Sample records for desenvolvimento da larva

  1. Trichinella spiralis: strong antibody response to a 49 kDa newborn larva antigen in infected rats.


    Salinas-Tobon, Maria Del Rosario; Navarrete-Leon, Anaid; Mendez-Loredo, Blanca Esther; Esquivel-Aguirre, Dalia; Martínez-Abrajan, Dulce Maria; Hernandez-Sanchez, Javier


    In this work, we analyzed the kinetics of anti-Trichinella spiralis newborn larva (NBL) antibodies (Ab) and the antigenic recognition pattern of NBL proteins and its dose effects. Wistar rats were infected with 0, 700, 2000, 4000 and 8000 muscle larvae (ML) and bled at different time intervals up to day 31 post infection (p.i.). Ab production was higher with 2000 ML dose and decreased with 8000, 4000 and 700 ML. Abs were not detected until day 10, peaked on day 14 for the 2000 ML dose and on day 19 for the other doses and thereafter declined slowly from 19 to 31 days p.i. In contrast, Abs to ML increased from day 10, peaked on day 19 and remained high until the end of the study. Abs bound strongly at least to three NBL components of 188, 205 and 49 kDa. NBL antigen of 188 and 205 kDa were recognized 10-26 days p.i. and that of 49 kDa from day 10 to day 31 p.i. A weak recognition towards antigens of 52, 54, 62 and 83 kDa was also observed during the infection. An early recognition of 31, 43, 45, 55, 68 and 85 kDa ML antigens was observed whereas the response to those of 43, 45, 48, 60, 64 and 97 kDa (described previously as TSL-1 antigens) occurred late in the infection. A follow-up of antigen recognition up to day 61 with the optimal immunization dose (2000 ML) evidenced a decline of Ab production to the 49 kDa NBL antigen 42 days p.i., which suggested antigenic differences with the previously reported 43 kDa ML antigen strongly recognized late in the infection. To analyze the stage-specificity of the 49 kDa NBL antigen, polyclonal antibodies (PoAb) were obtained in rats immunized with 49 kDa NBL antigen. PoAb reacted strongly with the 49 kDa NBL component in NBL total soluble extract but no reactivity was observed with soluble antigen of the other T. spiralis stages. Albeit with less intensity, the 49 kDa component was also recognized by PoAb together with other antigens of 53, 97 and 107 kDa, in NBL excretory-secretory products (NBL-ESP). Thus, our results reveal

  2. [Larva migrans].


    Chabasse, D; Le Clec'h, C; de Gentile, L; Verret, J L


    Larbish, cutaneous larva migrans or creeping eruption, is a serpiginous cutaneous eruption caused by skin penetration of infective larva from various animal nematodes. Hookworms (Ancylostoma brasiliense, A. caninum) are the most common causative parasites. They live in the intestines of dogs and cats where their ova are deposited in the animal feces. In sandy and shady soil, when temperature and moisture are elevated, the ova hatch and mature into infective larva. Infection occurs when humans have contact with the infected soil. Infective larva penetrate the exposed skin of the body, commonly around the feet, hands and buttocks. In humans, the larva are not able to complete their natural cycle and remain trapped in the upper dermis of the skin. The disease is widespread in tropical or subtropical regions, especially along the coast on sandy beaches. The diagnosis is easy for the patient who is returning from a tropical or subtropical climate and gives a history of beach exposure. The characteristic skin lesion is a fissure or erythematous cord which is displaced a few millimeters each day in a serpiginous track. Scabies, the larva currens syndrome due to Strongyloides stercoralis, must be distinguished from other creeping eruptions and subcutaneous swelling lesions caused by other nematodes or myiasis. Medical treatments are justified because it shortens the duration of the natural evolution of the disease. Topical tiabendazole is safe for localized invasions, but prolonged treatment may be necessary. Oral thiabendazole treatment for three days is effective, but sometimes is associated with adverse effects. Trials using albendazole for one or four consecutive days appear more efficacious. More recent trials using ivermectine showed that a single oral dose can cure 100% of the patients; thus, this drug looks very promising as a new form of therapy. Individual prophylaxis consists of avoiding skin contact with soil which has been contaminated with dog or cat feces

  3. Prolactin-like hormone in the nematode Trichinella spiralis larvae.


    Quintanar, J Luis; Salinas, Eva; Guerrero, Raquel; Gómez, Rigoberto; Vidal, Sergio; Aranda, Jorge; Clapp, Carmen


    Expression of prolactin (PRL) or prolactin-like hormone has been reported in invertebrates. We investigated the larval phase of Trichinella spiralis: (a) to express 23 kDa PRL, (b) to define its localization and (c) to test its possible biological activity. Immunostaining in isolated larvae demonstrated positive material to 23 kDa PRL by all along the stichosome, specifically in the stichocytes. Homogenized immunoblot larvae showed a 23 kDa protein band. To assess PRL release and its biological activity, larvae were incubated in culture medium and the excretory/secretory products were analyzed by the Nb2 cells bioassay. A cellular growth equivalent until 10 nM PRL and using antibody against 23 kDa PRL, the growth was blocked. In conclusion our result provides evidence that PRL-like hormone is expressed and secreted by the larvae of T. spiralis.

  4. Working with dauer larvae.


    Karp, Xantha


    Dauer diapause is a stress-resistant, developmentally quiescent, and long-lived larval stage adopted by Caenorhabditis elegans when conditions are unfavorable for growth and reproduction. This chapter contains methods to induce dauer larva formation, to isolate dauer larvae, and to study pre- and post-dauer stages.

  5. Visceral larva migrans


    ... with certain parasites found in the intestines of dogs and cats. Causes Visceral larva migrans (VLM) is ... parasites) that are found in the intestines of dogs and cats. Eggs produced by these worms are ...

  6. Baylisascaris Larva Migrans

    USGS Publications Warehouse

    Kazacos, Kevin R.; Abbott, Rachel C.; Van Riper, Charles


    SummaryBaylisascaris procyonis, the common raccoon roundworm, is the most commonly recognized cause of clinical larva migrans (LM) in animals, a condition in which an immature parasitic worm or larva migrates in a host animal’s tissues, causing obvious disease. Infection with B. procyonis is best known as a cause of fatal or severe neurologic disease that results when the larvae invade the brain, the spinal cord, or both; this condition is known as neural larva migrans (NLM). Baylisascariasis is a zoonotic disease, that is, one that is transmissible from animals to humans. In humans, B. procyonis can cause damaging visceral (VLM), ocular (OLM), and neural larva migrans. Due to the ubiquity of infected raccoons around humans, there is considerable human exposure and risk of infection with this parasite. The remarkable disease-producing capability of B. procyonis in animals and humans is one of the most significant aspects of the biology of ascarids (large roundworms) to come to light in recent years. Infection with B. procyonis has important health implications for a wide variety of free-ranging and captive wildlife, zoo animals, domestic animals, as well as human beings, on both an individual and population level. This report, eighth in the series of U.S. Geological Survey Circulars on zoonotic diseases, will help us to better understand the routes of Baylisascaris procyonis infections and how best to adequately monitor this zoonotic disease.

  7. Purification and properties of a monomeric lactate dehydrogenase from yak Hypoderma sinense larva.


    Li, Pengfei; Jin, Suyu; Huang, Lin; Liu, Haohao; Huang, Zhihong; Lin, Yaqiu; Zheng, Yucai


    The objective of the present study was to study the characteristics of lactate dehydrogenase (LDH) from Hypoderma sinense larva. H. sinense larvae were collected from yak (Bos grunniens) and identified by a PCR-RFLP method. Analysis of LDH activity showed that the total LDH activity in H. sinense larva was negatively correlated with the length of larva. Polyacrylamide gel electrophoresis of the extracts of H. sinense larvae revealed one band of LDH, which was then purified by affinity chromatography and gel filtration. This enzyme showed an approximately 36 kDa band on SDS-gel under both reducing and non-reducing conditions, in addition, size exclusion chromatography analysis showed that its molecular weight was smaller than bovine serum albumin (67 kDa), indicating that it contains only one subunit. Michaelis constants (Km) values assay revealed that LDH from H. sinense larva showed significantly lower Km for lactate than other animals. LDH of H. sinense larva was stable at 60 °C for 15 min, and also exhibited high catalytic efficiency in a wide range of pH. HgCl₂ at the concentration of 0.1mM significantly decreased the activity of LDH from H. sinense larva but not at the concentration of 0.01 mM. The results of the present study demonstrate that LDH from H. sinense larva is a thermal stable and pH insensitive enzyme suitable for catalyzing both forward and reverse reactions.

  8. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758) (Squamata: Teiidae).


    Macedo, Lilian Cristina; Melo, Francisco Tiago de Vasconcelos; Ávila-Pires, Teresa Cristina Sauer; Giese, Elane Guerreiro; Santos, Jeannie Nascimento Dos


    Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the "Osvaldo Rodrigues da Cunha" Herpetology Collection of the Emílio Goeldi Museum, Belém, Pará, Brazil. The aim of this study was to present the morphological study of the Acanthocephala larvae found in A. ameiva ameiva lizard.

  9. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758) (Squamata: Teiidae).


    Macedo, Lilian Cristina; Melo, Francisco Tiago de Vasconcelos; Ávila-Pires, Teresa Cristina Sauer; Giese, Elane Guerreiro; dos Santos, Jeannie Nascimento


    Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the "Osvaldo Rodrigues da Cunha" Herpetology Collection of the Emílio Goeldi Museum, Belém, Pará, Brazil. The aim of this study was to present the morphological study of the Acanthocephala larvae found in A. ameiva ameiva lizard.

  10. Microgavage of Zebrafish Larvae

    PubMed Central

    Cocchiaro, Jordan L.; Rawls, John F.


    The zebrafish has emerged as a powerful model organism for studying intestinal development1-5, physiology6-11, disease12-16, and host-microbe interactions17-25. Experimental approaches for studying intestinal biology often require the in vivo introduction of selected materials into the lumen of the intestine. In the larval zebrafish model, this is typically accomplished by immersing fish in a solution of the selected material, or by injection through the abdominal wall. Using the immersion method, it is difficult to accurately monitor or control the route or timing of material delivery to the intestine. For this reason, immersion exposure can cause unintended toxicity and other effects on extraintestinal tissues, limiting the potential range of material amounts that can be delivered into the intestine. Also, the amount of material ingested during immersion exposure can vary significantly between individual larvae26. Although these problems are not encountered during direct injection through the abdominal wall, proper injection is difficult and causes tissue damage which could influence experimental results.We introduce a method for microgavage of zebrafish larvae. The goal of this method is to provide a safe, effective, and consistent way to deliver material directly to the lumen of the anterior intestine in larval zebrafish with controlled timing. Microgavage utilizes standard embryo microinjection and stereomicroscopy equipment common to most laboratories that perform zebrafish research. Once fish are properly positioned in methylcellulose, gavage can be performed quickly at a rate of approximately 7-10 fish/ min, and post-gavage survival approaches 100% depending on the gavaged material. We also show that microgavage can permit loading of the intestinal lumen with high concentrations of materials that are lethal to fish when exposed by immersion. To demonstrate the utility of this method, we present a fluorescent dextran microgavage assay that can be used to

  11. Behavioural fever in zebrafish larvae.


    Rey, Sonia; Moiche, Visila; Boltaña, Sebastian; Teles, Mariana; MacKenzie, Simon


    Behavioural fever has been reported in different species of mobile ectotherms including the zebrafish, Danio rerio, in response to exogenous pyrogens. In this study we report, to our knowledge for the first time, upon the ontogenic onset of behavioural fever in zebrafish (Danio rerio) larvae. For this, zebrafish larvae (from first feeding to juveniles) were placed in a continuous thermal gradient providing the opportunity to select their preferred temperature. The novel thermal preference aquarium was based upon a continuous vertical column system and allows for non-invasive observation of larvae vertical distribution under isothermal (TR at 28 °C) and thermal gradient conditions (TCH: 28-32 °C). Larval thermal preference was assessed under both conditions with or without an immersion challenge, in order to detect the onset of the behavioural fever response. Our results defined the onset of the dsRNA induced behavioural fever at 18-20 days post fertilization (dpf). Significant differences were observed in dsRNA challenged larvae, which prefer higher temperatures (1-4 °C increase) throughout the experimental period as compared to non-challenged larvae. In parallel we measured the abundance of antiviral transcripts; viperin, gig2, irf7, trim25 and Mxb mRNAs in dsRNA challenged larvae under both thermal regimes: TR and TCh. Significant increases in the abundance of all measured transcripts were recorded under thermal choice conditions signifying that thermo-coupling and the resultant enhancement of the immune response to dsRNA challenge occurs from 18 dpf onwards in the zebrafish. The results are of importance as they identify a key developmental stage where the neuro-immune interface matures in the zebrafish likely providing increased resistance to viral infection.

  12. Sediment bioassays with oyster larvae

    SciTech Connect

    Chapman, P.M.; Morgan, J.D.


    Tests with naturally-occurring sediments are rare and sediment testing methodology is not standardized. The authors present a simple methodology for undertaking sediment bioassays with oyster larvae, and present data from a recent study to prove the utility of this method.

  13. How the pilidium larva feeds

    PubMed Central


    Introduction The nemertean pilidium is a long-lived feeding larva unique to the life cycle of a single monophyletic group, the Pilidiophora, which is characterized by this innovation. That the pilidium feeds on small planktonic unicells seems clear; how it does so is unknown and not readily inferred, because it shares little morphological similarity with other planktotrophic larvae. Results Using high-speed video of trapped lab-reared pilidia of Micrura alaskensis, we documented a multi-stage feeding mechanism. First, the external ciliation of the pilidium creates a swimming and feeding current which carries suspended prey past the primary ciliated band spanning the posterior margins of the larval body. Next, the larva detects prey that pass within reach, then conducts rapid and coordinated deformations of the larval body to re-direct passing cells and surrounding water into a vestibular space between the lappets, isolated from external currents but not quite inside the larva. Once a prey cell is thus captured, internal ciliary bands arranged within this vestibule prevent prey escape. Finally, captured cells are transported by currents within a buccal funnel toward the stomach entrance. Remarkably, we observed that the prey of choice – various cultured cryptomonads – attempt to escape their fate. Conclusions The feeding mechanism deployed by the pilidium larva coordinates local control of cilia-driven water transport with sensorimotor behavior, in a manner clearly distinct from any other well-studied larval feeding mechanisms. We hypothesize that the pilidium’s feeding strategy may be adapted to counter escape responses such as those deployed by cryptomonads, and speculate that similar needs may underlie convergences among disparate planktotrophic larval forms. PMID:23927417

  14. Workbook on the Identification of Mosquito Larvae.

    ERIC Educational Resources Information Center

    Pratt, Harry D.; And Others

    This self-instructional booklet is designed to enable public health workers identify larvae of some important North American mosquito species. The morphological features of larvae of the various genera and species are illustrated in a programed booklet, which also contains illustrated taxonomic keys to the larvae of 11 North American genera and to…

  15. Simultaneous Larva Migrans and Larva Currens Caused by Strongyloides stercoralis: A Case Report

    PubMed Central

    Corte, Liliam Dalla; da Silva, Mariana Vale Scribel; Souza, Paulo Ricardo Martins


    Strongyloidiasis is an infectious disease caused by the Strongyloides stercoralis larvae, which penetrate the skin, go through the lymphatic circulation, and migrate to the lungs before reaching the intestines. They mature and may cause cutaneous strongyloidiasis, known as larva currens because of the quick migratory rate of the larva. The authors describe a case in which the larvae did not follow their natural lymph route, and after penetrating into the intertriginous area, they migrated to the dermis, developing larva migrans in the early phase, and later associated with the typical lesions of larva currens. The diagnosis was confirmed by the presence of larva in the skin biopsy. PMID:23476820

  16. Ecophysiology of dorsal versus ventral cuticle in flattened sawfly larvae

    NASA Astrophysics Data System (ADS)

    Boevé, Jean-Luc; Angeli, Sergio


    Platycampus larvae are highly cryptic leaf feeders characterised by a dorso-ventrally flattened body, the dorsal integument resembling a shield. Dorsal and ventral cuticles from Platycampus luridiventris were compared by histology and gel electrophoresis. By Azan-staining, a red and a blue layer were distinguished in the dorsal cuticle, while the ventral cuticle showed one, almost uniform blue layer, as in both cuticles of control species. The two cuticles from P. luridiventris had similar amounts and sodium dodecyl sulphate-polyacrylamide gel electrophoresis profiles of soluble proteins, but not insoluble proteins. One insoluble protein (MW ≈ 41 kDa) was visible as a large band in the ventral cuticle only. It is likely that this protein renders the cuticle elastic, and that the dorsal, red layer is the exocuticle, mainly composed of insoluble proteins. We discuss eco-physiological implications of the exocuticle in insects. Further, data from the literature indicate that the defence strategy in P. luridiventris larvae relies on being visually cryptic towards avian predators and tactically cryptic towards arthropod predators and parasitoids. Crypsis in both senses is favoured by the shield effect, itself based on an abnormally thick dorsal exocuticle. Although the larvae are external feeders, they may be considered as hidden from an ecological perspective.

  17. Biology of Paenibacillus larvae, a deadly pathogen of honey bee larvae.


    Ebeling, Julia; Knispel, Henriette; Hertlein, Gillian; Fünfhaus, Anne; Genersch, Elke


    The gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood of honey bees, a notifiable disease in many countries. Hence, P. larvae can be considered as an entomopathogen of considerable relevance in veterinary medicine. P. larvae is a highly specialized pathogen with only one established host, the honey bee larva. No other natural environment supporting germination and proliferation of P. larvae is known. Over the last decade, tremendous progress in the understanding of P. larvae and its interactions with honey bee larvae at a molecular level has been made. In this review, we will present the recent highlights and developments in P. larvae research and discuss the impact of some of the findings in a broader context to demonstrate what we can learn from studying "exotic" pathogens.

  18. Single stimulus learning in zebrafish larvae

    PubMed Central

    O’Neale, Ashley; Ellis, Joseph; Creton, Robbert; Colwill, Ruth M.


    Learning about a moving visual stimulus was examined in zebrafish larvae using an automated imaging system and a t1-t2 design. In three experiments, zebrafish larvae were exposed to one of two inputs at t1 (either a gray bouncing disk or an identical but stationary disk) followed by a common test at t2 (the gray bouncing disk). Using 7 days post-fertilization (dpf) larvae and 12 stimulus exposures, Experiment 1 established that these different treatments produced differential responding to the moving disk during testing. Larvae familiar with the moving test stimulus were significantly less likely to be still in its presence than larvae that had been exposed to the identical but stationary stimulus. Experiment 2 confirmed this result in 7 dpf larvae and extended the finding to 5 and 6 dpf larvae. Experiment 3 found differential responding to the moving test stimulus with 4 or 8 stimulus exposures but not with just one exposure in 7 dpf larvae. These results provide evidence for learning in very young zebrafish larvae. The merits and challenges of the t1-t2 framework to study learning are discussed. PMID:24012906

  19. Differentiation of larva migrans caused by Baylisascaris procyonis and Toxocara species by Western blotting.


    Dangoudoubiyam, Sriveny; Kazacos, Kevin R


    Baylisascaris procyonis and Toxocara species are two important causes of larva migrans in humans. Larva migrans caused by Toxocara spp. is well known and is diagnosed serologically by enzyme immunoassay. Over a dozen cases of larva migrans and associated eosinophilic encephalitis caused by B. procyonis have also been reported, and at least a dozen additional cases are known. An enzyme-linked immunosorbent assay (ELISA) using the excretory-secretory (ES) antigen of B. procyonis larvae is currently being used in our laboratory as an aid in the diagnosis of this infection in humans. Clinically affected individuals show very high reactivity (measured as the optical density) on this ELISA; however, a one-way cross-reactivity with Toxocara spp. has been observed. As an approach to differentiate these two infections based on serology, we performed Western blots, wherein the B. procyonis ES antigen was reacted with serum samples from individuals known to be positive for either Toxocara spp. or B. procyonis larva migrans. Western blot results showed that B. procyonis antigens of between 30 and 45 kDa were specifically identified only by the sera from individuals with Baylisascaris larva migrans, thus allowing for differentiation between the two infections. This included human patient serum samples submitted for serologic testing, as well as sera from rabbits experimentally infected with B. procyonis. When used in conjunction with the ELISA, Western blotting could be an efficient tool for diagnosis of this infection in humans.

  20. Workbook on Identification of Aedes Aegypti Larvae.

    ERIC Educational Resources Information Center

    Pratt, Harry D.; And Others

    This self-instructional booklet is designed to enable yellow fever control workers to identify the larvae of "Aedes aegypti." The morphological features of mosquito larvae are illustrated in this partially programed text, and the distinguishing features of "A. aegypti" indicated. A glossary is included. (AL)

  1. Behavior of Settling Marine Larvae in Flow

    NASA Astrophysics Data System (ADS)

    Hernandez, J.; Koehl, M. A.


    Many bottom-dwelling marine animals produce microscopic larvae that are dispersed by ambient water currents. These larvae can only recruit to habitats on which they have landed if they can resist being washed away by ambient water flow. We found that larvae on marine surfaces do not experience steady water flow, but rather are exposed to brief pulses of water movement as turbulent eddies sweep across them. We made video recordings of larvae of the tube worm, Hydroides elegans, (important members of the community of organisms growing on docks and ships) on surfaces subjected to measured realistic flow pulses to study factors that might affect their dislodgement from surfaces in nature. We found that the response of a larva of H. elegans to a realistic pulse of water flow depended on its behavior at the time of the pulse and on its recent history of exposure to flow pulses, and that stationary larvae were less likely than locomoting larvae to be blown away when hit by the first pulse of water flow.; ;

  2. Hyperparasitism of mosquitoes by water mite larvae.


    Werblow, Antje; Martin, Peter; Dörge, Dorian D; Koch, Lisa K; Mehlhorn, Heinz; Melaun, Christian; Klimpel, Sven


    Hyperparasitism of ectoparasitic water mite larvae on mosquitoes is still a neglected relationship and was investigated only in a few studies. We analysed 2313 female mosquitoes from six different sampling localities with regard to their degree of parasitism with water mite larvae. In total, we found 38 mosquito individuals parasitized by 93 water mite larvae, ranging from 1 to 12 larvae per mosquito. Water mite larvae detected are members of the two species Parathyas cf. barbigera (n = 92) and Arrenurus cf. globator (n = 1). Out of the analysed mosquitoes, individuals out of the species Aedes vexans, Anopheles claviger, Ochlerotatus communis, the Ochlerotatus cantans/annulipes group, Ochlerotatus cataphylla and Ochlerotatus sticticus were tested to be parasitized by water mite larvae. The highest prevalence was found within the species Oc. cataphylla (28.6 %) and Oc. cantans/annulipes (21.7 %). No water mite larvae were found, e.g. on individuals of Aedes cinereus, Coquillettidia richiardii, the Culex pipiens/torrentium group, Ochlerotatus caspius, Ochlerotatus dorsalis or Ochlerotatus punctor. All of the attachment sites were located between the neck and abdomen with the ventral thorax site being the most frequent one.

  3. Cutaneous Larva Migrans in Early Infancy

    PubMed Central

    Siddalingappa, Karjigi; Murthy, Sambasiviah Chidambara; Herakal, Kallappa; Kusuma, Marganahalli Ramachandra


    Cutaneous larva migrans or creeping eruptions is a cutaneous dermatosis caused by hookworm larvae, Ancylostoma braziliense. A 2-month-old female child presented with a progressive rash over the left buttock of 4 days duration. Cutaneous examination showed an urticarial papule progressing to erythematous, tortuous, thread-like tract extending a few centimeters from papule over the left gluteal region. A clinical diagnosis of cutaneous larva migrans was considered. Treatment with albendazole led to complete resolution, confirming the diagnosis. This is to the best of our knowledge, the youngest age at which this condition is being reported. PMID:26538729

  4. TIME management by medicinal larvae.


    Pritchard, David I; Čeřovský, Václav; Nigam, Yamni; Pickles, Samantha F; Cazander, Gwendolyn; Nibbering, Peter H; Bültemann, Anke; Jung, Wilhelm


    Wound bed preparation (WBP) is an integral part of the care programme for chronic wounds. The acronym TIME is used in the context of WBP and describes four barriers to healing in chronic wounds; namely, dead Tissue, Infection and inflammation, Moisture imbalance and a non-migrating Edge. Larval debridement therapy (LDT) stems from observations that larvae of the blowfly Lucilia sericata clean wounds of debris. Subsequent clinical studies have proven debriding efficacy, which is likely to occur as a result of enzymatically active alimentary products released by the insect. The antimicrobial, anti-inflammatory and wound healing activities of LDT have also been investigated, predominantly in a pre-clinical context. This review summarises the findings of investigations into the molecular mechanisms of LDT and places these in context with the clinical concept of WBP and TIME. It is clear from these findings that biotherapy with L. sericata conforms with TIME, through the enzymatic removal of dead tissue and its associated biofilm, coupled with the secretion of defined antimicrobial peptides. This biotherapeutic impact on the wound serves to reduce inflammation, with an associated capacity for an indirect effect on moisture imbalance. Furthermore, larval serine proteinases have the capacity to alter fibroblast behaviour in a manner conducive to the formation of granulation tissue.

  5. Lethal infection thresholds of Paenibacillus larvae for honeybee drone and worker larvae (Apis mellifera).


    Behrens, Dieter; Forsgren, Eva; Fries, Ingemar; Moritz, Robin F A


    We compared the mortality of honeybee (Apis mellifera) drone and worker larvae from a single queen under controlled in vitro conditions following infection with Paenibacillus larvae, a bacterium causing the brood disease American Foulbrood (AFB). We also determined absolute P. larvae cell numbers and lethal titres in deceased individuals of both sexes up to 8 days post infection using quantitative real-time PCR (qPCR). Our results show that in drones the onset of infection induced mortality is delayed by 1 day, the cumulative mortality is reduced by 10% and P. larvae cell numbers are higher than in worker larvae. Since differences in bacterial cell titres between sexes can be explained by differences in body size, larval size appears to be a key parameter for a lethal threshold in AFB tolerance. Both means and variances for lethal thresholds are similar for drone and worker larvae suggesting that drone resistance phenotypes resemble those of related workers.

  6. Pathogenicity of Isolates of Serratia Marcescens towards Larvae of the Scarab Phyllophaga Blanchardi (Coleoptera)

    PubMed Central

    Pineda-Castellanos, Mónica L.; Rodríguez-Segura, Zitlhally; Villalobos, Francisco J.; Hernández, Luciano; Lina, Laura; Nuñez-Valdez, M. Eugenia


    Serratia marcescens is a Gram negative bacterium (Enterobacteriaceae) often associated with infection of insects. In order to find pathogenic bacteria with the potential to control scarab larvae, several bacterial strains were isolated from the hemocoel of diseased Phyllophaga spp (Coleoptera:Scarabaeidae) larvae collected from cornfields in Mexico. Five isolates were identified as Serratia marcescens by 16S rRNA gene sequencing and biochemical tests. Oral and injection bioassays using healthy Phyllophaga blanchardi larvae fed with the S. marcescens isolates showed different degrees of antifeeding effect and mortality. No insecticidal activity was observed for Spodoptera frugiperda larvae (Lepidoptera: Noctuidae) by oral inoculation. S. marcescens (Sm81) cell-free culture supernatant caused significant antifeeding effect and mortality to P. blanchardi larvae by oral bioassay and also mortality by injection bioassay. Heat treated culture broths lost the ability to cause disease symptoms, suggesting the involvement of proteins in the toxic activity. A protein of 50.2 kDa was purified from the cell-free broth and showed insecticidal activity by injection bioassay towards P. blanchardi. Analysis of the insecticidal protein by tandem- mass spectrometry (LC-MS/MS) showed similarity to a Serralysin-like protein from S. marcescens spp. This insecticidal protein could have applications in agricultural biotechnology. PMID:25984910

  7. Dispersal strategies in sponge larvae: integrating the life history of larvae and the hydrologic component.


    Mariani, Simone; Uriz, María-J; Turon, Xavier; Alcoverro, Teresa


    While known to be uniformly non-feeding, short-lived, and potentially short dispersing, sponge larvae display different behaviours (swimming ability and taxis). Our aim was to show whether sponge larvae with different behaviours exhibit different dispersal strategies under variable intensity of water movements. We first assessed the distribution of larvae of six taxa: Dictyoceratida spp., Dysidea avara, Crambe crambe, Phorbas tenacior, Scopalina lophyropoda, and Cliona viridis, collected through plankton sampling, and the abundance of the corresponding adult sponges across three hard bottom communities and a sandy bottom from a north-west Mediterranean rocky shore. We then tested adult-larvae couplings (abundance of larvae vs abundance of adults) under increasing levels of water movements (surge) to assess the importance of this environmental factor in driving differences in dispersal strategies. Adults of Dictyoceratida spp., D. avara, and P. tenacior were most abundant in semi-dark caves (SDC), C. crambe and C. viridis in communities of sciaphilic algae (SA), whereas the distribution of S. lophyropoda was extremely patchy, being present almost only in the SA community of one of the five stations studied. Larvae of Dictyoceratida spp. and P. tenacior were more abundant in the SDC, whereas D. avara and C. crambe were homogeneously distributed across the communities. The larvae of C. viridis were more abundant in the SA communities and the S. lophyropoda larvae were mostly present in one station and one community (SA). Increased water movement did not modify the adult-larvae coupling for Dictyoceratida spp., D. avara, and C. crambe, whereas it broke up the positive association for P. tenacior and to some extent S. lophyropoda. For C. viridis, possible variability in adult-larvae coupling was not tested because the larvae were collected on only one day under calm sea conditions. We confirm that efficient-swimming larvae with some cue response can actively counteract

  8. Rearing Chrysoperla externa Larvae on Artificial Diets.


    Bezerra, C E S; Amaral, B B; Souza, B


    We tested three artificial diets for rearing larvae of Chrysoperla externa (Hagen) (Neuroptera: Chrysopidae), aiming at reducing the production costs of this predator. Two of the diets come from studies with other species of lacewings, and the third is a modification described in this paper. All diets were based on animal protein and were supplied to 2nd and 3rd instar larvae, whereas 1st instar larvae received eggs of Anagasta kuehniella (Zeller) (Lepidoptera: Pyralidae). We evaluated the preimaginal duration and survival, adult size, longevity and fecundity, egg hatchability, and predatory capacity of larvae produced. The performance of the diets was followed for seven generations. The diet we describe showed to be the best among the artificial diets tested. Our results show that C. externa can be successfully reared on artificial diets during second and third instars, reducing in 90% the dependency on eggs of A. kuehniella.

  9. Activity of R(+) Limonene Against Anisakis Larvae

    PubMed Central

    Muscolino, Daniele; Panebianco, Felice; Patania, Andrea; Benianti, Chiara; Ziino, Graziella; Giuffrida, Alessandro


    The aim of this work is to evaluate the activity of R(+) limonene of against Anisakidae larvae. Its effectiveness was tested in vitro. The results obtained showed a significant activity of the compound against Anisakis larvae, suggesting further investigation on its potential use in the industrial marinating process. In this regard, the use of R(+) limonene in seafood products could be interesting, also due the sensory attributes resulting from its use and its relatively safe status. PMID:27800423

  10. Transcriptional response of honey bee larvae infected with the bacterial pathogen Paenibacillus larvae

    Technology Transfer Automated Retrieval System (TEKTRAN)

    American foulbrood disease of honey bees is caused by the bacterium Paenibacillus larvae. Infection occurs per os in larvae and systemic infection requires a breaching of the host peritrophic matrix and midgut epithelium. Genetic variation exists for both bacterial virulence and host resistance, and...

  11. Chironomidae bloodworms larvae as aquatic amphibian food.


    Fard, Mojdeh Sharifian; Pasmans, Frank; Adriaensen, Connie; Laing, Gijs Du; Janssens, Geert Paul Jules; Martel, An


    Different species of chironomids larvae (Diptera: Chironomidae) so-called bloodworms are widely distributed in the sediments of all types of freshwater habitats and considered as an important food source for amphibians. In our study, three species of Chironomidae (Baeotendipes noctivagus, Benthalia dissidens, and Chironomus riparius) were identified in 23 samples of larvae from Belgium, Poland, Russia, and Ukraine provided by a distributor in Belgium. We evaluated the suitability of these samples as amphibian food based on four different aspects: the likelihood of amphibian pathogens spreading, risk of heavy metal accumulation in amphibians, nutritive value, and risk of spreading of zoonotic bacteria (Salmonella, Campylobacter, and ESBL producing Enterobacteriaceae). We found neither zoonotic bacteria nor the amphibian pathogens Ranavirus and Batrachochytrium dendrobatidis in these samples. Our data showed that among the five heavy metals tested (Hg, Cu, Cd, Pb, and Zn), the excess level of Pb in two samples and low content of Zn in four samples implicated potential risk of Pb accumulation and Zn inadequacy. Proximate nutritional analysis revealed that, chironomidae larvae are consistently high in protein but more variable in lipid content. Accordingly, variations in the lipid: protein ratio can affect the amount and pathway of energy supply to the amphibians. Our study indicated although environmentally-collected chironomids larvae may not be vectors of specific pathogens, they can be associated with nutritional imbalances and may also result in Pb bioaccumulation and Zn inadequacy in amphibians. Chironomidae larvae may thus not be recommended as single diet item for amphibians.

  12. Ventral nerve cord in Phoronopsis harmeri larvae.


    Temereva, Elena N


    The nervous system organization is considered a phylogenetically important character among metazoans. The phylum Phoronida is included in a supraphyletic taxon known as Lophotrochozoa. Many lophotrochozoans possess a metameric ventral nerve cord as adults or larvae. Phoronids do not exhibit external metamery either as larvae or as adults. The current study describes the ventral nerve cord in the young larva of Phoronopsis harmeri. This structure is apparent both in the serotonergic and FMRF-amidergic nervous system in young larvae. The ventral nerve cord extends from the mouth to the tentacular ridge. Both serotonergic and FMRF-amidergic components consist of two ventrolateral nerves, each with several unipolar neurons. The ventrolateral nerves connect to each other by means of thin repetitive transversal nerves ("commissures"). The abundance of neurons and nerves in the epidermis of the oral field of actinotrocha larva likely reflects the importance of this area in collection of food particles. The ventral nerve cords of the actinotrocha and the metatrochophore differ in their positions with respect to ciliated bands: the cord is located between the preoral and postoral ciliated bands in the actinotrocha but between the postoral ciliated band and telotroch in the metatrochophore. The presence of the ventral nerve cord, which contains repetitive elements (neurons and "commissures"), in the early development of P. harmeri may recapitulate some stages of nervous system development during phoronid phylogeny. The larval nervous system does not contain nervous centers under the tentacular ridge that can correlate with the catastrophic metamorphosis and unique body plan of phoronids.

  13. Quantifying and predicting Drosophila larvae crawling phenotypes

    PubMed Central

    Günther, Maximilian N.; Nettesheim, Guilherme; Shubeita, George T.


    The fruit fly Drosophila melanogaster is a widely used model for cell biology, development, disease, and neuroscience. The fly’s power as a genetic model for disease and neuroscience can be augmented by a quantitative description of its behavior. Here we show that we can accurately account for the complex and unique crawling patterns exhibited by individual Drosophila larvae using a small set of four parameters obtained from the trajectories of a few crawling larvae. The values of these parameters change for larvae from different genetic mutants, as we demonstrate for fly models of Alzheimer’s disease and the Fragile X syndrome, allowing applications such as genetic or drug screens. Using the quantitative model of larval crawling developed here we use the mutant-specific parameters to robustly simulate larval crawling, which allows estimating the feasibility of laborious experimental assays and aids in their design. PMID:27323901

  14. Sensorimotor structure of Drosophila larva phototaxis.


    Kane, Elizabeth A; Gershow, Marc; Afonso, Bruno; Larderet, Ivan; Klein, Mason; Carter, Ashley R; de Bivort, Benjamin L; Sprecher, Simon G; Samuel, Aravinthan D T


    The avoidance of light by fly larvae is a classic paradigm for sensorimotor behavior. Here, we use behavioral assays and video microscopy to quantify the sensorimotor structure of phototaxis using the Drosophila larva. Larval locomotion is composed of sequences of runs (periods of forward movement) that are interrupted by abrupt turns, during which the larva pauses and sweeps its head back and forth, probing local light information to determine the direction of the successive run. All phototactic responses are mediated by the same set of sensorimotor transformations that require temporal processing of sensory inputs. Through functional imaging and genetic inactivation of specific neurons downstream of the sensory periphery, we have begun to map these sensorimotor circuits into the larval central brain. We find that specific sensorimotor pathways that govern distinct light-evoked responses begin to segregate at the first relay after the photosensory neurons.

  15. Sensorimotor structure of Drosophila larva phototaxis

    PubMed Central

    Kane, Elizabeth A.; Gershow, Marc; Afonso, Bruno; Larderet, Ivan; Klein, Mason; Carter, Ashley R.; de Bivort, Benjamin L.; Sprecher, Simon G.; Samuel, Aravinthan D. T.


    The avoidance of light by fly larvae is a classic paradigm for sensorimotor behavior. Here, we use behavioral assays and video microscopy to quantify the sensorimotor structure of phototaxis using the Drosophila larva. Larval locomotion is composed of sequences of runs (periods of forward movement) that are interrupted by abrupt turns, during which the larva pauses and sweeps its head back and forth, probing local light information to determine the direction of the successive run. All phototactic responses are mediated by the same set of sensorimotor transformations that require temporal processing of sensory inputs. Through functional imaging and genetic inactivation of specific neurons downstream of the sensory periphery, we have begun to map these sensorimotor circuits into the larval central brain. We find that specific sensorimotor pathways that govern distinct light-evoked responses begin to segregate at the first relay after the photosensory neurons. PMID:24043822

  16. Quantifying and predicting Drosophila larvae crawling phenotypes.


    Günther, Maximilian N; Nettesheim, Guilherme; Shubeita, George T


    The fruit fly Drosophila melanogaster is a widely used model for cell biology, development, disease, and neuroscience. The fly's power as a genetic model for disease and neuroscience can be augmented by a quantitative description of its behavior. Here we show that we can accurately account for the complex and unique crawling patterns exhibited by individual Drosophila larvae using a small set of four parameters obtained from the trajectories of a few crawling larvae. The values of these parameters change for larvae from different genetic mutants, as we demonstrate for fly models of Alzheimer's disease and the Fragile X syndrome, allowing applications such as genetic or drug screens. Using the quantitative model of larval crawling developed here we use the mutant-specific parameters to robustly simulate larval crawling, which allows estimating the feasibility of laborious experimental assays and aids in their design.

  17. Quantifying and predicting Drosophila larvae crawling phenotypes

    NASA Astrophysics Data System (ADS)

    Günther, Maximilian N.; Nettesheim, Guilherme; Shubeita, George T.


    The fruit fly Drosophila melanogaster is a widely used model for cell biology, development, disease, and neuroscience. The fly’s power as a genetic model for disease and neuroscience can be augmented by a quantitative description of its behavior. Here we show that we can accurately account for the complex and unique crawling patterns exhibited by individual Drosophila larvae using a small set of four parameters obtained from the trajectories of a few crawling larvae. The values of these parameters change for larvae from different genetic mutants, as we demonstrate for fly models of Alzheimer’s disease and the Fragile X syndrome, allowing applications such as genetic or drug screens. Using the quantitative model of larval crawling developed here we use the mutant-specific parameters to robustly simulate larval crawling, which allows estimating the feasibility of laborious experimental assays and aids in their design.

  18. Incidence of ascaridoid larvae in Kuwaiti food fishes.


    Sey, O; Petter, A J


    Three hundred and six fish of 83 species were carefully examined in Kuwait during the period from October 1992 to September 1995 for ascaridoid larvae. Thirty-nine fishes (12.7%) belonging to 23 species were infected with 9 types of ascaridoid third-stage larvae: Anisakis simplex, Terranva spp, Contracaecum spp and 6 different types of Hysterothylacium spp (KA-KF). Hysterothylacium larvae (including all types) were found in all the infected fish except one (94.6%); Terranova larvae were found in 12 fishes (10 species, 56.1%); Anisakis simplex larvae occurred in 2 fishes (2 species, 8.6%) and Contracaecum spp larvae in one fish only.

  19. Predators induce cloning in echinoderm larvae.


    Vaughn, Dawn; Strathmann, Richard R


    Asexual propagation (cloning) is a widespread reproductive strategy of plants and animals. Although larval cloning is well documented in echinoderms, identified stimuli for cloning are limited to those associated with conditions favorable for growth and reproduction. Our research shows that larvae of the sand dollar Dendraster excentricus also clone in response to cues from predators. Predator-induced clones were smaller than uncloned larvae, suggesting an advantage against visual predators. Our results offer another ecological context for asexual reproduction: rapid size reduction as a defense.

  20. Attraction to and learning from social cues in fruitfly larvae.


    Durisko, Zachary; Dukas, Reuven


    We examined the use of social information in fruitfly larvae, which represent an ideal model system owing to their robust learning abilities, small number of neurons and well-studied neurogenetics. Focal larvae showed attraction to the distinct odour emanating from food occupied by other larvae. In controlled learning experiments, focal larvae preferred novel odours previously paired with food occupied by other larvae over novel odours previously paired with unoccupied food. When we gave groups of larvae a choice between food patches differing in quality, more larvae aggregated on the higher-quality food, suggesting that attraction to and learning about cues associated with other larvae can be beneficial. Furthermore, larvae were more likely to find the best available food patch in trials when that food patch was occupied by other larvae than in trials when that food patch was unoccupied. Our data suggest, however, that the benefits from joining others may be at least partially offset by the fitness costs of increased competition, because larvae reared in isolation did as well as or better than larvae reared in groups on three key fitness parameters: developmental rate, survival rate and adult dry body mass. Our work establishes fruitfly larvae as a highly tractable model species for further research on the mechanisms that modulate behaviour and learning in a social context.

  1. Suppressing bullfrog larvae with carbon dioxide

    USGS Publications Warehouse

    Gross, Jackson A.; Ray, Andrew; Sepulveda, Adam J.; Watten, Barnaby J.; Densmore, Christine L.; Layhee, Megan J.; Mark Abbey-Lambert,; ,


    Current management strategies for the control and suppression of the American Bullfrog (Lithobates catesbeianus = Rana catesbeiana Shaw) and other invasive amphibians have had minimal effect on their abundance and distribution. This study evaluates the effects of carbon dioxide (CO2) on pre- and prometamorphic Bullfrog larvae. Bullfrogs are a model organism for evaluating potential suppression agents because they are a successful invader worldwide. From experimental trials we estimated that the 24-h 50% and 99% lethal concentration (LC50 and LC99) values for Bullfrog larvae were 371 and 549 mg CO2/L, respectively. Overall, larvae that succumbed to experimental conditions had a lower body condition index than those that survived. We also documented sublethal changes in blood chemistry during prolonged exposure to elevated CO2. Specifically, blood pH decreased by more than 0.5 pH units after 9 h of exposure and both blood partial pressure of CO2 (pCO2) and blood glucose increased. These findings suggest that CO2 treatments can be lethal to Bullfrog larvae under controlled laboratory conditions. We believe this work represents the necessary foundation for further consideration of CO2 as a potential suppression agent for one of the most harmful invaders to freshwater ecosystems.

  2. Evolution of foraging behavior in Drosophilid larvae

    NASA Astrophysics Data System (ADS)

    Rivera-Alba, Marta; Kabra, Mayank; Branson, Kristin; Mirth, Christen


    Drosophilids, like other insects, go through a larval phase before metamorphosing into adults. Larvae increase their body weight by several orders of magnitude in a few days. We therefore hypothesized that foraging behavior is under strong evolutionary pressure to best fit the larval environment. To test our hypothesis we used a multidisciplinary approach to analyze foraging behavior across species and larval stages. First, we recorded several videos of larvae foraging for each of 47 Drosophilid species. Then, using a supervised machine learning approach, we automatically annotated the video collection for the foraging sub-behaviors, including crawling, turning, head casting or burrowing. We also computed over 100 features to describe the posture and dynamics of each animal in each video frame. From these data, we fit models to the behavior of each species. The models each had the same parametric form, but differed in the exact parameters. By simulating larva behavior in virtual arenas we can infer which properties of the environments are better for each species. Comparisons between these inferred environments and the actual environments where these animals live will give us a deeper understanding about the evolution of foraging behavior in Drosophilid larvae.

  3. DMAP-85: a tau-like protein from Drosophila melanogaster larvae.


    Cambiazo, V; González, M; Maccioni, R B


    Microtubule-associated proteins (MAPs) play major regulatory roles in the organization and integrity of the cytoskeletal network. Our main interest in this study was the identification and the analysis of structural and functional aspects of Drosophila melanogaster MAPs. A novel MAP with a relative molecular mass of 85 kDa from Drosophila larvae was found associated with taxol-polymerized microtubules. In addition, this protein bound to mammalian tubulin in an overlay assay and coassembled with purified bovine brain tubulin in microtubule sedimentation experiments. The estimated stoichiometry of 85-kDa protein versus tubulin in the polymers was 1:5.3 +/- 0.2 mol/mol. It was shown that the 85-kDa protein bound specifically to an affinity column of Sepharose-beta II-(422-434) tubulin peptide, which contains the sequence of the MAP binding domain on beta II-tubulin. Affinity-purified 85-kDa protein enhanced microtubule assembly in a concentration-dependent manner. This effect was significantly decreased by the presence of the beta II-(422-434) peptide in the assembly assays, thus confirming the specificity of the 85-kDa protein interaction with the C-terminal domain on tubulin. Furthermore, this protein also exhibited a strong affinity for calmodulin, based on affinity chromatographic assays. Monoclonal and polyclonal anti-tau antibodies, including sequence-specific probes that recognize repeated microtubule-binding motifs on tau, MAP-2, and MAP-4 and specific N-terminal sequences of tau, cross-reacted with the 85-kDa protein from Drosophila larvae. These results suggest that tau and Drosophila 85-kDa protein share common functional and structural epitopes. We have named this protein as DMAP-85 for Drosophila MAP.(ABSTRACT TRUNCATED AT 250 WORDS)

  4. Appetitive associative olfactory learning in Drosophila larvae.


    Apostolopoulou, Anthi A; Widmann, Annekathrin; Rohwedder, Astrid; Pfitzenmaier, Johanna E; Thum, Andreas S


    In the following we describe the methodological details of appetitive associative olfactory learning in Drosophila larvae. The setup, in combination with genetic interference, provides a handle to analyze the neuronal and molecular fundamentals of specifically associative learning in a simple larval brain. Organisms can use past experience to adjust present behavior. Such acquisition of behavioral potential can be defined as learning, and the physical bases of these potentials as memory traces. Neuroscientists try to understand how these processes are organized in terms of molecular and neuronal changes in the brain by using a variety of methods in model organisms ranging from insects to vertebrates. For such endeavors it is helpful to use model systems that are simple and experimentally accessible. The Drosophila larva has turned out to satisfy these demands based on the availability of robust behavioral assays, the existence of a variety of transgenic techniques and the elementary organization of the nervous system comprising only about 10,000 neurons (albeit with some concessions: cognitive limitations, few behavioral options, and richness of experience questionable). Drosophila larvae can form associations between odors and appetitive gustatory reinforcement like sugar. In a standard assay, established in the lab of B. Gerber, animals receive a two-odor reciprocal training: A first group of larvae is exposed to an odor A together with a gustatory reinforcer (sugar reward) and is subsequently exposed to an odor B without reinforcement. Meanwhile a second group of larvae receives reciprocal training while experiencing odor A without reinforcement and subsequently being exposed to odor B with reinforcement (sugar reward). In the following both groups are tested for their preference between the two odors. Relatively higher preferences for the rewarded odor reflect associative learning--presented as a performance index (PI). The conclusion regarding the associative

  5. Carabid larvae as predators of weed seeds: granivory in larvae of Amara eurynota (Coleoptera: Carabidae).


    Saska, Pavel


    Up to date we do not have much information about predation on seeds by larvae of ground beetles. One of the reasons why such knowledge is important is that granivorous larvae contribute to predation of weed seeds. In this study, the food requirements of larvae of autumn breeding carabid species Amara eurynota (Panzer) were investigated in the laboratory and a hypothesis, that they are granivorous was tested. Insect diet (Tenebrio molitor larvae), three seed diets (seeds of Artemisia vulgaris, Tripleurospermum inodorum or Urtica dioica or a mixed diet (T. molitor + A. uulgaris) were used as food. For larvae of A. eurynota, seeds are essential for successful completion of development, because all those fed pure insect diet died before pupation. However, differences in suitability were observed between pure seed diets. Larvae fed seeds of A. vulgaris had the lowest mortality and fastest development of the seed diets. Those fed seeds of T. inodorum had also low mortality, but the development was prolonged in the third instar. In contrast, development of larvae reared on seeds of U. dioica was slowest of the tested diets and could not be completed, as all individuals died before pupation. When insects were included to seed diet of A. vulgaris (mixed diet), the duration of development shortened, but mortality remained the same when compared to seed diet of A. vulgaris. According to the results it was concluded that larvae of A. eurynota are granivorous. A mixed diet and seed diets of A. uulgaris and T. inodorum were suitable and insect diet and seeds of U. dioica were unsuitable diets in this experiment.

  6. [Larvae of barnacles (Cirripedia: Thoracica) in the White sea plankton].


    Poltarukha, O P


    The barnacle fauna in the White Sea is briefly described. The morphology of barnacle larvae in this water body is comparatively analyzed. The characters important for the larvae identification are given particular attention. A classification key was developed for the nauplius and cyprid larvae of barnacles in the White Sea.

  7. Workbook on the Identification of Anopheles Larvae. Preliminary Issue.

    ERIC Educational Resources Information Center

    Pratt, Harry D.; Stojanovich, Chester J.

    This self-instructional booklet is designed to enable malarial control workers to identify the larvae of "Anopheles" species that are important malaria vectors. The morphological features of the larvae are illustrated in a programed booklet, which also contains an illustrated taxonomic key to 25 species of anopheline larvae. A glossary and a short…

  8. An Introduction to the Identification of Chironomid Larvae.

    ERIC Educational Resources Information Center

    Mason, William T., Jr.

    This publication is an introductory guide to the identification of Chironomid (Midge) larvae. The larvae of these small flies are an important link in the food chain between algae and microinvertebrates. As a family, the larvae exhibit a wide range of tolerance to environmental factors such as amounts and types of pollutants. Much of this…

  9. Heating rate and induced thermotolerance in Mexican fruit fly (Diptera: Tephritidae) larvae, a quarantine pest of citrus and mangoes.


    Thomas, D B; Shellie, K C


    A bioassay and graduated temperature water baths were used to document the induction of thermotolerance in third-instar Mexican fruit fly, Anastrepha ludens (Loew). The 99% lethal time dose for larvae exposed to 44 degrees C core temperatures in artificial fruit is 61.5 min when a slow heating rate (120 min ramp) is applied, but only 41.9 min when a fast heating rate (15 min ramp) is applied. In electrophoretic profiles a heat inducible protein of molecular weight 32 kDa was detected in 76% of the larvae exposed to the slow ramp treatment, but only 42% of the larvae in the fast ramp treatment. Results from this research demonstrate that thermotolerance can be induced under conditions used to commercially disinfest fresh produce and highlight the necessity for specifying heating rates in quarantine treatment schedules.

  10. Toxocara canis: monoclonal antibodies to larval excretory-secretory antigens that bind with genus and species specificity to the cuticular surface of infective larvae.


    Bowman, D D; Mika-Grieve, M; Grieve, R B


    When maintained in culture, the infective-stage larvae of Toxocara canis produce a group of excretory-secretory antigens. Monoclonal antibodies to these antigens have been produced and partially characterized. Hybridomas were made using spleens from mice that had been given 250 embryonated eggs of T. canis followed by immunization with excretory-secretory antigens. Monoclonal antibodies were first screened against excretory-secretory antigens using an indirect enzyme-linked immunosorbent assay. Those antibodies positive in this assay were then screened against the surfaces of formalin-fixed, infective-stage larvae using an indirect fluorescent antibody assay. The two monoclonal antibodies showing fluorescence were also tested against the surfaces of infective-stage larvae of Toxocara cati, Baylisascaris procyonis, Toxascaris leonina, Ascaris suum, a Porrocaecum sp., and Dirofilaria immitis. One of these two antibodies bound to the surface of T. canis and T. cati while the other bound only to the surface of T. canis; neither were reactive with the other ascaridoid larvae or the larvae of D. immitis. Enzyme-linked immunoelectrotransfer blotting techniques were used to demonstrate that the cross-reactive antibody recognized antigens with molecular weights of about 200 kDa while the more specific monoclonal antibody recognized antigens with approximate molecular weights of 80 kDa. The specificity of these two antibodies for T. canis and T. cati should prove helpful in the development of more specific assays for the diagnosis of visceral and ocular larva migrans.

  11. Complete Genome Sequence of Paenibacillus larvae MEX14, Isolated from Honey Bee Larvae from the Xochimilco Quarter in Mexico City

    PubMed Central

    Peréz de la Rosa, D.; Pérez de la Rosa, J. J.; Cossio-Bayugar, R.; Miranda-Miranda, E.; Lozano, L.; Bravo-Díaz, M. A.; Rocha-Martínez, M. K.


    Paenibacillus larvae strain MEX14 is a facultative anaerobic endospore-forming bacterium that infects Apis mellifera larvae. Strain MEX14 was isolated from domestic bee larvae collected in a backyard in Mexico City. The estimated genome size was determined to be 4.18 Mb, and it harbors 4,806 protein coding genes (CDSs). PMID:26316636

  12. Complete Genome Sequence of Paenibacillus larvae MEX14, Isolated from Honey Bee Larvae from the Xochimilco Quarter in Mexico City.


    Peréz de la Rosa, D; Pérez de la Rosa, J J; Cossio-Bayugar, R; Miranda-Miranda, E; Lozano, L; Bravo-Díaz, M A; Rocha-Martínez, M K; Sachman-Ruiz, B


    Paenibacillus larvae strain MEX14 is a facultative anaerobic endospore-forming bacterium that infects Apis mellifera larvae. Strain MEX14 was isolated from domestic bee larvae collected in a backyard in Mexico City. The estimated genome size was determined to be 4.18 Mb, and it harbors 4,806 protein coding genes (CDSs).

  13. Larva of Palaemnema brasiliensis Machado (Odonata: Platystictidae), from Amazonas, Brazil.


    Neiss, Ulisses Gaspar; Hamada, Neusa


    The larva of Palaemnema brasiliensis Machado, 2009 is described and illustrated based on last-instar larvae and exuviae of reared larvae collected in a blackwater stream in Barcelos and Presidente Figueiredo municipalities, Amazonas state, Brazil. The larva of P. brasiliensis can be distinguished from the two South American species of the genus with described larvae (P. clementia Selys and P. mutans Calvert), mainly by presence of a single obtuse cusp on the labial palp, the presence and configuration of setae in the caudal lamellae, and the proportional length of terminal filaments of the caudal lamellae. The family is recorded here for the first time in Brazilian state of Amazonas.

  14. Predatory cannibalism in Drosophila melanogaster larvae.


    Vijendravarma, Roshan K; Narasimha, Sunitha; Kawecki, Tadeusz J


    Hunting live prey is risky and thought to require specialized adaptations. Therefore, observations of predatory cannibalism in otherwise non-carnivorous animals raise questions about its function, adaptive significance and evolutionary potential. Here we document predatory cannibalism on larger conspecifics in Drosophila melanogaster larvae and address its evolutionary significance. We found that under crowded laboratory conditions younger larvae regularly attack and consume 'wandering-stage' conspecifics, forming aggregations mediated by chemical cues from the attacked victim. Nutrition gained this way can be significant: an exclusively cannibalistic diet was sufficient for normal development from eggs to fertile adults. Cannibalistic diet also induced plasticity of larval mouth parts. Finally, during 118 generations of experimental evolution, replicated populations maintained under larval malnutrition evolved enhanced propensity towards cannibalism. These results suggest that, at least under laboratory conditions, predation on conspecifics in Drosophila is a functional, adaptive behaviour, which can rapidly evolve in response to nutritional conditions.

  15. Undescribed Setae in Larvae of Culicidae (Diptera)

    DTIC Science & Technology


    ABSTRACT. An unnamed pair of setae (two pairs in some species groups) on the larval cervical membrane in all genera of Culicidae examined is des- cribed...ventrolat- era1 seta was noted on the cervical membrane by the senior author. Further research confirmed its presence in all culicid genera for...referred to them as cervical hairs and recorded their length and branching in third and fourth stage larvae of the four Aedes species he studied

  16. A waterborne behavioral cue for the actinotroch larva of Phoronis pallida (Phoronida) produced by Upogebia pugettensis (Decapoda: Thalassinidea).


    Santagata, Scott


    Phoronis pallida (Phoronida) occurs as a commensal within the burrow of Upogebia pugettensis (Decapoda: Thalassinidea). Upogebia-conditioned seawater (UCSW) induced an exploratory swimming behavior in competent larvae of P. pallida in a dosage-dependent manner. This behavior included a significant increase in swimming speed that was directed downward, along with the repeated probing of the bottom with the sensory portion of the oral hood. The waterborne cue from the shrimp was present in the gut effluent, and the swimming behavior was not the result of the elevated ammonia concentration. Molecular weight separation of the UCSW estimated that the cue was between 10 and 50 kDa. Enzymatic treatments showed that the cue's activity could be eliminated by arginase and significantly reduced by lipase. Competent larvae were also induced to metamorphose when exposed to 20 mM CsCl for 30 min. Larvae did not respond to CsCl when cultured about 4 weeks past the onset of competence. Compared with actinotroch larvae of other phoronid species, P. pallida larvae exhibit greater behavioral specificity and neuronal differences within the hood sense organ. These anatomical and behavioral differences may have been maintained through a coevolutionary process among P. pallida and species of thalassinid shrimps that share Upogebia life-history characteristics.

  17. Visual learning in individually assayed Drosophila larvae.


    Gerber, B; Scherer, S; Neuser, K; Michels, B; Hendel, T; Stocker, R F; Heisenberg, M


    An understanding of associative learning is facilitated if it can be analyzed in a simple animal like the fruit fly Drosophila. Here, we introduce the first visual associative learning paradigm for larval Drosophila; this is remarkable as larvae have an order of magnitude fewer neurons than adult flies. Larvae were subjected to either of two reciprocal training regimes: Light+/Dark- or Light-/Dark+. Subsequently, all larvae were individually tested for their preference between Light versus Dark. The difference between training regimes was therefore exclusively which visual situation was associated with which reinforcer; differences observed during the test thus reflected exclusively associative learning. For positive reinforcement (+) we used fructose (FRU), and for negative reinforcement (-) either quinine or sodium chloride (QUI, NaCl). Under these conditions, associative learning could be reproducibly observed in both wild-type strains tested. We then compared the effectiveness of training using differential conditioning, with both positive and negative reinforcement, to that using only positive or only negative reinforcement. We found that FRU only, but neither QUI nor NaCl, was in itself effective as a reinforcer. This is the first demonstration of appetitive learning in larval Drosophila. It is now possible to investigate the behavioral and neuronal organization of appetitive visual learning in this simple and genetically easy-to-manipulate experimental system.

  18. Caffeine Taste Signaling in Drosophila Larvae

    PubMed Central

    Apostolopoulou, Anthi A.; Köhn, Saskia; Stehle, Bernhard; Lutz, Michael; Wüst, Alexander; Mazija, Lorena; Rist, Anna; Galizia, C. Giovanni; Lüdke, Alja; Thum, Andreas S.


    The Drosophila larva has a simple peripheral nervous system with a comparably small number of sensory neurons located externally at the head or internally along the pharynx to assess its chemical environment. It is assumed that larval taste coding occurs mainly via external organs (the dorsal, terminal, and ventral organ). However, the contribution of the internal pharyngeal sensory organs has not been explored. Here we find that larvae require a single pharyngeal gustatory receptor neuron pair called D1, which is located in the dorsal pharyngeal sensilla, in order to avoid caffeine and to associate an odor with caffeine punishment. In contrast, caffeine-driven reduction in feeding in non-choice situations does not require D1. Hence, this work provides data on taste coding via different receptor neurons, depending on the behavioral context. Furthermore, we show that the larval pharyngeal system is involved in bitter tasting. Using ectopic expressions, we show that the caffeine receptor in neuron D1 requires the function of at least four receptor genes: the putative co-receptors Gr33a, Gr66a, the putative caffeine-specific receptor Gr93a, and yet unknown additional molecular component(s). This suggests that larval taste perception is more complex than previously assumed already at the sensory level. Taste information from different sensory organs located outside at the head or inside along the pharynx of the larva is assembled to trigger taste guided behaviors. PMID:27555807

  19. Proteome Response of Tribolium castaneum Larvae to Bacillus thuringiensis Toxin Producing Strains

    PubMed Central

    Contreras, Estefanía; Rausell, Carolina; Real, M. Dolores


    Susceptibility of Tribolium castaneum (Tc) larvae was determined against spore-crystal mixtures of five coleopteran specific and one lepidopteran specific Bacillus thuringiensis Cry toxin producing strains and those containing the structurally unrelated Cry3Ba and Cry23Aa/Cry37Aa proteins were found toxic (LC50 values 13.53 and 6.30 µg spore-crystal mixture/µL flour disc, respectively). Using iTRAQ combined with LC-MS/MS allowed the discovery of seven novel differentially expressed proteins in early response of Tc larvae to the two active spore-crystal mixtures. Proteins showing a statistically significant change in treated larvae compared to non-intoxicated larvae fell into two major categories; up-regulated proteins were involved in host defense (odorant binding protein C12, apolipophorin-III and chemosensory protein 18) and down-regulated proteins were linked to metabolic pathways affecting larval metabolism and development (pyruvate dehydrogenase Eα subunit, cuticular protein, ribosomal protein L13a and apolipoprotein LI-II). Among increased proteins, Odorant binding protein C12 showed the highest change, 4-fold increase in both toxin treatments. The protein displayed amino acid sequence and structural homology to Tenebrio molitor 12 kDa hemolymph protein b precursor, a non-olfactory odorant binding protein. Analysis of mRNA expression and mortality assays in Odorant binding protein C12 silenced larvae were consistent with a general immune defense function of non-olfactory odorant binding proteins. Regarding down-regulated proteins, at the transcriptional level, pyruvate dehydrogenase and cuticular genes were decreased in Tc larvae exposed to the Cry3Ba producing strain compared to the Cry23Aa/Cry37Aa producing strain, which may contribute to the developmental arrest that we observed with larvae fed the Cry3Ba producing strain. Results demonstrated a distinct host transcriptional regulation depending upon the Cry toxin treatment. Knowledge on how insects

  20. In vitro culture of Parascaris equorum larvae and initial investigation of parasite excretory-secretory products.


    Burk, Steffanie V; Dangoudoubiyam, Sriveny; Brewster-Barnes, Tammy; Bryant, Uneeda K; Howe, Daniel K; Carter, Craig N; Vanzant, Eric S; Harmon, Robert J; Kazacos, Kevin R; Rossano, Mary G


    Currently, diagnosis of Parascaris equorum infection in equids is limited to patent infections. The goals of this study were to culture P. equorum larvae in vitro and identify excretory-secretory (ES) products for prepatent diagnostic testing. Parascaris equorum L2/L3 larvae were hatched and cultured for up to 3 weeks for ES product collection. Fifth stage (L5) P. equorum were also cultured for ES product collection. Examination of ES fractions by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and silver stain revealed L2/L3 products ranging from 12-94 kDa and L5 products ranging from 12-189 kDa. Western blot analyses were conducted using polyclonal antibodies produced against P. equorum or Baylisascaris procyonis L2/L3 ES products, sera from rabbits inoculated with B. procyonis or Toxocara canis eggs, and sera from animals naturally infected with P. equorum or T. canis. Western blot results indicated parasite antigens migrating at 19 and 34 kDa may be useful for specifically detecting P. equorum infections.

  1. Drosophila larvae: Thermal ecology in changing environments

    NASA Astrophysics Data System (ADS)

    Wang, George

    Temperature affects almost all aspects of life. Although much work has been done to assess the impact of temperature on organismal performance, relatively little is known about how organisms behaviorally regulate temperature, how these behaviors effect population fitness, or how changing climate may interact with these behaviors. I explore these questions with the model system Drosophila larvae. Larvae are small, with a low thermal mass and limited capacity for physiological thermoregulation. Mortality is generally high in larvae, with large potential impacts on population growth rate. Thus behavioral thermoregulation in larvae should be of critical selective importance. I present a review of the current knowledge of Drosophila thermal preference. I describe quantifiable thermoregulatory behaviors ( TMV and TW) unique to larvae. I show interspecific variation of these behaviors in Drosophila melanogaster and several close relatives, and intraspecific variation between populations collected from different environments. I also investigate these behaviors in two mutant lines, ssa and biz, to investigate the genetic basis of these behaviors. I show that larval thermoregulatory systems are independent of those of adults. Further these thermoregulatory behaviors differ between two sister species, D. yakuba and D. santomea. Although these two species readily hybridize in laboratory conditions, very few hybrids are observed in the field. The surprising result that hybrids of D. yakuba and D. santomea seem to inherit TMV from D. yakuba suggests a novel extrinsic isolation mechanism between the two species. I explore how fitness is the result of the interaction between genetics and the environment. I utilize Monte Carlo simulation to show how non-linear norms of reaction generate variation in populations even in the absence of behavior or epigenetic evolutionary mechanisms. Finally I investigate the global distribution of temperatures in which these organisms exist using

  2. Isolation and identification of excretory-secretory and somatic antigens from the Oestrus ovis larvae by SDS-PAGE and immunoblotting.


    Alborzi, Alireza; Jolodar, Abbas; Seyfi Abad Shapouri, Masoudreza; Bagherian Pour, Esmaeil


    Oestrus ovis is an economically important parasite of small ruminants and a zoonotic parasite with many reports of ophthalmomyiasis in human from Iran and other countries. The aim of the peresent study was the isolation and identification of excretory-secretory (ES) and somatic (S) antigens of O. ovis second and third stage larvae (L2, L3) collected from Arabi sheep breeds located in southwest of Iran. Positive sera were prepared by marking the sheep, taking blood sample and direct observation of the parasite in the head. Somatic antigens of the larvae (SL2, SL3) were prepared by sonication. Larval excretory-secretory antigens (ESL2, ESL3) were prepared by incubation the larvae in RPMI-1640 RPMI medium. Electrophoretic protein profiles of ESL2 two, ESL3 seven, SL2 eight, SL3 fifteen bands (from 79.0 to below 14.4 KDa) were shown. In immunoblotting with positive sera, four common bands in SL2 and SL3 at 58, 42.0, 29.0 and 28.0 kDa, one specific band in SL3 at 47.0 kDa and one band in ESL2, at 28.0 kDa, and three bands in ESL3 at 58.0, 42.0, 29.0 and 28.0 kDa were recognized. Among the profiles, the 28 kDa protein was the most common antigenic component. Nevertheless, the antigenic proteins 29, 58 kDa were a common protein in electrophoretic patterns of both S and ES proteins of L2 and L3 but, 42.0 kDa antigen the only one detected in immunoblot but not in S and ES protein profiles of the larvae. Therefore, the antigens 29.0, 42.0 and 58.0 kDa can be used for further studies of protective effects and serological diagnostic methods.

  3. Interactions among Drosophila larvae before and during collision

    PubMed Central

    Otto, Nils; Risse, Benjamin; Berh, Dimitri; Bittern, Jonas; Jiang, Xiaoyi; Klämbt, Christian


    In populations of Drosophila larvae, both, an aggregation and a dispersal behavior can be observed. However, the mechanisms coordinating larval locomotion in respect to other animals, especially in close proximity and during/after physical contacts are currently only little understood. Here we test whether relevant information is perceived before or during larva-larva contacts, analyze its influence on behavior and ask whether larvae avoid or pursue collisions. Employing frustrated total internal reflection-based imaging (FIM) we first found that larvae visually detect other moving larvae in a narrow perceptive field and respond with characteristic escape reactions. To decipher larval locomotion not only before but also during the collision we utilized a two color FIM approach (FIM2c), which allowed to faithfully extract the posture and motion of colliding animals. We show that during collision, larval locomotion freezes and sensory information is sampled during a KISS phase (german: Kollisions Induziertes Stopp Syndrom or english: collision induced stop syndrome). Interestingly, larvae react differently to living, dead or artificial larvae, discriminate other Drosophila species and have an increased bending probability for a short period after the collision terminates. Thus, Drosophila larvae evolved means to specify behaviors in response to other larvae. PMID:27511760

  4. Transcriptional Response of Honey Bee Larvae Infected with the Bacterial Pathogen Paenibacillus larvae

    PubMed Central

    Cornman, Robert Scott; Lopez, Dawn; Evans, Jay D.


    American foulbrood disease of honey bees is caused by the bacterium Paenibacillus larvae. Infection occurs per os in larvae and systemic infection requires a breaching of the host peritrophic matrix and midgut epithelium. Genetic variation exists for both bacterial virulence and host resistance, and a general immunity is achieved by larvae as they age, the basis of which has not been identified. To quickly identify a pool of candidate genes responsive to P. larvae infection, we sequenced transcripts from larvae inoculated with P. larvae at 12 hours post-emergence and incubated for 72 hours, and compared expression levels to a control cohort. We identified 75 genes with significantly higher expression and six genes with significantly lower expression. In addition to several antimicrobial peptides, two genes encoding peritrophic-matrix domains were also up-regulated. Extracellular matrix proteins, proteases/protease inhibitors, and members of the Osiris gene family were prevalent among differentially regulated genes. However, analysis of Drosophila homologs of differentially expressed genes revealed spatial and temporal patterns consistent with developmental asynchrony as a likely confounder of our results. We therefore used qPCR to measure the consistency of gene expression changes for a subset of differentially expressed genes. A replicate experiment sampled at both 48 and 72 hours post infection allowed further discrimination of genes likely to be involved in host response. The consistently responsive genes in our test set included a hymenopteran-specific protein tyrosine kinase, a hymenopteran specific serine endopeptidase, a cytochrome P450 (CYP9Q1), and a homolog of trynity, a zona pellucida domain protein. Of the known honey bee antimicrobial peptides, apidaecin was responsive at both time-points studied whereas hymenoptaecin was more consistent in its level of change between biological replicates and had the greatest increase in expression by RNA-seq analysis

  5. The Identification of Congeners and Aliens by Drosophila Larvae.


    Del Pino, Francisco; Jara, Claudia; Pino, Luis; Medina-Muñoz, María Cristina; Alvarez, Eduardo; Godoy-Herrera, Raúl


    We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b) mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b), Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles.

  6. The Identification of Congeners and Aliens by Drosophila Larvae

    PubMed Central

    Del Pino, Francisco; Jara, Claudia; Pino, Luis; Medina-Muñoz, María Cristina; Alvarez, Eduardo; Godoy-Herrera, Raúl


    We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b) mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b), Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles. PMID:26313007

  7. Sound response mediated by the TRP channels NOMPC, NANCHUNG, and INACTIVE in chordotonal organs of Drosophila larvae.


    Zhang, Wei; Yan, Zhiqiang; Jan, Lily Yeh; Jan, Yuh Nung


    Mechanical stimuli, including tactile and sound signals, convey a variety of information important for animals to navigate the environment and avoid predators. Recent studies have revealed that Drosophila larvae can sense harsh or gentle touch with dendritic arborization (da) neurons in the body wall and can detect vibration with chordotonal organs (Cho). Whether they can also detect and respond to vibration or sound from their predators remains an open question. Here we report that larvae respond to sound of wasps and yellow jackets, as well as to pure tones of frequencies that are represented in such natural sounds, with startle and burrowing behaviors. The larval response to sound/vibration requires Cho neurons and, to a lesser extent, class IV da neurons. Our calcium imaging and electrophysiological experiments reveal that Cho neurons, but not class IV da neurons, are excited by natural sounds or pure tones, with tuning curves and intensity dependence appropriate for the behavioral responses. Furthermore, our study implicates the transient receptor potential (TRP) channels NOMPC, NANCHUNG, and INACTIVE, but not the dmPIEZO channel, in the mechanotransduction and/or signal amplification for the detection of sound by the larval Cho neurons. These findings indicate that larval Cho, like their counterparts in the adult fly, use some of the same mechanotransduction channels to detect sound waves and mediate the sensation akin to hearing in Drosophila larvae, allowing them to respond to the appearance of predators or other environmental cues at a distance with behaviors crucial for survival.

  8. Self-mixing of fly larvae during feeding

    NASA Astrophysics Data System (ADS)

    Shishkov, Olga; Johnson, Christopher; Zhang, Bryan; Hu, David


    How do we sustainably feed a growing world population? One solution of increasing interest is the use of black solider fly larvae, pea-sized grubs envisioned to transform hundreds of tons of food waste into a sustainable protein source. Although startups across the world are raising these larvae, a physical understanding of how they should be raised and fed remains missing. In this study, we present experiments measuring their feeding rate as a function of number of larvae. We show that larger groups of larvae have greater mixing which entrains hungry larvae around the food, increasing feeding rate. Feeding of larvae thus differs from feeding of cattle or other livestock which exhibit less self-mixing.

  9. Equipment for transporting live black fly larvae (Diptera: Simuliiae)

    USGS Publications Warehouse

    Tarshis, I.B.; Adkins, T.R.


    In studies relating to the biology and ecology of black flies, live larvae of at least 70 species of Simuliidae have been collected from their natural breeding sites and transported in containers with nonagitated water for short distances to the laboratory. One of us (Tarshis 1966) found, however, that even small numbers of simuliid larvae cannot survive in containers with nonagitated water for more than 6 hr. Additionally, when massive numbers of larvae are introduced into transport containers in which the water is not agitated, the larvae perish because they become entangled within the masses of silken threads they emit whenever disturbed (Tarshis and Neil 1970). Therefore, when transporting larvae long distances or when transporting large numbers of larvae any distance, it is essential to agitate the water in the transport containers.

  10. Fate of pharmaceuticals and pesticides in fly larvae composting.


    Lalander, C; Senecal, J; Gros Calvo, M; Ahrens, L; Josefsson, S; Wiberg, K; Vinnerås, B


    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (<10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment.

  11. Learning and memory in zebrafish larvae.


    Roberts, Adam C; Bill, Brent R; Glanzman, David L


    Larval zebrafish possess several experimental advantages for investigating the molecular and neural bases of learning and memory. Despite this, neuroscientists have only recently begun to use these animals to study memory. However, in a relatively short period of time a number of forms of learning have been described in zebrafish larvae, and significant progress has been made toward their understanding. Here we provide a comprehensive review of this progress; we also describe several promising new experimental technologies currently being used in larval zebrafish that are likely to contribute major insights into the processes that underlie learning and memory.

  12. Learning and memory in zebrafish larvae

    PubMed Central

    Roberts, Adam C.; Bill, Brent R.; Glanzman, David L.


    Larval zebrafish possess several experimental advantages for investigating the molecular and neural bases of learning and memory. Despite this, neuroscientists have only recently begun to use these animals to study memory. However, in a relatively short period of time a number of forms of learning have been described in zebrafish larvae, and significant progress has been made toward their understanding. Here we provide a comprehensive review of this progress; we also describe several promising new experimental technologies currently being used in larval zebrafish that are likely to contribute major insights into the processes that underlie learning and memory. PMID:23935566

  13. Toxicity of phenol on Macrobrachium rosenbergii (de Man) eggs, larvae, and post-larvae

    SciTech Connect

    Law, A.T.; Yeo, M.E.


    Literature on the toxicities of phenol on aquatic organisms is very limited. USEPA reported that the acute and chronic toxicities of phenol to freshwater aquatic life occur at concentrations as low as 10.2 mg/L and 2.56 mg/L, respectively. While for the saltwater aquatic life the acute toxicity occurs at concentrations as low as 5.8 mg/L. No data are available for the chronic toxicity of phenol to saltwater aquatic life. Sublethal concentrations of phenol have significant effects on the physiological and histological processes of the aquatic organisms: such as gill necrosis; destruction of erythrocyte cells; inhibition of sexual activities; suppression on growth and reduction of resistance to diseases. Macrobrachium rosenbergii(de Man) is the sole freshwater prawn cultured in Malaysia. Occasionally, the hatcheries are unable to produce the post-larvae because of undefined pollutants present in the water supplies. It has been observed that the use of cracked fiberglass tanks for larvae rearing is correlated with high mortality. This high mortality is probably due to the toxicity of the phenolic compounds which are leached out from the fiber glass tank into the water. This study was undertaken to evaluate the toxicity of phenol on eggs, larvae and post-larvae of M. rosenbergii and to set the water quality criteria of phenol for the said species. 16 refs., 3 tabs.

  14. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.


    Kloezen, Wendy; van Helvert-van Poppel, Marilyn; Fahal, Ahmed H; van de Sande, Wendy W J


    Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.

  15. Structure and occurrence of cyphonautes larvae (bryozoa, ectoprocta).


    Nielsen, Claus; Worsaae, Katrine


    We have studied larvae of the freshwater ctenostome Hislopia malayensis with scanning electron microscopy (SEM), confocal laser scanning microscopy (CLSM), and LM of serial sections. Some additional observations on larvae of M. membranacea using SEM and CLSM are also reported. The overall configuration of muscles, nerves, and cilia of the two larvae are identical. However, the larva of H. malayensis is much smaller than that of M. membranacea, which may explain most of the differences observed. Although all major nerves and muscle strands are present in H. malayensis, they are generally composed of fewer fibers. The H. malayensis larva lacks the anterior and posterior intervalve cilia. Its pyriform organ is unciliated with only a small central depression. The adhesive epithelium is not invaginated as an adhesive sac and lacks the large muscles interpreted as adhesive sac muscles in the M. membranacea larva. The velum carries two rows of ciliated cells, though the lower "row" consists of only one or two cells. Both rows of ciliated cells are innervated by nerves, which have not been detected in the M. membranacea larva. The ciliated ridge of H. malayensis lacks the frontal cilia. The planktotrophic cyphonautes larvae in a number of ctenostome clades and in the "basal" cheilostome clade Malacostega (and probably in the earliest cheilostomes) support the idea that the cyphonautes larva is the ancestral larval type of the Eurystomata. It may even represent the ancestral larval type of the bryozoans (= ectoprocts).

  16. A Model of Drosophila Larva Chemotaxis.


    Davies, Alex; Louis, Matthieu; Webb, Barbara


    Detailed observations of larval Drosophila chemotaxis have characterised the relationship between the odour gradient and the runs, head casts and turns made by the animal. We use a computational model to test whether hypothesised sensorimotor control mechanisms are sufficient to account for larval behaviour. The model combines three mechanisms based on simple transformations of the recent history of odour intensity at the head location. The first is an increased probability of terminating runs in response to gradually decreasing concentration, the second an increased probability of terminating head casts in response to rapidly increasing concentration, and the third a biasing of run directions up concentration gradients through modulation of small head casts. We show that this model can be tuned to produce behavioural statistics comparable to those reported for the larva, and that this tuning results in similar chemotaxis performance to the larva. We demonstrate that each mechanism can enable odour approach but the combination of mechanisms is most effective, and investigate how these low-level control mechanisms relate to behavioural measures such as the preference indices used to investigate larval learning behaviour in group assays.

  17. Metamorphosis of cinctoblastula larvae (Homoscleromorpha, porifera).


    Ereskovsky, Alexander V; Tokina, Daria B; Bézac, Chantal; Boury-Esnault, Nicole


    The metamorphosis of the cinctoblastula of Homoscleromorpha is studied in five species belonging to three genera. The different steps of metamorphosis are similar in all species. The metamorphosis occurs by the invagination and involution of either the anterior epithelium or the posterior epithelium of the larva. During metamorphosis, morphogenetic polymorphism was observed, which has an individual character and does not depend on either external or species specific factors. In the rhagon, the development of the aquiferous system occurs only by epithelial morphogenesis and subsequent differentiation of cells. Mesohylar cells derive from flagellated cells after ingression. The formation of pinacoderm and choanoderm occurs by the differentiation of the larval flagellated epithelium. This is possibly due to the conservation of cell junctions in the external surface of the larval flagellated cells and of the basement membrane in their internal surface. The main difference in homoscleromorph metamorphosis compared with Demospongiae is the persistence of the flagellated epithelium throughout this process and even in the adult since exo- and endopinacoderm remain flagellated. The antero-posterior axis of the larva corresponds to the baso-apical axis of the adult in Homoscleromorpha.

  18. Olfactory Learning in Individually Assayed Drosophila Larvae

    PubMed Central

    Scherer, Sabine; Stocker, Reinhard F.; Gerber, Bertram


    Insect and mammalian olfactory systems are strikingly similar. Therefore, Drosophila can be used as a simple model for olfaction and olfactory learning. The brain of adult Drosophila, however, is still complex. We therefore chose to work on the larva with its yet simpler but adult-like olfactory system and provide evidence for olfactory learning in individually assayed Drosophila larvae. We developed a differential conditioning paradigm in which odorants are paired with positive (“+” fructose) or negative (“-” quinine or sodium chloride) gustatory reinforcers. Test performance of individuals from two treatment conditions is compared—one received odorant A with the positive reinforcer and odorant B with a negative reinforcer (A+/B-); animals from the other treatment condition were trained reciprocally (A-/B+). During test, differences in choice between A and B of individuals having undergone either A+/B- or A-/B+ training therefore indicate associative learning. We provide such evidence for both combinations of reinforcers; this was replicable across repetitions, laboratories, and experimenters. We further show that breaks improve performance, in accord with basic principles of associative learning. The present individual assay will facilitate electrophysiological studies, which necessarily use individuals. As such approaches are established for the larval neuromuscular synapse, but not in adults, an individual larval learning paradigm will serve to link behavioral levels of analysis to synaptic physiology. PMID:12773586

  19. Manganese(II) chloride alters behavioral and neurochemical parameters in larvae and adult zebrafish.


    Altenhofen, Stefani; Wiprich, Melissa Talita; Nery, Laura Roesler; Leite, Carlos Eduardo; Vianna, Monica Ryff Moreira Roca; Bonan, Carla Denise


    Manganese (Mn) is an essential metal for organisms, but high levels can cause serious neurological damage. The aim of this study was to evaluate the effects of MnCl2 exposure on cognition and exploratory behavior in adult and larval zebrafish and correlate these findings with brain accumulation of Mn, overall brain tyrosine hydroxylase (TH) levels, dopamine (DA) levels, 3,4-dihydroxyphenylacetic acid (DOPAC) levels and cell death markers in the nervous system. Adults exposed to MnCl2 for 4days (0.5, 1.0 and 1.5mM) and larvae exposed for 5days (0.1, 0.25 and 0.5mM) displayed decreased exploratory behaviors, such as distance traveled and absolute body turn angle, in addition to reduced movement time and an increased number of immobile episodes in larvae. Adults exposed to MnCl2 for 4days showed impaired aversive long-term memory in the inhibitory avoidance task. The overall brain TH levels were elevated in adults and larvae evaluated at 5 and 7 days post-fertilization (dpf). Interestingly, the protein level of this enzyme was decreased in larval animals at 10dpf. Furthermore, DOPAC levels were increased in adult animals exposed to MnCl2. Protein analysis showed increased apoptotic markers in both the larvae and adult nervous system. The results demonstrated that prolonged exposure to MnCl2 leads to locomotor deficits that may be associated with damage caused by this metal in the CNS, particularly in the dopaminergic system.

  20. Coronatin-2 from the entomopathogenic fungus Conidiobolus coronatus kills Galleria mellonella larvae and incapacitates hemocytes.


    Boguś, M I; Wieloch, W; Ligęza-Żuber, M


    Coronatin-2, a 14.5 kDa protein, was isolated from culture filtrates of the entomopathogenic fungus Conidiobolus coronatus (Costantin) Batko (Entomophthoramycota: Entomophthorales). After LC-MS/MS (liquid chromatography tandem mass spectrometry) analysis of the tryptic peptide digest of coronatin-2 and a mass spectra database search no orthologs of this protein could be found in fungi. The highest homology was observed to the partial translation elongation factor 1a from Sphaerosporium equinum (protein sequence coverage, 21%), with only one peptide sequence, suggesting that coronatin-2 is a novel fungal protein that has not yet been described. In contrast to coronatin-1, an insecticidal 36 kDa protein, which shows both elastolytic and chitinolytic activity, coronatin-2 showed no enzymatic activity. Addition of coronatin-2 into cultures of hemocytes taken from larvae of Galleria mellonella Linnaeus (Lepidoptera: Pyralidae), resulted in progressive disintegration of nets formed by granulocytes and plasmatocytes due to rapid degranulation of granulocytes, extensive vacuolization of plasmatocytes accompanied by cytoplasm expulsion, and cell disintegration. Spherulocytes remained intact, while oenocytes rapidly disintegrated. Coronatin-2 produced 80% mortality when injected into G. mellonella at 5 µg larva-1. Further study is warranted to determine the relevance of the acute toxicity of coronatin-2 and its effects on hemocytes in vitro to virulence of C. coronatus against its hosts.

  1. Active downward propulsion by oyster larvae in turbulence.


    Fuchs, Heidi L; Hunter, Elias J; Schmitt, Erika L; Guazzo, Regina A


    Oyster larvae (Crassostrea virginica) could enhance their settlement success by moving toward the seafloor in the strong turbulence associated with coastal habitats. We characterized the behavior of individual oyster larvae in grid-generated turbulence by measuring larval velocities and flow velocities simultaneously using infrared particle image velocimetry. We estimated larval behavioral velocities and propulsive forces as functions of the kinetic energy dissipation rate ε, strain rate γ, vorticity ξ and acceleration α. In calm water most larvae had near-zero vertical velocities despite propelling themselves upward (swimming). In stronger turbulence all larvae used more propulsive force, but relative to the larval axis, larvae propelled themselves downward (diving) instead of upward more frequently and more forcefully. Vertical velocity magnitudes of both swimmers and divers increased with turbulence, but the swimming velocity leveled off as larvae were rotated away from their stable, velum-up orientation in strong turbulence. Diving speeds rose steadily with turbulence intensity to several times the terminal fall velocity in still water. Rapid dives may require a switch from ciliary swimming to another propulsive mode such as flapping the velum, which would become energetically efficient at the intermediate Reynolds numbers attained by larvae in strong turbulence. We expected larvae to respond to spatial or temporal velocity gradients, but although the diving frequency changed abruptly at a threshold acceleration, the variation in propulsive force and behavioral velocity was best explained by the dissipation rate. Downward propulsion could enhance oyster larval settlement by raising the probability of larval contact with oyster reef patches.

  2. Complete Genome Sequences of Five Paenibacillus larvae Bacteriophages.


    Sheflo, Michael A; Gardner, Adam V; Merrill, Bryan D; Fisher, Joshua N B; Lunt, Bryce L; Breakwell, Donald P; Grose, Julianne H; Burnett, Sandra H


    Paenibacillus larvae is a pathogen of honeybees that causes American foulbrood (AFB). We isolated bacteriophages from soil containing bee debris collected near beehives in Utah. We announce five high-quality complete genome sequences, which represent the first completed genome sequences submitted to GenBank for any P. larvae bacteriophage.

  3. Selenium impacts on razorback sucker, Colorado: Colorado River: III. Larvae

    USGS Publications Warehouse

    Hamilton, S.J.; Holley, K.M.; Buhl, K.J.; Bullard, F.A.


    Razorback sucker (Xyrauchen texanus) larvae from adults exposed to selenium at three sites near Grand Junction, Colorado, for 9 months were used in a 30-day waterborne and dietary selenium study. Selenium concentrations in water averaged <1.6 ??g/L from 24-Road, 0.9 ??g/L from Horsethief, 5.5 ??g/L from Adobe Creek, and 10.7 ??g/L from the North Pond. Selenium in dietary items averaged 2.7 ??g/g in brine shrimp, 5.6 ??g/g in zooplankton from Horsethief east wetland, 20 ??g/g in zooplankton from Adobe Creek, and 39 ??g/g in zooplankton from North Pond. The lowest survival occurred in larvae fed zooplankton rather than brine shrimp. Survival of larvae at Adobe Creek and North Pond was lower in site water than in reference water. Survival of brood stock larvae was higher than Horsethief larvae even though they received the same water and dietary treatments. Arsenic concentrations in brine shrimp may have resulted in an antagonistic interaction with selenium and reduced adverse effects in larvae. Deformities in larvae from North Pond were similar to those reported for selenium-induced teratogenic deformities in other fish species. Selenium concentrations of ???4.6 ??g/g in food resulted in rapid mortality of larvae from Horsethief, Adobe Creek, and North Pond, and suggested that selenium toxicity in the Colorado River could limit recovery of this endangered fish.

  4. Prey capture of pike Esox lucius larvae in turbid water.


    Salonen, M; Engström-Ost, J


    Pike Esox lucius larvae captured fewer calanoid and cyclopoid copepods in turbid than in clear water, whereas no differences were detected in feeding rates on Daphnia longispina. Decreased capture of copepods may lead to lower growth and survival of E. lucius larvae in turbid areas, in particular, if cladocerans are scarce.

  5. The effects of dissolved gas supersaturation on white sturgeon larvae

    USGS Publications Warehouse

    Counihan, T.D.; Miller, A.I.; Mesa, M.G.; Parsley, M.J.


    Spill at dams has caused supersaturation of atmospheric gas in waters of the Columbia and Snake rivers and raised concerns about the effects of dissolved gas supersaturation (DGS) on white sturgeons Acipenser transmontanus. The timing and location of white sturgeon spawning and the dispersal of white sturgeon larvae from incubation areas makes the larval stage potentially vulnerable to the effects of DGS. To assess the effects of DGS on white sturgeon larvae, we exposed larvae to mean total dissolved gas (TDG) levels of 118% and 131% saturation in laboratory bioassay tests. Gas bubble trauma (GBT) was manifested as a gas bubble in the buccal cavity, nares, or both and it first occurred at developmental stages characterized by the formation of the mouth and gills. Exposure times of 15 min were sufficient to elicit these signs in larvae in various stages of development. No mortality was observed in larvae exposed to 118% TDG for 10 d, but 50% mortality occurred after a 13-d exposure to 131% TDG. The signs of GBT we observed resulted in positive buoyancy and alterations in behavior that may affect the dispersal and predation vulnerability of white sturgeon larvae. The exact depth distribution of dispersing white sturgeon larvae in the Columbia River currently is unknown. Thus, our results may represent a worst-case scenario if white sturgeon larvae are dispersed at depths with insufficient hydrostatic pressure to compensate for high TDG levels.

  6. Rapid bioassay to screen potential biopesticides in Tenebrio molitor larvae

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A simplified assay was devised to evaluate the response of Tenebrio molitor larvae to potential insect control products. The assay incorporates punched disks of flattened whole-grain bread placed in 96-well plates, with treatments applied topically, and neonate larvae added to each well. To evalua...

  7. Selenium impacts on razorback sucker, Colorado: Colorado River III. Larvae.


    Hamilton, Steven J; Holley, Kathy M; Buhl, Kevin J; Bullard, Fern A


    Razorback sucker (Xyrauchen texanus) larvae from adults exposed to selenium at three sites near Grand Junction, Colorado, for 9 months were used in a 30-day waterborne and dietary selenium study. Selenium concentrations in water averaged <1.6 microg/L from 24-Road, 0.9 microg/L from Horsethief, 5.5 microg/L from Adobe Creek, and 10.7 microg/L from the North Pond. Selenium in dietary items averaged 2.7 microg/g in brine shrimp, 5.6 microg/g in zooplankton from Horsethief east wetland, 20 microg/g in zooplankton from Adobe Creek, and 39 microg/g in zooplankton from North Pond. The lowest survival occurred in larvae fed zooplankton rather than brine shrimp. Survival of larvae at Adobe Creek and North Pond was lower in site water than in reference water. Survival of brood stock larvae was higher than Horsethief larvae even though they received the same water and dietary treatments. Arsenic concentrations in brine shrimp may have resulted in an antagonistic interaction with selenium and reduced adverse effects in larvae. Deformities in larvae from North Pond were similar to those reported for selenium-induced teratogenic deformities in other fish species. Selenium concentrations of 4.6 microg/g in food resulted in rapid mortality of larvae from Horsethief, Adobe Creek, and North Pond, and suggested that selenium toxicity in the Colorado River could limit recovery of this endangered fish.

  8. Trail marking by larvae of the eastern tent caterpillar.


    Fitzgerald, T D


    Eastern tent caterpillars that are successful foragers deposit trails as they return to the tent that are more attractive than the exploratory trails of the unfed larvae. The trails of these fed returning larvae attract unfed tentmates to food finds anre chemical factors account for the attractiveness of these trails.

  9. Early detection of non-native fishes using fish larvae

    EPA Science Inventory

    Our objective was to evaluate the use of fish larvae for early detection of non-native fishes, comparing traditional and molecular taxonomy approaches to investigate potential efficiencies. Fish larvae present an interesting opportunity for non-native fish early detection. First,...

  10. Loeffler's Syndrome Following Cutaneous Larva Migrans: An Uncommon Sequel

    PubMed Central

    Podder, Indrashis; Chandra, Somodyuti; Gharami, Ramesh Chandra


    Cutaneous larva migrans (CLM) is characterized by the formation of distinctive, tortuous, and serpentine skin lesions occurring as a result of epidermal burrowing by certain helminthic larvae. Although this condition is usually uneventful, rarely it may result in patchy pulmonary infiltration with peripheral eosinophilia, also called Loeffler's syndrome. This association is fairly uncommon and is thus being reported. PMID:27057020

  11. Discovery of mammalian hosts to Gnathostoma nipponicum larvae and prevalence of the larvae in rodents and insectivores.


    Oyamada, T; Kobayashi, H; Kindou, T; Kudo, N; Yoshikawa, H; Yoshikawa, T


    From September 1993 to November 1995, to clarify the natural infection of Gnathostoma nipponicum (G.n.) larvae in small wild mammals, a total of 313 animals consisted of three species of rodents and two species of insectivores, collected from an endemic area of this nematode in Aomori Prefecture, were investigated. Two species, Rattus norvegicus (R.n.) and Chimarrogale himalayica (C.h.) were infected with G.n. larvae, and the infection rate was extremely high with 27.2% and 72.7% in the former and latter. The infected animals harbored the larvae of 2-10 (mean: 6.0) in R.N. and 2-40 (10.6) in C.h., and a total of 273 larvae was recovered. The all larvae (18) from R.n. and the vast majority of the larvae (216/255: 82.4%) from C.h. were recovered from the musculature, and many encapsulated larvae were found in these portions of C.h. Taxonomically, all the larvae were identified as the advance third-stage larvae (AdL3) of G.n. The body length was 1,056-2,110 microns, and was larger than those of the naturally-infected AdL3 reported from cold-blooded animals. No morphological alterations or death of the larva was observed. From these results, it would seem that R.n. and C.h. are highly susceptible to G.n. larvae, and has very suitable characteristics as the hosts. Furthermore, a hypothesis is advanced that these mammals serves as the plausible paratenic hosts in the life cycle of G.n. This report is the first record of R.n. (Rodentia) and C.h. (Insectivora) naturally-infected with AdL3 of G.n.

  12. Bacteria Present in Comadia redtenbacheri Larvae (Lepidoptera: Cossidae).


    Hernández-Flores, L; Llanderal-Cázares, C; Guzmán-Franco, A W; Aranda-Ocampo, S


    The external and internal culturable bacterial community present in the larvae of Comadia redtenbacheri Hammerschmidt, an edible insect, was studied. Characterization of the isolates determined the existence of 18 morphotypes and phylogenetic analysis of the 16S rRNA gene revealed the existence of Paenibacillus sp., Bacillus safensis, Pseudomonas sp., Bacillus pseudomycoides, Corynebacterium variabile, Enterococcus sp., Gordonia sp., Acinetobacter calcoaceticus, Arthrobacter sp., Micrococcus sp., and Bacillus cereus. Greater diversity of bacteria was found in those larvae obtained from vendors than in those directly taken from Agave plants in nature. Many of the larvae obtained from vendors presented signs of potential disease, and after the analysis, results showed a greater bacterial community compared with the larvae with a healthy appearance. This indicates that bacterial flora can vary in accordance with how the larvae are handled during extraction, collection, and transport.

  13. Mechanical recovery of inhibited cyathostomin larvae from equine intestinal tissue.


    Glover, I D; Henry, G M; Townsend, N B; Coles, G C


    The Stomacher is very widely used in food and medical research for extracting tissues. To determine whether nematode larvae were disrupted by the Stomacher, L3 larvae of Haemonchus contortus were homogenised for up to 40 min at full power but no larval disruption occurred. Therefore, tissue from the mucosa and submucosa of the caecum of horses collected from a licenced abattoir was treated to determine whether inhibited cyathostomin larvae could be extracted. The optimum time on full power for a 10-g sample was 20 min, and in three out of five caecal samples from different horses, significantly more larvae were recovered than with 6 h pepsin HCl digestion. It is concluded that the Stomacher provides a simple fast method of extracting inhibited nematode larvae from gastrointestinal tissues in the horse that could replace digestion with pepsin HCl.

  14. Habitat selection by marine larvae in changing chemical environments.


    Lecchini, D; Dixson, D L; Lecellier, G; Roux, N; Frédérich, B; Besson, M; Tanaka, Y; Banaigs, B; Nakamura, Y


    The replenishment and persistence of marine species is contingent on dispersing larvae locating suitable habitat and surviving to a reproductive stage. Pelagic larvae rely on environmental cues to make behavioural decisions with chemical information being important for habitat selection at settlement. We explored the sensory world of crustaceans and fishes focusing on the impact anthropogenic alterations (ocean acidification, red soil, pesticide) have on conspecific chemical signals used by larvae for habitat selection. Crustacean (Stenopus hispidus) and fish (Chromis viridis) larvae recognized their conspecifics via chemical signals under control conditions. In the presence of acidified water, red soil or pesticide, the ability of larvae to chemically recognize conspecific cues was altered. Our study highlights that recruitment potential on coral reefs may decrease due to anthropogenic stressors. If so, populations of fishes and crustaceans will continue their rapid decline; larval recruitment will not replace and sustain the adult populations on degraded reefs.

  15. Chemical spying in coral reef fish larvae at recruitment.


    Roux, Natacha; Brooker, Rohan M; Lecellier, Gaël; Berthe, Cécile; Frédérich, Bruno; Banaigs, Bernard; Lecchini, David


    When fish larvae recruit back to a reef, chemical cues are often used to find suitable habitat or to find juvenile or adult conspecifics. We tested if the chemical information used by larvae was intentionally produced by juvenile and adult conspecifics already on the reef (communication process) or whether the cues used result from normal biochemical processes with no active involvement by conspecifics ("spying" behavior by larvae). Conspecific chemical cues attracted the majority of larvae (four out of the seven species tested); although while some species were equally attracted to cues from adults and juveniles (Chromis viridis, Apogon novemfasciatus), two exhibited greater sensitivity to adult cues (Pomacentrus pavo, Dascyllus aruanus). Our results indicate also that spying cues are those most commonly used by settling fishes (C. viridis, P. pavo, A. novemfasciatus). Only one species (D. aruanus) preferred the odour of conspecifics that had had visual contact with larvae (communication).

  16. External Ophthalmomyiasis Caused by a Rare Infesting Larva, Sarcophaga argyrostoma

    PubMed Central

    Graffi, Shmuel; Peretz, Avi; Wilamowski, Amos; Schnur, Heather; Akad, Fouad; Naftali, Modi


    Purpose. External ophthalmomyiasis (EO) is caused by infesting larvae belonging to various species of flies. Most documented cases result from sheep (Oestrus ovis) and Russian (Rhinoestrus purpureus) botfly larvae, but we recently discovered a rare case of EO caused by flesh fly (Sarcophaga argyrostoma) larvae. Here, we report the case of a patient with EO who had been hospitalized and sedated for 1 week because of unrelated pneumonia. Methods. Case report. Results. A total of 32 larvae were removed from the adnexae of both eyes. Larvae identification was confirmed through DNA analysis. Treatment with topical tobramycin resulted in complete resolution of EO. Conclusion. EO can be caused by S. argyrostoma, and the elderly and debilitated may require extra ocular protection against flies during sedation. PMID:24455366

  17. Neuromechanics of crawling in D. melanogaster larvae

    NASA Astrophysics Data System (ADS)

    Pehlevan, Cengiz; Paoletti, Paolo; Mahadevan, L.


    Nervous system, body and environment interact in non-trivial ways to generate locomotion and thence behavior in an organism. Here we present a minimal integrative mathematical model to describe the simple behavior of forward crawling in Drosophila larvae. Our model couples the excitation-inhibition circuits in the nervous system to force production in the muscles and body movement in a frictional environment, which in turn leads to a proprioceptive signal that feeds back to the nervous system. Our results explain the basic observed phenomenology of crawling with or without proprioception, and elucidate the stabilizing role of proprioception in crawling with respect to external and internal perturbations. Our integrated approach allows us to make testable predictions on the effect of changing body-environment interactions on crawling, and serves as a substrate for the development of hierarchical models linking cellular processes to behavior.

  18. Antibacterial properties of grapefruit seed extract against Paenibacillus larvae subsp. larvae.


    Semprini, P; Langella, V; Pasini, B; Falda, M T; Calvarese, S


    Twenty-one samples of grapefruit seed extract (GSE) either from marketed products or provided by an apiculturist were analysed to verify their inhibition activity, in particular against Paenibacillus larvae subsp. larvae, responsible for American foulbrood. The bactericide capacity of GSE has been measured in Bacillus subtilis BGA, Bacillus cereus 11778, Bacillus cereus K250 and Micrococcus luteus 9341a; these bacteria are normally used in the laboratory to study inhibitors. The results showed that not all GSE have the same inhibitory activity and two of those analysed do not inhibit the five bacteria used. Considering that 19 samples inhibited American foulbrood bacillus, the authors conclude that the use of a natural product (such as GSE) to control this important disease of bees, can be used as a substitute for chemotherapeutic products, after appropriate expedients.

  19. Iodine nutrition and toxicity in Atlantic cod (Gadus morhua) larvae.


    Penglase, S; Harboe, T; Sæle, O; Helland, S; Nordgreen, A; Hamre, K


    Copepods as feed promote better growth and development in marine fish larvae than rotifers. However, unlike rotifers, copepods contain several minerals such as iodine (I), at potentially toxic levels. Iodine is an essential trace element and both under and over supply of I can inhibit the production of the I containing thyroid hormones. It is unknown whether marine fish larvae require copepod levels of I or if mechanisms are present that prevent I toxicity. In this study, larval Atlantic cod (Gadus morhua) were fed rotifers enriched to intermediate (26 mg I kg(-1) dry weight; MI group) or copepod (129 mg I kg(-1) DW; HI group) I levels and compared to cod larvae fed control rotifers (0.6 mg I kg(-1) DW). Larval I concentrations were increased by 3 (MI) and 7 (HI) fold compared to controls during the rotifer feeding period. No differences in growth were observed, but the HI diet increased thyroid follicle colloid to epithelium ratios, and affected the essential element concentrations of larvae compared to the other groups. The thyroid follicle morphology in the HI larvae is typical of colloid goitre, a condition resulting from excessive I intake, even though whole body I levels were below those found previously in copepod fed cod larvae. This is the first observation of dietary induced I toxicity in fish, and suggests I toxicity may be determined to a greater extent by bioavailability and nutrient interactions than by total body I concentrations in fish larvae. Rotifers with 0.6 mg I kg(-1) DW appeared sufficient to prevent gross signs of I deficiency in cod larvae reared with continuous water exchange, while modelling of cod larvae versus rotifer I levels suggests that optimum I levels in rotifers for cod larvae is 3.5 mg I kg(-1) DW.

  20. Iodine nutrition and toxicity in Atlantic cod (Gadus morhua) larvae

    PubMed Central

    Penglase, S; Harboe, T; Sæle, Ø; Helland, S; Nordgreen, A


    Copepods as feed promote better growth and development in marine fish larvae than rotifers. However, unlike rotifers, copepods contain several minerals such as iodine (I), at potentially toxic levels. Iodine is an essential trace element and both under and over supply of I can inhibit the production of the I containing thyroid hormones. It is unknown whether marine fish larvae require copepod levels of I or if mechanisms are present that prevent I toxicity. In this study, larval Atlantic cod (Gadus morhua) were fed rotifers enriched to intermediate (26 mg I kg-1 dry weight; MI group) or copepod (129 mg I kg-1 DW; HI group) I levels and compared to cod larvae fed control rotifers (0.6 mg I kg-1 DW). Larval I concentrations were increased by 3 (MI) and 7 (HI) fold compared to controls during the rotifer feeding period. No differences in growth were observed, but the HI diet increased thyroid follicle colloid to epithelium ratios, and affected the essential element concentrations of larvae compared to the other groups. The thyroid follicle morphology in the HI larvae is typical of colloid goitre, a condition resulting from excessive I intake, even though whole body I levels were below those found previously in copepod fed cod larvae. This is the first observation of dietary induced I toxicity in fish, and suggests I toxicity may be determined to a greater extent by bioavailability and nutrient interactions than by total body I concentrations in fish larvae. Rotifers with 0.6 mg I kg-1 DW appeared sufficient to prevent gross signs of I deficiency in cod larvae reared with continuous water exchange, while modelling of cod larvae versus rotifer I levels suggests that optimum I levels in rotifers for cod larvae is 3.5 mg I kg-1 DW. PMID:23638355

  1. How to Kill the Honey Bee Larva: Genomic Potential and Virulence Mechanisms of Paenibacillus larvae

    PubMed Central

    Fünfhaus, Anne; Voss, Jörn; Gollnow, Kathleen; Poppinga, Lena; Liesegang, Heiko; Garcia-Gonzalez, Eva; Genersch, Elke; Daniel, Rolf


    Paenibacillus larvae, a Gram positive bacterial pathogen, causes American Foulbrood (AFB), which is the most serious infectious disease of honey bees. In order to investigate the genomic potential of P. larvae, two strains belonging to two different genotypes were sequenced and used for comparative genome analysis. The complete genome sequence of P. larvae strain DSM 25430 (genotype ERIC II) consisted of 4,056,006 bp and harbored 3,928 predicted protein-encoding genes. The draft genome sequence of P. larvae strain DSM 25719 (genotype ERIC I) comprised 4,579,589 bp and contained 4,868 protein-encoding genes. Both strains harbored a 9.7 kb plasmid and encoded a large number of virulence-associated proteins such as toxins and collagenases. In addition, genes encoding large multimodular enzymes producing nonribosomally peptides or polyketides were identified. In the genome of strain DSM 25719 seven toxin associated loci were identified and analyzed. Five of them encoded putatively functional toxins. The genome of strain DSM 25430 harbored several toxin loci that showed similarity to corresponding loci in the genome of strain DSM 25719, but were non-functional due to point mutations or disruption by transposases. Although both strains cause AFB, significant differences between the genomes were observed including genome size, number and composition of transposases, insertion elements, predicted phage regions, and strain-specific island-like regions. Transposases, integrases and recombinases are important drivers for genome plasticity. A total of 390 and 273 mobile elements were found in strain DSM 25430 and strain DSM 25719, respectively. Comparative genomics of both strains revealed acquisition of virulence factors by horizontal gene transfer and provided insights into evolution and pathogenicity. PMID:24599066

  2. Effects of various diets on the calcium and phosphorus composition of mealworms (Tenebrio molitor larvae) and superworms (Zophobas morio larvae).


    Latney, La'Toya V; Toddes, Barbara D; Wyre, Nicole R; Brown, Dorothy C; Michel, Kathryn E; Briscoe, Johanna A


    OBJECTIVE To evaluate whether the nutritive quality of Tenebrio molitor larvae and Zophobas morio larvae, which are commonly cultured as live food sources, is influenced by 4 commercially available diets used as nutritional substrates; identify which diet best improved calcium content of larvae; and identify the feeding time interval that assured the highest calcium intake by larvae. ANIMALS 2,000 Zophobas morio larvae (ie, superworms) and 7,500 Tenebrio molitor larvae (ie, mealworms). PROCEDURES Larvae were placed in control and diet treatment groups for 2-, 7-, and 10-day intervals. Treatment diets were as follows: wheat millings, avian hand feeding formula, organic avian mash diet, and a high-calcium cricket feed. Control groups received water only. After treatment, larvae were flash-frozen live with liquid nitrogen in preparation for complete proximate and mineral analyses. Analyses for the 2-day treatment group were performed in triplicate. RESULTS The nutrient composition of the high-calcium cricket feed groups had significant changes in calcium content, phosphorus content, and metabolizable energy at the 2-day interval, compared with other treatment groups, for both mealworms and superworms. Calcium content and calcium-to-phosphorus ratios for larvae in the high-calcium cricket feed group were the highest among the diet treatments for all treatment intervals and for both larval species. CONCLUSIONS AND CLINICAL RELEVANCE A 2-day interval with the high-calcium cricket feed achieved a larval nutrient composition sufficient to meet National Research Council dietary calcium recommendations for nonlactating rats. Mealworm calcium composition reached 2,420 g/1,000 kcal at 48 hours, and superworm calcium composition reached 2,070g/1,000 kcal at 48 hours. These findings may enable pet owners, veterinarians, insect breeders, and zoo curators to optimize nutritive content of larvae fed to insectivorous animals.

  3. [Effect of temperature on the viability of Trichinella spiralis larvae].


    Randazzo, Viviana R; La Sala, Luciano F; Costamagna, Sixto R


    The aim of this work was to study the effect of temperature on the viability of free and encysted larvae of Trichinella spiralis from southwest Buenos Aires province, Argentina. Larvae were treated at variable temperatures (-30 °C, -20 °C, 4 °C, 20 °C, gradual heating between 0-100 °C). The time necessary to kill 100 % of larvae was calculated. During the first days of freezing, larval mortality significantly increased as a function of time. Regardless of temperature, encysted larvae survived longer than the free ones. At -30 °C, -20 °C, and 20 °C there were no significant differences between the survival curves for each larval stage. At 4 °C, mortality was less severe for encysted larvae. All free and encysted larvae died at 61 days and 95 days (-30 °C), 160 days and 180 days (-20 °C), 280 days and 330 days (4 °C) and 460 days and 590 days (20 °C), respectively. Cooking at 90 °C and 100 °C during 15 minutes killed 100 % of free and encysted larvae, respectively. Our results suggest that temperatures and exposure times traditionally used to treat meat products with a potential to transmit T. spiralis are not entirely efficient.

  4. Effects of low temperatures on larvae of the genus Trichinella.


    Hulínská, D; Figallová, V; Shaikenov, B


    We examined the effect of an exposure to -25 degrees C (for 8 days) on the histochemistry and the fine structure of 30-day-old Trichinella larvae from muscle fibres of the diaphragm. The larvae of T. pseudospiralis and T. nelsoni were either destroyed in the muscle fibres, dead, eosinophile, or were not found. The structureless mass of a degenerating, changed sarcoplasm was highly AIP-active, and gave a weak positive reaction for SS-groups of proteins. The wall of the deformed capsule around T. nelsoni, and the cuticle of the larva, stained diffusely; it did not contain AM. In a few muscle fibres exposed to -25 degrees C, histochemical reactions of the capsule surrounding larvae of T. nativa and sometimes of larvae of T. spiralis, and reaction of the changed sarcoplasm, were similar to those of the controls. A few mobile larvae were isolated by digestion only from a diaphragm infected with T. nativa. Deterrent to a prolonged survival of larvae were the formation of ice crystals and a denaturation of proteins by which the sarcoplasm of the infected muscle fibre was changed gradually into both a plasmolytically and karyolytically altered mass. Degenerative changes in the fine structure of infected muscle fibres were demonstrated by the presence of "spheromembranous bodies" in the sarcoplasm resembling myeline formations observed after exposure to poisonous substances, e.g., colchicine.

  5. The phylogenetic significance of colour patterns in marine teleost larvae

    PubMed Central

    Baldwin, Carole C


    Ichthyologists, natural-history artists, and tropical-fish aquarists have described, illustrated, or photographed colour patterns in adult marine fishes for centuries, but colour patterns in marine fish larvae have largely been neglected. Yet the pelagic larval stages of many marine fishes exhibit subtle to striking, ephemeral patterns of chromatophores that warrant investigation into their potential taxonomic and phylogenetic significance. Colour patterns in larvae of over 200 species of marine teleosts, primarily from the western Caribbean, were examined from digital colour photographs, and their potential utility in elucidating evolutionary relationships at various taxonomic levels was assessed. Larvae of relatively few basal marine teleosts exhibit erythrophores, xanthophores, or iridophores (i.e. nonmelanistic chromatophores), but one or more of those types of chromatophores are visible in larvae of many basal marine neoteleosts and nearly all marine percomorphs. Whether or not the presence of nonmelanistic chromatophores in pelagic marine larvae diagnoses any major teleost taxonomic group cannot be determined based on the preliminary survey conducted, but there is a trend toward increased colour from elopomorphs to percomorphs. Within percomorphs, patterns of nonmelanistic chromatophores may help resolve or contribute evidence to existing hypotheses of relationships at multiple levels of classification. Mugilid and some beloniform larvae share a unique ontogenetic transformation of colour pattern that lends support to the hypothesis of a close relationship between them. Larvae of some tetraodontiforms and lophiiforms are strikingly similar in having the trunk enclosed in an inflated sac covered with xanthophores, a character that may help resolve the relationships of these enigmatic taxa. Colour patterns in percomorph larvae also appear to diagnose certain groups at the interfamilial, familial, intergeneric, and generic levels. Slight differences in generic

  6. Comparative genomics of 9 novel Paenibacillus larvae bacteriophages

    PubMed Central

    Stamereilers, Casey; LeBlanc, Lucy; Yost, Diane; Amy, Penny S.; Tsourkas, Philippos K.


    ABSTRACT American Foulbrood Disease, caused by the bacterium Paenibacillus larvae, is one of the most destructive diseases of the honeybee, Apis mellifera. Our group recently published the sequences of 9 new phages with the ability to infect and lyse P. larvae. Here, we characterize the genomes of these P. larvae phages, compare them to each other and to other sequenced P. larvae phages, and putatively identify protein function. The phage genomes are 38–45 kb in size and contain 68–86 genes, most of which appear to be unique to P. larvae phages. We classify P. larvae phages into 2 main clusters and one singleton based on nucleotide sequence identity. Three of the new phages show sequence similarity to other sequenced P. larvae phages, while the remaining 6 do not. We identified functions for roughly half of the P. larvae phage proteins, including structural, assembly, host lysis, DNA replication/metabolism, regulatory, and host-related functions. Structural and assembly proteins are highly conserved among our phages and are located at the start of the genome. DNA replication/metabolism, regulatory, and host-related proteins are located in the middle and end of the genome, and are not conserved, with many of these genes found in some of our phages but not others. All nine phages code for a conserved N-acetylmuramoyl-L-alanine amidase. Comparative analysis showed the phages use the “cohesive ends with 3′ overhang” DNA packaging strategy. This work is the first in-depth study of P. larvae phage genomics, and serves as a marker for future work in this area. PMID:27738559

  7. Anguilliform larvae collected off North Carolina

    USGS Publications Warehouse

    Ross, S.W.; Casazza, T.L.; Quattrini, A.M.; Sulak, K.J.


    The distinctive larval stage of eels (leptocephalus) facilitates dispersal through prolonged life in the open ocean. Leptocephali are abundant and diverse off North Carolina, yet data on distributions and biology are lacking. The water column (from surface to 1,293 m) was sampled in or near the Gulf Stream off Cape Hatteras, Cape Lookout, and Cape Fear, North Carolina during summer through fall of 1999-2005, and leptocephali were collected by neuston net, plankton net, Tucker trawl, and dip net. Additional samples were collected nearly monthly from a transect across southern Onslow Bay, North Carolina (from surface to 91 m) from April 2000 to December 2001 by bongo and neuston nets, Methot frame trawl, and Tucker trawl. Overall, 584 tows were completed, and 224 of these yielded larval eels. The 1,295 eel leptocephali collected (combining all methods and areas) represented at least 63 species (nine families). Thirteen species were not known previously from the area. Dominant families for all areas were Congridae (44% of individuals, 11 species), Ophichthidae (30% of individuals, 27 species), and Muraenidae (22% of individuals, ten species). Nine taxa accounted for 70% of the overall leptocephalus catches (in order of decreasing abundance): Paraconger caudilimbatus (Poey), Gymnothorax ocellatus Agassiz complex, Ariosoma balearicum (Delaroche), Ophichthus gomesii (Castelnau), Callechelys muraena Jordan and Evermann, Letharchus aliculatus McCosker, Rhynchoconger flavus (Goode and Bean), Ophichthus cruentifer (Goode and Bean), Rhynchoconger gracilior (Ginsburg). The top three species represented 52% of the total eel larvae collected. Most leptocephali were collected at night (79%) and at depths > 45 m. Eighty percent of the eels collected in discrete depth Tucker trawls at night ranged from mean depths of 59-353 m. A substantial number (38% of discrete depth sample total) of larval eels were also collected at the surface (neuston net) at night. Daytime leptocephalus

  8. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    NASA Astrophysics Data System (ADS)

    Aladawi, M. A.; Albarodi, H.; Hammoudeh, A.; Shamma, M.; Sharabi, N.


    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  9. Diel and seasonal distribution patterns of eggs, embryos and larvae of Twaite shad Alosa fallax fallax (Lacépède, 1803) in a lowland tidal river

    NASA Astrophysics Data System (ADS)

    Esteves, Eduardo; Pedro Andrade, José


    The anadromous Twaite shad Alosa fallax fallax (Lacépède, 1803) is globally classified as "Data Deficient" by the IUCN but the Instituto de Conservação da Natureza, Portugal, classified the species as "Vulnerable". In this study, the aims were to describe the putative diel, seasonal and inter-annual patterns of distribution and abundance of Twaite shad early life-history stages in a lowland tidal river, River Mira (south Portugal), and to examine how changes in temperature, rainfall, microplankton biomass, potential prey and competitors' predator abundance affect the distribution patterns using generalised additive models (GAM). Twaite shad yolk-sac larvae were collected indiscriminately at various times of day while larvae were more common during daylight hours in comparison to samples collected during the night, independently of tide. Moreover, A. f. fallax eggs, embryos and larvae were found in samples from late-March to mid-June. Peak densities were observed around late-April for eggs, mid-May for embryos and mid to late-May for larvae. The observed among- and within-year changes in abundance of Twaite shad embryos and larvae were related, through GAM, with a combination of environmental covariates, mainly in a non-linear way.

  10. Regulation of Life Cycle Checkpoints and Developmental Activation of Infective Larvae in Strongyloides stercoralis by Dafachronic Acid

    PubMed Central

    Pilgrim, Adeiye A.; Nolan, Thomas J.; Wang, Zhu; Kliewer, Steven A.; Mangelsdorf, David J.; Lok, James B.


    The complex life cycle of the parasitic nematode Strongyloides stercoralis leads to either developmental arrest of infectious third-stage larvae (iL3) or growth to reproductive adults. In the free-living nematode Caenorhabditis elegans, analogous determination between dauer arrest and reproductive growth is governed by dafachronic acids (DAs), a class of steroid hormones that are ligands for the nuclear hormone receptor DAF-12. Biosynthesis of DAs requires the cytochrome P450 (CYP) DAF-9. We tested the hypothesis that DAs also regulate S. stercoralis development via DAF-12 signaling at three points. First, we found that 1 μM Δ7-DA stimulated 100% of post-parasitic first-stage larvae (L1s) to develop to free-living adults instead of iL3 at 37°C, while 69.4±12.0% (SD) of post-parasitic L1s developed to iL3 in controls. Second, we found that 1 μM Δ7-DA prevented post-free-living iL3 arrest and stimulated 85.2±16.9% of larvae to develop to free-living rhabditiform third- and fourth-stages, compared to 0% in the control. This induction required 24–48 hours of Δ7-DA exposure. Third, we found that the CYP inhibitor ketoconazole prevented iL3 feeding in host-like conditions, with only 5.6±2.9% of iL3 feeding in 40 μM ketoconazole, compared to 98.8±0.4% in the positive control. This inhibition was partially rescued by Δ7-DA, with 71.2±16.4% of iL3 feeding in 400 nM Δ7-DA and 35 μM ketoconazole, providing the first evidence of endogenous DA production in S. stercoralis. We then characterized the 26 CYP-encoding genes in S. stercoralis and identified a homolog with sequence and developmental regulation similar to DAF-9. Overall, these data demonstrate that DAF-12 signaling regulates S. stercoralis development, showing that in the post-parasitic generation, loss of DAF-12 signaling favors iL3 arrest, while increased DAF-12 signaling favors reproductive development; that in the post-free-living generation, absence of DAF-12 signaling is crucial for iL3 arrest

  11. Simple clearing technique as species determination tool in blowfly larvae.


    Niederegger, Senta; Wartenberg, Nelly; Spiess, Roland; Mall, Gita


    A simple clearing technique is presented by which species specific structures and organs of blowfly larvae can easily be visualized and displayed without any danger of mechanical damages or dislocations of delicate formations and without fixation of the object.

  12. [Community features of Sacrabaeoida larvae in Stipa grandis steppe].


    Xinmin, Liu; Ning, Wu


    The study showed that in the Stipa grandis steppe of Inner Mongolia, there were 4 families and 9 species of Scarabaeoidea larvae, among which, the numbers of species and individuals of Melolonthidae were more than those of other families. The important value of the dominant species in Scarabaeoidea larvae community were Trematodes tenebrioides > Serica orientalis > Amphimallon solstitialis > Cyriopertha arcuata. Based on the features of their seasonal dynamics, they could be classified into three kinds. The first kind was that their density peak occurred in spring and autumn, such as Serica orientalis. Cyriopertha arcuata belonged to the second kind, and its density had no obvious fluctuation through all the year. Trematodes tenebrioides and Amphimallon solstitialis could be classified into the third kind, and their density peak all occurred in autumn. The biodiversity index of Scarabaeoidea larvae community was relatively higher in autumn than in spring and summer. Although the richness of Scarabaeoidea larvae populations was not lower in spring, their composition was very simple.

  13. Lead levels of Culex mosquito larvae inhabiting lead utilizing factory

    PubMed Central

    Kitvatanachai, S; Apiwathnasorn, C; Leemingsawat, S; Wongwit, W; Overgaard, HJ


    Objective To determine lead level primarily in Culex quinquefasciatus (Cx. quinquefasciatus), and Culex gelidus (Cx. gelidus) larvae inhabiting lead consuming factories, and to putatively estimate eco-toxicological impact of effluents from the firms. Methods Third instars larvae were sampled by standard dipping method and lead concentrations in the larvae and their respective surrounding factory aquatic environments were determined through standard atomic absorption spectrophotometry (AAS). Results Cx. quinquefasciatus was the most abundant species followed by Cx. gelidus. The levels of lead were higher in the Cx. quinquefasciatus (1.08-47.47 µg/g), than in the wastewaters surface (0.01-0.78 µg/mL) from the factories or closer areas around factories. Other species were not reaching the criteria for lead determination. Conclusions The Cx. quinquefasciatus larvae can bio-accumulate the metal and can potentially serve as a biomarker of lead contamination, to complemente conventional techniques. PMID:23569727

  14. Using Fish Larvae to Connect Landscapes to Coastal Fisheries

    EPA Science Inventory

    We show preliminary results from research using chemical biomarkers in fish larvae to refine our conceptual and quantative models that describe the flow of energy and nutrients from the land to coastal aquatic food webs.

  15. Culturing Embryos and Larvae of Marine Molluscs and Protochordates.

    ERIC Educational Resources Information Center

    Healey, R.; Turner, S. C.


    Presents a description for maintaining adult forms of molluscs and protochordates in order to obtain gametes for laboratory studies of animal development. The methods also include those for culturing embryonic larvae forms in vitro. (Author/SA)

  16. Improved Software for Quantifying the Behavior of Drosophila Larvae

    NASA Astrophysics Data System (ADS)

    Bernat, Natalie; Gershow, Marc

    A key advantage of small crawling organisms like C elegans and the Drosophila larva is that their behaviors may be assayed automatically using computer vision software. Current state of the art software is capable of detecting the positions and postures of crawling larvae and automatically categorize their behaviors in parallel. However, these algorithms, which are based on frame-by-frame analysis of thresholded black and white images, fail to correctly describe the postures of larvae executing sharp bends and have difficulty separating multiple larvae that are physically touching. We present new tracking software that uses intensity information in grayscale images and applies temporal smoothness constraints to positions and postures. We implemented this software as an ImageJ plugin, extending its portability and applicability.

  17. [The toxicity of different crude oils on mussel larva].


    Lucas, A; Le Roux, S; Pérès, J M


    Five natural oils of varied origins, mixed with sea water by stirring, have been shown to be toxic for mussel larvae, which have been contaminated during one hour. This toxicity, expressed by the mortality percentage and the growth rate after contamination, was dependent on the type and the concentration of oil. The tests were carried out on 20 h old and 5 days old larvae, and were similar and complementary.

  18. The use of fly larvae for organic waste treatment.


    Čičková, Helena; Newton, G Larry; Lacy, R Curt; Kozánek, Milan


    The idea of using fly larvae for processing of organic waste was proposed almost 100 years ago. Since then, numerous laboratory studies have shown that several fly species are well suited for biodegradation of organic waste, with the house fly (Musca domestica L.) and the black soldier fly (Hermetia illucens L.) being the most extensively studied insects for this purpose. House fly larvae develop well in manure of animals fed a mixed diet, while black soldier fly larvae accept a greater variety of decaying organic matter. Blow fly and flesh fly maggots are better suited for biodegradation of meat processing waste. The larvae of these insects have been successfully used to reduce mass of animal manure, fecal sludge, municipal waste, food scrapes, restaurant and market waste, as well as plant residues left after oil extraction. Higher yields of larvae are produced on nutrient-rich wastes (meat processing waste, food waste) than on manure or plant residues. Larvae may be used as animal feed or for production of secondary products (biodiesel, biologically active substances). Waste residue becomes valuable fertilizer. During biodegradation the temperature of the substrate rises, pH changes from neutral to alkaline, ammonia release increases, and moisture decreases. Microbial load of some pathogens can be substantially reduced. Both larvae and digested residue may require further treatment to eliminate pathogens. Facilities utilizing natural fly populations, as well as pilot and full-scale plants with laboratory-reared fly populations have been shown to be effective and economically feasible. The major obstacles associated with the production of fly larvae from organic waste on an industrial scale seem to be technological aspects of scaling-up the production capacity, insufficient knowledge of fly biology necessary to produce large amounts of eggs, and current legislation. Technological innovations could greatly improve performance of the biodegradation facilities and

  19. Characterization of secreted proteases of Paenibacillus larvae, potential virulence factors in honeybee larval infection

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Paenibacillus larvae is the causative agent of American Foulbrood (AFB), the most severe bacterial disease that affects honeybee larvae. AFB causes a significant decrease in the honeybee population affecting the beekeeping industry and agricultural production. After infection of larvae, P. larvae se...

  20. Immunohistological labeling of microtubules in sensory neuron dendrites, tracheae, and muscles in the Drosophila larva body wall.


    Yalgin, Cagri; Karim, M Rezaul; Moore, Adrian W


    To understand how differences in complex cell shapes are achieved, it is important to accurately follow microtubule organization. The Drosophila larval body wall contains several cell types that are models to study cell and tissue morphogenesis. For example tracheae are used to examine tube morphogenesis(1), and the dendritic arborization (DA) sensory neurons of the Drosophila larva have become a primary system for the elucidation of general and neuron-class-specific mechanisms of dendritic differentiation(2-5) and degeneration(6). The shape of dendrite branches can vary significantly between neuron classes, and even among different branches of a single neuron(7,8). Genetic studies in DA neurons suggest that differential cytoskeletal organization can underlie morphological differences in dendritic branch shape(4,9-11). We provide a robust immunological labeling method to assay in vivo microtubule organization in DA sensory neuron dendrite arbor (Figures 1, 2, Movie 1). This protocol illustrates the dissection and immunostaining of first instar larva, a stage when active sensory neuron dendrite outgrowth and branching organization is occurring (12,13). In addition to staining sensory neurons, this method achieves robust labeling of microtubule organization in muscles (Movies 2, 3), trachea (Figure 3, Movie 3), and other body wall tissues. It is valuable for investigators wishing to analyze microtubule organization in situ in the body wall when investigating mechanisms that control tissue and cell shape.

  1. Larva migrans in squirrel monkeys experimentally infected with Baylisascaris potosis.


    Tokiwa, Toshihiro; Tsugo, Kosuke; Nakamura, Shohei; Taira, Kensuke; Une, Yumi


    Roundworms of the genus Baylisascaris are natural parasites primarily of wild carnivores, and they can occasionally cause infection in humans and animals. Infection results in visceral larva migrans and/or neural larva migrans, which can be severe or fatal in some animals. Recently, Baylisascaris nematodes isolated from kinkajous (Potos flavus) and previously referred to as Baylisascaris procyonis were renamed as Baylisascaris potosis; however, data regarding the pathogenicity of B. potosis towards animals and humans are lacking. In the present study, we experimentally infected squirrel monkeys (Saimiri sciureus) with B. potosis to determine the suitability of the monkey as a primate model. We used embryonated eggs of B. potosis at two different doses (10,000 eggs and 100,000 eggs) and examined the animals at 30 days post-infection. Histopathological examination showed the presence of B. potosis larvae and infiltration of inflammatory cells around a central B. potosis larvae in the brain, intestines, and liver. Nevertheless, the monkeys showed no clinical signs associated with infection. Parasitological examination revealed the presence of B. potosis larvae in the intestines, liver, lung, muscles, brain, kidney, and diaphragm. Our findings extend the range of species that are susceptible to B. potosis and provide evidence for the zoonotic potential of larva migrans in high dose infections.

  2. Biorheological action of Ascaris lumbricoides larvae on human erythrocytes.


    de León, Patricia Ponce; Del Balzo, Gonzalo; Riquelme, Bibiana


    Previous studies have shown that A. lumbricoides extracts capture sialic acid (SA) from human red blood cells (RBC). The aim of this work was to study hemorheological alterations in vitro caused by parasite larvae. The biorheological action of three larva concentrates of first and second larval stage on group O erythrocytes was analyzed by incubating the erythrocyte packed together with an equal volume of larvae (treated RBC) and PBS (control RBC). Distribution and parameters of aggregation (digital image analysis), aggregation kinetics (erythroaggregameter), and viscoelasticity (erythrodeformeter) were measured. The digital image analysis showed that all the larvae diminished the isolated cells percentage and increased the size of the formed aggregates. The aggregate formation velocity was lower in the treated than in the control. The deformability index (ID) values of treated RBC did not present variations with respect to those of the control, but a decrease in the erythrocyte elastic modulus (μ(m)) and membrane surface viscosity (η(m)) values was observed, indicating that the larvae not only induced a diminution in the membrane surface viscosity of RBC but also altered the dynamic viscoelasticity of the membrane. Experiments carried out in vitro support the conclusion that the contact between larvae and RBC produces hemorheological alterations.

  3. Incorporation of bacterial extracellular polysaccharide by black fly larvae (Simuliidae)

    USGS Publications Warehouse

    Couch, C.A.; Meyer, J.L.; Hall, R.O.


    Black fly larvae (Simulium) assimilated, with high efficiency (80-90%), bacterial extracellular polysaccharide (EPS) extracted from laboratory cultures of a pseudomonad isolated from the Ogeechee River. Incorporation was traced using 13C-labelled EPS offered to larvae as a coating on a mixture of 1-??m latex beads and kaolin particles. These EPS-coated particles were used to simulate natural particles, both living and dead. Solubility, protein, and nitrogen content of the EPS suggested it was a slime rather than a capsular polysaccharide. Glycosyl composition of the EPS was glucose and galactose in ?? and ?? linkages, with pyruvate, succinate, and possibly malonate constituent groups. To evaluate the incorporation of C derived from protein associated with the EPS matrix, feeding experiments were conducted using EPS with and without proteins extracted. Black fly larvae incorporated 7.2 ??g EPS C larva-1 d-1 from EPS that did not have proteins extracted, and 19.5 ??g EPS C larva-1 d-1 from EPS with proteins extracted. Carbon in protein that is typically associated with EPS was not solely or selectively incorporated. EPS incorporation rates are similar to rates of cellular bacterial carbon incorporation previously estimated for Ogeechee River black fly larvae. If EPS is generally available as a food resource, the importance of bacteria in detrital food webs may be underestimated by studies that examine only the consumption of bacterial cells.

  4. Sun-Compass Orientation in Mediterranean Fish Larvae

    PubMed Central

    Faillettaz, Robin; Blandin, Agathe; Paris, Claire B.; Koubbi, Philippe; Irisson, Jean-Olivier


    Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history, larvae of coastal species have to head back to the shore at the end of their pelagic episode, to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues on orientation. In this study we quantified the in situ orientation behavior of settlement-stage larvae in a temperate region, with a continuous coast and a dominant along-shore current, and inspected both coast-dependent and independent cues. We tested six species: one Pomacentridae, Chromis chromis, and five Sparidae, Boops boops, Diplodus annularis, Oblada melanura, Spicara smaris and Spondyliosoma cantharus. Over 85% of larvae were highly capable of keeping a bearing, which is comparable to the orientation abilities of tropical species. Sun-related cues influenced the precision of bearing-keeping at individual level. Three species, out of the four tested in sufficient numbers, oriented significantly relative to the sun position. These are the first in situ observations demonstrating the use of a sun compass for orientation by wild-caught settlement-stage larvae. This mechanism has potential for large-scale orientation of fish larvae globally. PMID:26308915

  5. Description of larva and puparium of Oplodontha rubrithorax (Diptera: Stratiomyidae) from the Oriental Region.


    Nerudová, Jana; Kovac, Damir; Tóthová, Andrea


    This is the first description of larva and puparium of Oplodontha rubrithorax (Macquart, 1838) from the Oriental Region. Larvae were found at a hot spring in North Thailand. The morphological features and cuticular structures of the larva are documented by drawings and SEM micrographs and the main characters are compared with the European O. viridula (Fabricius, 1775), the only described larva of this genus. Differences between larvae of both species were only found in pubescence. The characteristic, somewhat dilated and slightly clavate hairs on the dorsal surface of the body segments of O. viridula larva are apparently lacking in the larva of O. rubrithorax.

  6. O que bilíngues bimodais têm a nos dizer sobre desenvolvimento bilíngue?

    PubMed Central

    de Quadros, Ronice Müller; Lillo-Martin, Diane; Pichler, Deborah Chen


    O objetivo deste trabalho é apresentar o que as pesquisas que estamos desenvolvendo com crianças ouvintes, filhas de pais surdos, adquirindo Língua Brasileira de Sinais (Libras) e Português e Língua de Sinais Americana (ASL) e Inglês (Lillo-Martin et al. 2010) têm a nos dizer sobre desenvolvimento bilíngue. Os dados deste estudo fazem parte de um banco de dados de interações espontâneas coletadas longitudinalmente, alternando contextos de aquisição da Libras e do português como língua alvo, no Brasil e dados coletados longitudinalmente. nos mesmos contextos, de crianças adquirindo ASL e inglês1. Além disso, há também dados do estudo experimental com testes aplicados nos dois pares de línguas que se agregam ao presente estudo. Uma visão geral dos estudos desenvolvidos sobre a aquisição bilíngue bimodal por crianças ouvintes, filhas de pais surdos, será apresentada e, então, serão expostos alguns aspectos linguísticos deste tipo de aquisição, considerando as discussões sobre aquisição bilíngue a partir da pesquisa realizada. PMID:24431480

  7. Serodiagnosis of toxocariasis by ELISA using crude antigen of Toxocara canis larvae.


    Jin, Yan; Shen, Chenghua; Huh, Sun; Sohn, Woon-Mok; Choi, Min-Ho; Hong, Sung-Tae


    Toxocariasis is a worldwide zoonosis caused by larvae of ascarid nematodes of dogs or cats, Toxocara canis or T. cati. Diagnosis of human toxocariasis currently relies on serology that uses T. canis excretory-secretory antigen to detect specific IgG antibodies by ELISA. We investigated the serodiagnostic efficacy of ELISA using crude antigen of T. canis larvae (TCLA). Serum specimens of 64 clinically confirmed toxocariasis, 115 healthy controls, and 119 other tissue-invading helminthiases were screened by ELISA using TCLA. The ELISA using TCLA showed 92.2% (59/64 patient samples) sensitivity and 86.6% (103/119) specificity. Its positive diagnostic predictivity was 78.7% and negative predictivity was 97.8%. No serum of healthy controls reacted but that of anisakiasis (45.5%), gnathostomiasis (19.2%), clonorchiasis (15.8%), sparganosis (11.1%), and cysticercosis (6.3%) cross-reacted. Immunoblot analysis on TCLA recognized antigenic proteins of 28- and 30-kDa bands in their dominant protein quantity and strong blotting reactivity. The present results indicate that the ELISA using our TCLA antigen is acceptable by the sensitivity and specificity for serodiagnosis of human toxocariasis. ELISA with TCLA is recommended to make differential diagnosis for patients with any sign of organ infiltration and eosinophilia.

  8. Retention of crab larvae in a coastal null zone

    NASA Astrophysics Data System (ADS)

    Tilburg, Charles E.; Dittel, Ana I.; Epifanio, Charles E.


    Alongshelf transport in the southern Middle Atlantic Bight is forced by buoyancy-driven currents originating in three large estuaries along the bight. These currents are strongest in the coastal ocean near the southern terminus of each estuary, while the analogous region on the northern side is characterized by weak subtidal flow. We used a combination of field observations and numerical modeling to test the hypothesis that these regions of weak subtidal flow are coastal null zones that serve as retention areas for larvae. The field study consisted of a four-day, shipboard investigation of the distribution of blue crab larvae ( Callinectes sapidus) near the mouth of Delaware Bay (˜39°N, 75°W) in late summer, 2004. Hydrographic surveys of the study site were conducted with a hull-mounted, surface-measuring system. Results showed a sharp boundary between the null zone and the buoyancy-driven current to the south. Blue crab larvae were collected in surface plankton tows along a 30-km transect that encompassed these two areas. Stations with higher densities of larvae were clustered in the null zone during both ebb and flood tides. A numerical model was used to examine the physical mechanisms responsible for the observed distribution. Model results agreed with the field survey and showed that simulated larvae are aggregated in the null zone. The simulations also demonstrated that larvae spawned within the null zone have a much greater probability of settling in juvenile nursery habitat within the bay. The close agreement between field and model results provides consistent support for the hypothesis that coastal null zones associated with the buoyancy-driven circulation of large estuaries may allow retention of larvae in the vicinity of the natal spawning population.

  9. Downregulation of dTps1 in Drosophila melanogaster larvae confirms involvement of trehalose in redox regulation following desiccation.


    Thorat, Leena; Mani, Krishna-Priya; Thangaraj, Pradeep; Chatterjee, Suvro; Nath, Bimalendu B


    As a survival strategy to environmental water deficits, desiccation-tolerant organisms are commonly known for their ability to recruit stress-protective biomolecules such as trehalose. We have previously reported the pivotal role of trehalose in larval desiccation tolerance in Drosophila melanogaster. Trehalose has emerged as a versatile molecule, serving mainly as energy source in insects and also being a stress protectant. While several recent reports have revealed the unconventional role of trehalose in scavenging reactive oxygen species in yeast and plants, this aspect has not received much attention in animals. We examined the status of desiccation-induced generation of reactive oxygen species in D. melanogaster larvae and the possible involvement of trehalose in ameliorating the harmful consequences thereof. Insect trehalose synthesis is governed by the enzyme trehalose 6-phosphate synthase 1 (TPS1). Using the ubiquitous da-GAL4-driven expression of the dTps1-RNAi transgene, we generated dTps1-downregulated Drosophila larvae possessing depleted levels of dTps1 transcripts. This resulted in the inability of the larvae for trehalose synthesis, thereby allowing us to elucidate the significance of trehalose in the regulation of desiccation-responsive redox homeostasis. Furthermore, the results from molecular genetics studies, biochemical assays, electron spin resonance analyses and a simple, non-invasive method of whole larval live imaging suggested that trehalose in collaboration with superoxide dismutase (SOD) is involved in the maintenance of redox state in D. melanogaster.

  10. Image Enhancement for Tracking the Translucent Larvae of Drosophila melanogaster

    PubMed Central

    Atkinson, Nigel S.


    Drosophila melanogaster larvae are model systems for studies of development, synaptic transmission, sensory physiology, locomotion, drug discovery, and learning and memory. A detailed behavioral understanding of larvae can advance all these fields of neuroscience. Automated tracking can expand fine-grained behavioral analysis, yet its full potential remains to be implemented for the larvae. All published methods are unable to track the larvae near high contrast objects, including the petri-dish edges encountered in many behavioral paradigms. To alleviate these issues, we enhanced the larval contrast to obtain complete tracks. Our method employed a dual approach of optical-contrast boosting and post-hoc image processing for contrast enhancement. We reared larvae on black food media to enhance their optical contrast through darkening of their digestive tracts. For image processing we performed Frame Averaging followed by Subtraction then Thresholding (FAST). This algorithm can remove all static objects from the movie, including petri-dish edges prior to processing by the image-tracking module. This dual approach for contrast enhancement also succeeded in overcoming fluctuations in illumination caused by the alternating current power source. Our tracking method yields complete tracks, including at the edges of the behavioral arena and is computationally fast, hence suitable for high-throughput fine-grained behavioral measurements. PMID:21209929

  11. Dynamics of Social Behavior in Fruit Fly Larvae

    PubMed Central

    Durisko, Zachary; Kemp, Rebecca; Mubasher, Rameeshay; Dukas, Reuven


    We quantified the extent and dynamics of social interactions among fruit fly larvae over time. Both a wild-type laboratory population and a recently-caught strain of larvae spontaneously formed social foraging groups. Levels of aggregation initially increased during larval development and then declined with the wandering stage before pupation. We show that larvae aggregated more on hard than soft food, and more at sites where we had previously broken the surface of the food. Groups of larvae initiated burrowing sooner than solitary individuals, indicating that one potential benefit of larval aggregations is an improved ability to dig and burrow into the food substrate. We also show that two closely related species, D. melanogaster and D. simulans, differ in their tendency to aggregate, which may reflect different evolutionary histories. Our protocol for quantifying social behavior in larvae uncovered robust social aggregations in this simple model, which is highly amenable to neurogenetic analyses, and can serve for future research into the mechanisms and evolution of social behavior. PMID:24740198

  12. Constrained circulation at Endeavour ridge facilitates colonization by vent larvae.


    Thomson, Richard E; Mihály, Steven F; Rabinovich, Alexander B; McDuff, Russell E; Veirs, Scott R; Stahr, Frederick R


    Understanding how larvae from extant hydrothermal vent fields colonize neighbouring regions of the mid-ocean ridge system remains a major challenge in oceanic research. Among the factors considered important in the recruitment of deep-sea larvae are metabolic lifespan, the connectivity of the seafloor topography, and the characteristics of the currents. Here we use current velocity measurements from Endeavour ridge to examine the role of topographically constrained circulation on larval transport along-ridge. We show that the dominant tidal and wind-generated currents in the region are strongly attenuated within the rift valley that splits the ridge crest, and that hydrothermal plumes rising from vent fields in the valley drive a steady near-bottom inflow within the valley. Extrapolation of these findings suggests that the suppression of oscillatory currents within rift valleys of mid-ocean ridges shields larvae from cross-axis dispersal into the inhospitable deep ocean. This effect, augmented by plume-driven circulation within rift valleys having active hydrothermal venting, helps retain larvae near their source. Larvae are then exported preferentially down-ridge during regional flow events that intermittently over-ride the currents within the valley.

  13. Phylogenetics links monster larva to deep-sea shrimp.


    Bracken-Grissom, Heather D; Felder, Darryl L; Vollmer, Nicole L; Martin, Joel W; Crandall, Keith A


    Mid-water plankton collections commonly include bizarre and mysterious developmental stages that differ conspicuously from their adult counterparts in morphology and habitat. Unaware of the existence of planktonic larval stages, early zoologists often misidentified these unique morphologies as independent adult lineages. Many such mistakes have since been corrected by collecting larvae, raising them in the lab, and identifying the adult forms. However, challenges arise when the larva is remarkably rare in nature and relatively inaccessible due to its changing habitats over the course of ontogeny. The mid-water marine species Cerataspis monstrosa (Gray 1828) is an armored crustacean larva whose adult identity has remained a mystery for over 180 years. Our phylogenetic analyses, based in part on recent collections from the Gulf of Mexico, provide definitive evidence that the rare, yet broadly distributed larva, C. monstrosa, is an early developmental stage of the globally distributed deepwater aristeid shrimp, Plesiopenaeus armatus. Divergence estimates and phylogenetic relationships across five genes confirm the larva and adult are the same species. Our work demonstrates the diagnostic power of molecular systematics in instances where larval rearing seldom succeeds and morphology and habitat are not indicative of identity. Larval-adult linkages not only aid in our understanding of biodiversity, they provide insights into the life history, distribution, and ecology of an organism.

  14. Larvicidal activity of Brazilian plant essential oils against Coenagrionidae larvae.


    Silva, D T; Silva, L L; Amaral, L P; Pinheiro, C G; Pires, M M; Schindler, B; Garlet, Q I; Benovit, S C; Baldisserotto, B; Longhi, S J; Kotzian, C B; Heinzmann, B M


    Odonate larvae can be serious pests that attack fish larvae, postlarvae, and fingerlings in fish culture tanks, causing significant loss in the supply and production of juveniles. This study reports a screen of the essential oils (EOs) of Nectandra megapotamica (Sprengel) Mez, Nectandra grandiflora Nees, Hesperozygis ringens (Bentham) Epling, Ocimum gratissimum L., Aloysia gratissima (Gillies & Hooker) Troncoso, and Lippia sidoides Chamisso against Coenagrionidae larvae. In addition, the most effective EO and its 50% lethal concentration (LC50) and chemical analysis are described. The larvae of Acanthagrion Selys, Homeoura Kennedy, Ischnura Charpentier, and Oxyagrion Selys were used to assess the EO effects. EO obtained from H. ringens, O. gratissimum, and L. sidoides showed the highest larvicidal effects at 19 h of treatment. The major constituents of the EO of H. ringens include pulegone and limonene, while eugenol and Z-beta-ocimene predominate in the EO of O. gratissimum, and carvacrol and rho-cymene were the major compounds of the EO of L. sidoides. Leaf EOs from H. ringens, O. gratissimum, and L. sidoides showed activity against Coenagrionidae larvae at similar concentrations with LC50s of 62.92, 75.05, and 51.65 microl liter(-1), respectively, and these were considered the most promising treatments.

  15. Phylogenetics links monster larva to deep-sea shrimp

    PubMed Central

    Bracken-Grissom, Heather D; Felder, Darryl L; Vollmer, Nicole L; Martin, Joel W; Crandall, Keith A


    Mid-water plankton collections commonly include bizarre and mysterious developmental stages that differ conspicuously from their adult counterparts in morphology and habitat. Unaware of the existence of planktonic larval stages, early zoologists often misidentified these unique morphologies as independent adult lineages. Many such mistakes have since been corrected by collecting larvae, raising them in the lab, and identifying the adult forms. However, challenges arise when the larva is remarkably rare in nature and relatively inaccessible due to its changing habitats over the course of ontogeny. The mid-water marine species Cerataspis monstrosa (Gray 1828) is an armored crustacean larva whose adult identity has remained a mystery for over 180 years. Our phylogenetic analyses, based in part on recent collections from the Gulf of Mexico, provide definitive evidence that the rare, yet broadly distributed larva, C. monstrosa, is an early developmental stage of the globally distributed deepwater aristeid shrimp, Plesiopenaeus armatus. Divergence estimates and phylogenetic relationships across five genes confirm the larva and adult are the same species. Our work demonstrates the diagnostic power of molecular systematics in instances where larval rearing seldom succeeds and morphology and habitat are not indicative of identity. Larval–adult linkages not only aid in our understanding of biodiversity, they provide insights into the life history, distribution, and ecology of an organism. PMID:23145324

  16. Cold tolerance of third-instar Drosophila suzukii larvae.


    Jakobs, Ruth; Ahmadi, Banafsheh; Houben, Sarah; Gariepy, Tara D; Sinclair, Brent J


    Drosophila suzukii is an emerging global pest of soft fruit; although it likely overwinters as an adult, larval cold tolerance is important both for determining performance during spring and autumn, and for the development of temperature-based control methods aimed at larvae. We examined the low temperature biology of third instar feeding and wandering larvae in and out of food. We induced phenotypic plasticity of thermal biology by rearing under short days and fluctuating temperatures (5.5-19°C). Rearing under fluctuating temperatures led to much slower development (42.1days egg-adult) compared to control conditions (constant 21.5°C; 15.7days), and yielded larger adults of both sexes. D. suzukii larvae were chill-susceptible, being killed by low temperatures not associated with freezing, and freezing survival was not improved when ice formation was inoculated externally via food or silver iodide. Feeding larvae were more cold tolerant than wandering larvae, especially after rearing under fluctuating temperatures, and rearing under fluctuating temperatures improved survival of prolonged cold (0°C) to beyond 72h in both larval stages. There was no evidence that acute cold tolerance could be improved by rapid cold-hardening. We conclude that D. suzukii has the capacity to develop at low temperatures under fluctuating temperatures, but that they have limited cold tolerance. However, phenotypic plasticity of prolonged cold tolerance must be taken into account when developing low temperature treatments for sanitation of this species.

  17. Feeding ecology of lake whitefish larvae in eastern Lake Ontario

    USGS Publications Warehouse

    Johnson, James H.; McKenna, James E.; Chalupnicki, Marc A.; Wallbridge, Tim; Chiavelli, Rich


    We examined the feeding ecology of larval lake whitefish (Coregonus clupeaformis) in Chaumont Bay, Lake Ontario, during April and May 2004-2006. Larvae were collected with towed ichthyoplankton nets offshore and with larval seines along the shoreline. Larval feeding periodicity was examined from collections made at 4-h intervals over one 24-h period in 2005. Inter-annual variation in diet composition (% dry weight) was low, as was spatial variation among collection sites within the bay. Copepods (81.4%), primarily cyclopoids (59.1%), were the primary prey of larvae over the 3-year period. Cladocerans (8.1%; mainly daphnids, 6.7%) and chironomids (7.3%) were the other major prey consumed. Larvae did not exhibit a preference for any specific prey taxa. Food consumption of lake whitefish larvae was significantly lower at night (i.e., 2400 and 0400 h). Substantial variation in diet composition occurred over the 24-h diel study. For the 24-h period, copepods were the major prey consumed (50.4%) and their contribution in the diet ranged from 29.3% (0400 h) to 85.9% (1200 h). Chironomids made up 33.4% of the diel diet, ranging from 8.0% (0800 h) to 69.9% (0400 h). Diel variation in the diet composition of lake whitefish larvae may require samples taken at several intervals over a 24-h period to gain adequate representation of their feeding ecology.

  18. High magnetic field induced otolith fusion in the zebrafish larvae

    PubMed Central

    Pais-Roldán, Patricia; Singh, Ajeet Pratap; Schulz, Hildegard; Yu, Xin


    Magnetoreception in animals illustrates the interaction of biological systems with the geomagnetic field (geoMF). However, there are few studies that identified the impact of high magnetic field (MF) exposure from Magnetic Resonance Imaging (MRI) scanners (>100,000 times of geoMF) on specific biological targets. Here, we investigated the effects of a 14 Tesla MRI scanner on zebrafish larvae. All zebrafish larvae aligned parallel to the B0 field, i.e. the static MF, in the MRI scanner. The two otoliths (ear stones) in the otic vesicles of zebrafish larvae older than 24 hours post fertilization (hpf) fused together after the high MF exposure as short as 2 hours, yielding a single-otolith phenotype with aberrant swimming behavior. The otolith fusion was blocked in zebrafish larvae under anesthesia or embedded in agarose. Hair cells may play an important role on the MF-induced otolith fusion. This work provided direct evidence to show that high MF interacts with the otic vesicle of zebrafish larvae and causes otolith fusion in an “all-or-none” manner. The MF-induced otolith fusion may facilitate the searching for MF sensors using genetically amenable vertebrate animal models, such as zebrafish. PMID:27063288

  19. Activity of Thymus vulgaris essential oil against Anisakis larvae.


    Giarratana, F; Muscolino, D; Beninati, C; Giuffrida, A; Panebianco, A


    Anisakiasis is an important food-borne disease especially in countries with high fish consumption. The increase of cases of human disease and the virtual absence of effective treatments have prompted the research on new active compounds against Anisakis larvae. As well known, the disease is related to the consumption of raw or almost raw seafood products, but also marinated and/or salted fishery products, if the processing is insufficient to destroy nematode larvae can represent a risks for the consumers. In the light of the biocidal efficacy against different pathogens demonstrated for various essential oils, the aim of this work is to evaluate the effect of Thymus vulgaris essential oil (TEO) against anisakidae larvae. The TEO at 10% and 5% concentration in oil sunflower seeds, caused in vitro the death of all larvae within 14 h, with cuticle and intestinal wall damages. The results obtained showing a significant activity against Anisakis larvae, suggest further investigation on TEO as a larvicidal agent and on its potential use in the industrial marinating process.

  20. Visceral and Neural Larva Migrans in Rhesus Macaques

    PubMed Central

    Gozalo, Alfonso S; Maximova, Olga A; StClaire, Marisa C; Montali, Richard J; Ward, Jerrold M; Cheng, Lily I; Elkins, William R; Kazacos, Kevin R


    Large ascarid larvae within granulomas were noted histologically in the mesenteric and pancreatic lymph nodes of 13 of 21 rhesus macaques (Macaca mulatta) euthanized as part of an experimental viral pathogenesis study. In addition, 7 of the 13 monkeys had cerebral granulomas, which in 4 animals contained nematode larvae similar to those within the lymph nodes. Despite the lesions, the animals did not show clinical signs associated with the parasitic infections. Characteristics of the larvae included, on cross-section, a midbody diameter of approximately 60 to 80 µm, a centrally located and slightly compressed intestine flanked on either side by large triangular excretory columns, and prominent single lateral cuticular alae. The morphology of the larvae was compatible with Baylisascaris spp. Baylisascariasis is a well-described infection of animals and humans that is caused by migrating larvae of the raccoon roundworm, Baylisascaris procyonis. A similar species, B. columnaris, is found in skunks and can cause cerebrospinal nematodiasis, but most reported cases of baylisascariasis have been due to B. procyonis. Our macaques were born free-ranging on an island in the southeastern United States where raccoons, but not skunks, were found to be common inhabitants, indicating that B. procyonis was the most likely parasite involved. These cases are similar to the low-level or covert cases of Baylisascaris infection described to occur in humans and provide further evidence of the existence of this parasite in the southeastern United States. PMID:18702454

  1. Susceptibility of some vertebrate hosts to infection with early third-stage larvae of Gnathostoma hispidum.


    Sohn, W M; Lee, S H


    Susceptibility of some vertebrates was examined to the early third-stage larvae (EL3) of Gnathostoma hispidum. The larvae collected from the Chinese loaches were infected to 4 silk carps, 3 snake heads, 3 bullfrogs, 5 mice and 9 albino rats. No worms were detected in fish, silk carps and snake heads. In 3 bullfrogs fed 30 larvae, a total of 9 EL3 was recovered in the gastrointestinal tract (8 larvae) and liver (one). In 5 mice infected with 50 larvae, a total of 37 (74.0%) advanced third-stage larvae (AdL3) was recovered from the muscle (31 larvae), liver (5 larvae) and kidney at 4 weeks after infection. In 9 albino rats infected with 115 larvae, a total of 40 (34.8%) AdL3 was found in the muscle. The mammalian hosts were found susceptible to the EL3 of G. hispidum from Chinese loaches.

  2. Lipid and fatty acid analysis of uninfected and granulosis virus-infected Plodia interpunctella larvae

    NASA Technical Reports Server (NTRS)

    Shastri-Bhalla, K.; Consigli, R. A.; Spooner, B. S. (Principal Investigator)


    A comparative study on the lipid and fatty acid composition of the uninfected and GV-infected Plodia interpunctella larvae was performed. Higher levels of free fatty acids were found in GV-infected larvae compared to those of the uninfected larvae, while the latter had more triacylglycerol compared to the former. The known identified phospholipids were fewer in the GV-infected larvae compared to those in the uninfected larvae. However, an unidentified phospholipid was found to be approximately two times higher in GV-infected larvae. The total lipid of both larvae had palmitic, oleic, and linoleic as the major fatty acids. The fatty acid composition of the GV-infected larval phospholipid differed considerably compared to that of the uninfected larvae, in that the ratio of unsaturated fatty acid to saturated fatty acid was 3.5 times less in the GV-infected larvae.

  3. Isosmotic media prevent edema in amphibian larvae without cardiac function.


    Smith, S C


    The absence of cardiac and circulatory function causes severe edema in amphibian embryos. Analyzing the roles of embryonic and larval circulation in respiration may thus be confounded by the increased diffusion distance and decreased surface area/volume ratio caused by edema. Similarly, detailed morphological analyses of embryos/larvae with defective circulatory or renal function is difficult or impossible due to the gross morphological anomalies engendered by edematous swelling. To circumvent these problems, two media have been developed which are isosmotic with the plasma of a common experimental amphibian species (Ambystoma mexicanun). These media are remarkably effective in preventing fluid accumulation in embryos and larvae lacking heart function and, when used in slightly lower concentrations, cause no apparent harm to embryos and larvae with normal circulation for periods up to 3 weeks. These media should prove useful for a variety of studies on the developmental physiology of the circulatory system and possibly also when examining the development of renal function and ionoregulation.

  4. Paenibacillus larvae-Directed Bacteriophage HB10c2 and Its Application in American Foulbrood-Affected Honey Bee Larvae.


    Beims, Hannes; Wittmann, Johannes; Bunk, Boyke; Spröer, Cathrin; Rohde, Christine; Günther, Gabi; Rohde, Manfred; von der Ohe, Werner; Steinert, Michael


    Paenibacillus larvae is the causative agent of American foulbrood (AFB), the most serious honey bee brood bacterial disease. We isolated and characterized P. larvae-directed bacteriophages and developed criteria for safe phage therapy. Whole-genome analysis of a highly lytic virus of the family Siphoviridae (HB10c2) provided a detailed safety profile and uncovered its lysogenic nature and a putative beta-lactamase-like protein. To rate its antagonistic activity against the pathogens targeted and to specify potentially harmful effects on the bee population and the environment, P. larvae genotypes ERIC I to IV, representatives of the bee gut microbiota, and a broad panel of members of the order Bacillales were analyzed for phage HB10c2-induced lysis. Breeding assays with infected bee larvae revealed that the in vitro phage activity observed was not predictive of the real-life scenario and therapeutic efficacy. On the basis of the disclosed P. larvae-bacteriophage coevolution, we discuss the future prospects of AFB phage therapy.

  5. Fish larvae at fronts: Horizontal and vertical distributions of gadoid fish larvae across a frontal zone at the Norwegian Trench

    NASA Astrophysics Data System (ADS)

    Munk, Peter


    The reproduction and early life history of many fish species are linked to the physical and biological characteristics of fronts. In order to ascertain linkages between frontal physics and fish larvae, we investigated distributional differences among gadoid fish larvae comparing these to both horizontal and vertical variability in hydrography and abundances of potential copepod prey The investigation was carried out at a frontal zone along the Norwegian Trench in the northern North Sea, and was based on a series of cross-bathymetric sampling transects. Tows with a large ring net and an opening-closing net were used for describing fish larval horizontal and vertical distributions, while a submersible pump was used for describing vertical distributions of copepods. Hydrographic profiles and current velocity measurements were used to outline variability in temperature, salinity and current structure. Measurements demonstrated a distinct bottom front at the southern slope of the Trench with deepening isopycnals and high chlorphyll a concentrations. Abundances of both gadoid fish larvae and copepods peaked in vicinity of the front around mid-depth, and findings points to an inter-connection between the vertical and horizontal distributions of each species. However, the three-dimensional pattern of distribution differed significantly among species of larvae and species of copepods. The study underlines the complexity of bio-physical interrelationships in the frontal zone, and indicates that the zone encompasses specific ecological niches to which each species of fish larvae is adapted.

  6. Paenibacillus larvae-Directed Bacteriophage HB10c2 and Its Application in American Foulbrood-Affected Honey Bee Larvae

    PubMed Central

    Beims, Hannes; Wittmann, Johannes; Bunk, Boyke; Spröer, Cathrin; Rohde, Christine; Günther, Gabi; Rohde, Manfred; von der Ohe, Werner


    Paenibacillus larvae is the causative agent of American foulbrood (AFB), the most serious honey bee brood bacterial disease. We isolated and characterized P. larvae-directed bacteriophages and developed criteria for safe phage therapy. Whole-genome analysis of a highly lytic virus of the family Siphoviridae (HB10c2) provided a detailed safety profile and uncovered its lysogenic nature and a putative beta-lactamase-like protein. To rate its antagonistic activity against the pathogens targeted and to specify potentially harmful effects on the bee population and the environment, P. larvae genotypes ERIC I to IV, representatives of the bee gut microbiota, and a broad panel of members of the order Bacillales were analyzed for phage HB10c2-induced lysis. Breeding assays with infected bee larvae revealed that the in vitro phage activity observed was not predictive of the real-life scenario and therapeutic efficacy. On the basis of the disclosed P. larvae-bacteriophage coevolution, we discuss the future prospects of AFB phage therapy. PMID:26048941

  7. Predation on crown-of-thorns starfish larvae by damselfishes

    NASA Astrophysics Data System (ADS)

    Cowan, Zara-Louise; Dworjanyn, Symon A.; Caballes, Ciemon F.; Pratchett, Morgan S.


    Examining the functional response of predators can provide insight into the role of predation in structuring prey populations and ecological communities. This study explored feeding behaviour and functional responses of planktivorous damselfishes when offered captive reared larvae of crown-of-thorns starfish, Acanthaster sp., with the aim of determining whether these predators could ever play a role in moderating outbreaks of Acanthaster sp. We examined predatory behaviour of 11 species of planktivorous damselfish, testing: (1) the relationship between predator size and predation rate, both within and among fish species; (2) consumption rates on larvae of Acanthaster sp. versus larvae of a common, co-occurring coral reef asteroid Linckia laevigata; (3) maximal feeding rates upon both Acanthaster sp. and L. laevigata; and (4) functional responses of planktivorous fishes to increasing densities of Acanthaster sp. Consumption rates of crown-of-thorns larvae by damselfishes were independent of predator size; however, there was a significant negative relationship between predator size and consumption rate of L. laevigata, when pooling across all predatory species. Some damselfishes, including Acanthochromis polyacanthus and Amblyglyphidodon curacao, consumed larval Acanthaster sp. at a greater rate than for L. laevigata. Most predatory species (all except A. curacao and Pomacentrus amboinensis) exhibited a Type II functional response whereby the increasing feeding rate decelerated with increasing prey density. In addition to revealing that a wide range of planktivorous fishes can prey upon larvae of Acanthaster sp., these data suggest that planktivorous damselfishes may have the capacity to buffer against population fluctuations of Acanthaster sp. Importantly, predators with Type II functional responses often contribute to stability of prey populations, though planktivorous fishes may be swamped by an abnormally high influx of larvae, potentially contributing to the

  8. Nutrient effects of broodstocks on the larvae in Patinopecten yessoensis

    NASA Astrophysics Data System (ADS)

    Bai, Yucen; Zhang, Tao; Qiu, Tianlong; Gao, Yan; Zhang, Xiaofang


    Patinopecten yessoensis is a commercial valuable species. This study deals with the effect of nutrient effects of the broodstock (mainly ovaries) on the larvae. Concentrations of total carbohydrate, total protein and total lipid in the gonads of P. yessoensis from three Hatcheries (Hatchery 1, Hatchery 2, and Hatchery 3) were determined before and after spawning. The relationship between the nutrient concentration in ovaries before spawning (BC) and that of larvae (LC) was assessed as well as the change in nutrient levels in ovaries after spawning (DC). Results indicate that the BC of total carbohydrate (7.66%) and total lipid (14.48%) in ovaries were significantly higher than in testes (5.20%, 5.20% respectively), whereas the BC of total protein in the ovaries was lower (61.76%) than in the testes (81.67%). The different gonadal composition suggests the different nutrient demands between male and female broodstocks in breeding season. Patinopecten yessoensis gonads contained a higher proportion of lipids, in comparison to other bivalves, which might be a response to the low ambient water temperatures. Further analysis of fatty acids showed that the concentrations of n-3PUFA, EPA and DHA in larvae (LC) were positively correlated with BC and DC, indicating the significant nutrient influence of broodstocks on the larvae. As these fatty acids are important in metabolism, and have been demonstrated to be influential to the viability of the larvae, larval growth and the settlement, spat growth, and juvenile survival in many bivalves, they could possibly be used as indexes to evaluate, and predict condition of broodstocks and larvae.

  9. Development of a two photon microscope for tracking Drosophila larvae

    NASA Astrophysics Data System (ADS)

    Karagyozov, Doycho; Mihovilovic Skanata, Mirna; Gershow, Marc

    Current in vivo methods for measuring neural activity in Drosophila larva require immobilization of the animal. Although we can record neural signals while stimulating the sensory organs, we cannot read the behavioral output because we have prevented the animal from moving. Many research questions cannot be answered without observation of neural activity in behaving (freely-moving) animals. Our project aims to develop a tracking microscope that maintains the neurons of interest in the field of view and in focus during the rapid three dimensional motion of a free larva.

  10. Ultrastructural observations of the larva of Tubiluchus corallicola (Priapulida)

    NASA Astrophysics Data System (ADS)

    Higgins, R. P.; Storch, V.


    Larvae of Tubiluchus corallicola van der Land 1968 were investigated by scanning and transmission electron microscopy. The scalids are sensory organs, each has a bipolar receptor cell with a single apical cilium similar to the scalid in the adult. Muscle cells of the larva are more differentiated than previously reported for other Priapulida; the larval arrangement of circular and longitudinal musculature differs from that of the adult, and a diaphragm is reported for the first time in Priapulida. The diaphragm may function in hydrostatic control of eversion and inversion of the introvert and mouth cone. The functional morphology of these two structures is discussed and contrasted with the Kinorhyncha.

  11. In vitro and in vivo susceptibility of the honeybee bacterial pathogen Paenibacillus larvae subsp. larvae to the antibiotic tylosin.


    Alippi, Adriana M; Albo, Graciela N; Reynaldi, Francisco J; De Giusti, Marisa R


    The minimal inhibitory concentrations (MICs) of tylosin were determined to 67 strains of Paenibacillus larvae subsp. larvae, the causal agent of American Foulbrood (AFB) disease, from different geographical origins. MIC values obtained ranged from 0.0078 to 0.5 microg/ml. These very low values imply that no resistance to tylosin was found in any isolate of the Foulbrood pathogen. The measurement of diseased larvae with AFB-clinical symptoms in three different field studies demonstrated that tylosin treatment could be effective in vivo. No negative effects in colonies were noted at any dosage rates or forms of application. These studies demonstrate that tylosin, as tartrate, can be used to treat AFB in honeybee colonies.

  12. Monthly variations of Rhinoestrus spp. (Diptera: Oestridae) larvae infesting donkeys in Egypt: Morphological and molecular identification of third stage larvae

    PubMed Central

    Hilali, Mosaad A.; Mahdy, Olfat A.; Attia, Marwa M.


    This study was carried out to investigate the prevalence and monthly intensity of Rhinoestrus (R) spp. among donkeys slaughtered at Giza Zoo abattoir, Egypt. A total of 144 donkeys were examined at postmortem through two visits per month from January 2010 to December 2010. All donkeys were infested with one or more larval stages during all months of the examination period (100%). The 1st and 2nd stage larvae (L1 and L2) were mostly observed in the turbinate bones and seldom in the nasal passages, whereas the 3rd stage larvae (L3) were observed mostly in ethmoid and lamina cribrosa and rarely in nasal passages and pharynx. The highest monthly intensity of infestation with the total number of larval stages was recorded in January and August, while the lowest occurred in September. L1 was observed during all months with two peaks in January and June. L2 occurred from February to April, July, and August. L3 was present from March to May, August, and September. The ranked size of infestation with the total number of the 3 larval stages of Rhinoestrus spp. showed that a total of 107 donkeys had 1–10 larvae; 34 had 11–30 larvae; and 3 harbored 31–50 larvae. The morphology and molecular characterization of the third stage larvae of Rhinoestrus spp. were investigated. Morphologically, two morphotypes (1 and 2) of Rhinoestrus spp. (R. usbekistanicus like and the other R. purpureus like) were reported. Whereas molecular sequencing of mitochondrial cytochrome-oxidase subunit I showed 99% homology with those of R. usbekistanicus. In conclusion, Rhinoestrus spp. present in Egypt is mainly R. usbekistanicus, which includes two morphotypes, R. usbekistanicus like and R. purpureus like. PMID:26644940

  13. Intraguild predation and cannibalism among larvae of detritivorous caddisflies in subalpine wetlands

    USGS Publications Warehouse

    Wissinger, S.A.; Sparks, G.B.; Rouse, G.L.; Brown, W.S.; Steltzer, H.


    Comparative data from subalpine wetlands in Colorado indicate that larvae of the limnephilid caddisflies, Asynarchus nigriculus and Limnephilus externus, are reciprocally abundant among habitats - Limnephilus larvae dominate in permanent waters, whereas Asynarchus larvae dominate in temporary basins. The purpose of this paper is to report on field and laboratory experiments that link this pattern of abundance to biotic interactions among larvae. In the first field experiment, growth and survival were compared in single and mixed species treatments in littoral enclosures. Larvae, which eat mainly vascular plant detritus, grew at similar rates among treatments in both temporary and permanent habitats suggesting that exploitative competition is not important under natural food levels and caddisfly densities. However, the survival of Limnephilus larvae was reduced in the presence of Asynarchus larvae. Subsequent behavioral studies in laboratory arenas revealed that Asynarchus larvae are extremely aggressive predators on Limnephilus larvae. In a second field experiment we manipulated the relative sizes of larvae and found that Limnephilus larvae were preyed on only when Asynarchus larvae had the same size advantage observed in natural populations. Our data suggest that the dominance of Asynarchus larvae in temporary habitats is due to asymmetric intraguild predation (IGP) facilitated by a phenological head start in development. These data do not explain the dominance of Limnephilus larvae in permanent basins, which we show elsewhere to be an indirect effect of salamander predation. Behavioral observations also revealed that Asynarchus larvae are cannibalistic. In contrast to the IGP on Limnephilus larvae, Asynarchus cannibalism occurs among same-sized larvae and often involves the mobbing of one victim by several conspecifics. In a third field experiment, we found that Asynarchus cannibalism was not density-dependent and occurred even at low larval densities. We

  14. Phage Therapy is Effective in Protecting Honeybee Larvae from American Foulbrood Disease.


    Ghorbani-Nezami, Sara; LeBlanc, Lucy; Yost, Diane G; Amy, Penny S


    American foulbrood disease has a major impact on honeybees (Apis melifera) worldwide. It is caused by a Gram-positive, spore-forming bacterium, Paenibacillus larvae. The disease can only affect larval honeybees, and the bacterial endospores are the infective unit of the disease. Antibiotics are not sufficient to combat the disease due to increasing resistance among P. larvae strains. Because of the durability and virulence of P. larvae endospores, infections spread rapidly, and beekeepers are often forced to burn beehives and equipment. To date, very little information is available on the use of bacteriophage therapy in rescuing and preventing American foulbrood disease, therefore the goal of this study was to test the efficacy of phage therapy against P. larvae infection. Out of 32 previously isolated P. larvae phages, three designated F, WA, and XIII were tested on artificially reared honeybee larvae infected with P. larvae strain NRRL B-3650 spores. The presence of P. larvae DNA in dead larvae was confirmed by 16S rRNA gene-specific polymerase chain reaction amplification. Survival rates for phage-treated larvae were approximately the same as for larvae never infected with spores (84%), i.e., the phages had no deleterious effect on the larvae. Additionally, prophylactic treatment of larvae with phages before spore infection was more effective than administering phages after infection, although survival in both cases was higher than spores alone (45%). Further testing to determine the optimal combination and concentration of phages, and testing in actual hive conditions are needed.

  15. Phage Therapy is Effective in Protecting Honeybee Larvae from American Foulbrood Disease

    PubMed Central

    Ghorbani-Nezami, Sara; LeBlanc, Lucy; Yost, Diane G.; Amy, Penny S.


    American foulbrood disease has a major impact on honeybees (Apis melifera) worldwide. It is caused by a Gram-positive, spore-forming bacterium, Paenibacillus larvae. The disease can only affect larval honeybees, and the bacterial endospores are the infective unit of the disease. Antibiotics are not sufficient to combat the disease due to increasing resistance among P. larvae strains. Because of the durability and virulence of P. larvae endospores, infections spread rapidly, and beekeepers are often forced to burn beehives and equipment. To date, very little information is available on the use of bacteriophage therapy in rescuing and preventing American foulbrood disease, therefore the goal of this study was to test the efficacy of phage therapy against P. larvae infection. Out of 32 previously isolated P. larvae phages, three designated F, WA, and XIII were tested on artificially reared honeybee larvae infected with P. larvae strain NRRL B-3650 spores. The presence of P. larvae DNA in dead larvae was confirmed by 16S rRNA gene-specific polymerase chain reaction amplification. Survival rates for phage-treated larvae were approximately the same as for larvae never infected with spores (84%), i.e., the phages had no deleterious effect on the larvae. Additionally, prophylactic treatment of larvae with phages before spore infection was more effective than administering phages after infection, although survival in both cases was higher than spores alone (45%). Further testing to determine the optimal combination and concentration of phages, and testing in actual hive conditions are needed. PMID:26136497

  16. Low-Molecular-Weight Metabolites Secreted by Paenibacillus larvae as Potential Virulence Factors of American Foulbrood

    PubMed Central

    Schild, Hedwig-Annabell; Fuchs, Sebastian W.


    The spore-forming bacterium Paenibacillus larvae causes a severe and highly infective bee disease, American foulbrood (AFB). Despite the large economic losses induced by AFB, the virulence factors produced by P. larvae are as yet unknown. To identify such virulence factors, we experimentally infected young, susceptible larvae of the honeybee, Apis mellifera carnica, with different P. larvae isolates. Honeybee larvae were reared in vitro in 24-well plates in the laboratory after isolation from the brood comb. We identified genotype-specific differences in the etiopathology of AFB between the tested isolates of P. larvae, which were revealed by differences in the median lethal times. Furthermore, we confirmed that extracts of P. larvae cultures contain low-molecular-weight compounds, which are toxic to honeybee larvae. Our data indicate that P. larvae secretes metabolites into the medium with a potent honeybee toxic activity pointing to a novel pathogenic factor(s) of P. larvae. Genome mining of P. larvae subsp. larvae BRL-230010 led to the identification of several biosynthesis gene clusters putatively involved in natural product biosynthesis, highlighting the potential of P. larvae to produce such compounds. PMID:24509920

  17. Chiral PCB 91 and 149 Toxicity Testing in Embryo and Larvae (Danio rerio): Application of Targeted Metabolomics via UPLC-MS/MS

    PubMed Central

    Chai, Tingting; Cui, Feng; Yin, Zhiqiang; Yang, Yang; Qiu, Jing; Wang, Chengju


    In this study, we aimed to investigate the dysfunction of zebrafish embryos and larvae induced by rac-/(+)-/(−)- PCB91 and rac-/(−)-/(+)- PCB149. UPLC-MS/MS (Ultra-performance liquid chromatography coupled with mass spectrometry) was employed to perform targeted metabolomics analysis, including the quantification of 22 amino acids and the semi-quantitation of 22 other metabolites. Stereoselective changes in target metabolites were observed in embryos and larvae after exposure to chiral PCB91 and PCB149, respectively. In addition, statistical analyses, including PCA and PLS-DA, combined with targeted metabolomics were conducted to identify the characteristic metabolites and the affected pathways. Most of the unique metabolites in embryos and larvae after PCB91/149 exposure were amino acids, and the affected pathways for zebrafish in the developmental stage were metabolic pathways. The stereoselective effects of PCB91/149 on the metabolic pathways of zebrafish embryos and larvae suggest that chiral PCB91/149 exposure has stereoselective toxicity on the developmental stages of zebrafish. PMID:27629264

  18. Chiral PCB 91 and 149 Toxicity Testing in Embryo and Larvae (Danio rerio): Application of Targeted Metabolomics via UPLC-MS/MS

    NASA Astrophysics Data System (ADS)

    Chai, Tingting; Cui, Feng; Yin, Zhiqiang; Yang, Yang; Qiu, Jing; Wang, Chengju


    In this study, we aimed to investigate the dysfunction of zebrafish embryos and larvae induced by rac-/(+)-/(‑)- PCB91 and rac-/(‑)-/(+)- PCB149. UPLC-MS/MS (Ultra-performance liquid chromatography coupled with mass spectrometry) was employed to perform targeted metabolomics analysis, including the quantification of 22 amino acids and the semi-quantitation of 22 other metabolites. Stereoselective changes in target metabolites were observed in embryos and larvae after exposure to chiral PCB91 and PCB149, respectively. In addition, statistical analyses, including PCA and PLS-DA, combined with targeted metabolomics were conducted to identify the characteristic metabolites and the affected pathways. Most of the unique metabolites in embryos and larvae after PCB91/149 exposure were amino acids, and the affected pathways for zebrafish in the developmental stage were metabolic pathways. The stereoselective effects of PCB91/149 on the metabolic pathways of zebrafish embryos and larvae suggest that chiral PCB91/149 exposure has stereoselective toxicity on the developmental stages of zebrafish.

  19. Genome Sequences of Six Paenibacillus larvae Siphoviridae Phages.


    Carson, Susan; Bruff, Emily; DeFoor, William; Dums, Jacob; Groth, Adam; Hatfield, Taylor; Iyer, Aruna; Joshi, Kalyani; McAdams, Sarah; Miles, Devon; Miller, Delanie; Oufkir, Abdoullah; Raynor, Brinkley; Riley, Sara; Roland, Shelby; Rozier, Horace; Talley, Sarah; Miller, Eric S


    Six sequenced and annotated genomes of Paenibacillus larvae phages isolated from the combs of American foulbrood-diseased beehives are 37 to 45 kbp and have approximately 42% G+C content and 60 to 74 protein-coding genes. Phage Lily is most divergent from Diva, Rani, Redbud, Shelly, and Sitara.

  20. Genome Sequences of Six Paenibacillus larvae Siphoviridae Phages

    PubMed Central

    Carson, Susan; Bruff, Emily; DeFoor, William; Dums, Jacob; Groth, Adam; Hatfield, Taylor; Iyer, Aruna; Joshi, Kalyani; McAdams, Sarah; Miles, Devon; Miller, Delanie; Oufkir, Abdoullah; Raynor, Brinkley; Riley, Sara; Roland, Shelby; Rozier, Horace; Talley, Sarah


    Six sequenced and annotated genomes of Paenibacillus larvae phages isolated from the combs of American foulbrood-diseased beehives are 37 to 45 kbp and have approximately 42% G+C content and 60 to 74 protein-coding genes. Phage Lily is most divergent from Diva, Rani, Redbud, Shelly, and Sitara. PMID:26089405

  1. Aluminium chloride-induced toxicity in zebrafish larvae.


    Monaco, A; Grimaldi, M C; Ferrandino, I


    Embryos at shield stage and larvae at protruding mouth stage were exposed to different concentrations of aluminium chloride (AlCl3 ) for 72 h with the purpose to analyse their phenotype and lethality. After 24, 48 and 72 h of treatment, higher toxicity of the metal was observed on larvae with minimal lethal concentration of 0.25, 0.20 and 0.08 mm, respectively, while for embryos the corresponding values were 40, 25 and 16 mm. We observed pericardial oedema and alteration of heart rate in 50% of larvae after 48 h of exposure to 100 μm. In larvae exposed to the same concentration, there was also a neurological injury at the level of glial cells, with the number of glial fibrillary acidic protein-positive cells being significantly reduced. This study confirms the toxic nature of this metal and shows that aluminium could also interestingly represent a cardiotoxin in addition to its neurotoxic ability.

  2. Mini review: Hookworm-related cutaneous larva migrans.


    Feldmeier, H; Schuster, A


    Hookworm-related cutaneous larva migrans (HrCLM) is a parasitic skin disease caused by the migration of animal hookworm larvae in the epidermis. Since these larvae cannot penetrate the basal membrane of human skin, they remain confined to the epidermis and are unable to develop and complete their lifecycle. By consequence, HrCLM is a self-limiting disease. However, if not treated promptly, the skin pathology may persist for months. HrCLM is endemic in many resource-poor communities in the developing world. In high-income countries, HrCLM occurs sporadically or in the form of small epidemics. Travelers account for the great majority of cases seen by health-care professionals in high-income countries. Transmission occurs when naked skin comes into contact with contaminated soil. Exposure may also occur indoors. Exceptionally, larvae may be transmitted through fomites. The first clinical sign is a small reddish papule. Thereafter, the characteristic serpiginous, slightly elevated, erythematous track becomes visible. Itching becomes more and more intense. Excoriations induced by scratching facilitate bacterial superinfection of the lesion. The diagnosis is essentially clinical. It is supported by a recent travel history and the possibility of exposure. The drug of choice is ivermectin in a single dose (200 μg per kg bodyweight). Repeated treatments with albendazole (400 mg daily) are a good alternative in countries where ivermectin is not available.

  3. Predation of Chaoborus punctipennis on larvae of Dorosoma

    SciTech Connect

    Dailey, N.S.; Mattice, J.S.


    Laboratory and field studies were conducted to evaluate the significance of predation of Chaoborus punctipennis on Dorosoma larvae. Only third (III) and fourth (IV) instars of Chaoborus consumed shad larvae in the laboratory studies. Predation was directly related to shad density and chaoborus size, but was not related to age (or size) of yolk-sac Dorosoma or to temperature in the range of 20 to 25/sup 0/C prevalent during shad spawning. Analysis of evening plankton samples collected in Blue Springs Cove, Watts Bar Reservoir, Tennessee, during the shad spawning season suggested that interactions between the two species were reduced by spatial, temporal, and seasonal separation. Shad larvae were most abundant near the water surface, particularly near the shoreline and near dawn; III and IV instar Chaoborus were most abundant at 3 or 5 meter depths below the surface and highest concentrations were in deeper water areas between 2100 and 0300. In Blue Springs Cove in 1980, densities of shad and Chaoborus were too low to expect predation to occur based on the extrapolation of predation rates derived from the laboratory studies. This conclusion received further support from the fact that no signs of shad larvae were found in the crops of narcotized Chaoborus collected in Blue Springs Cove.

  4. Ingestion of Nanoplastics and Microplastics by Pacific Oyster Larvae.


    Cole, Matthew; Galloway, Tamara S


    Plastic debris is a prolific contaminant effecting freshwater and marine ecosystems across the globe. Of growing environmental concern are "microplastics"and "nanoplastics" encompassing tiny particles of plastic derived from manufacturing and macroplastic fragmentation. Pelagic zooplankton are susceptible to consuming microplastics, however the threat posed to larvae of commercially important bivalves is currently unknown. We exposed Pacific oyster (Crassostrea gigas) larvae (3-24 d.p.f.) to polystyrene particles spanning 70 nm-20 μm in size, including plastics with differing surface properties, and tested the impact of microplastics on larval feeding and growth. The frequency and magnitude of plastic ingestion over 24 h varied by larval age and size of polystyrene particle (ANOVA, P < 0.01), and surface properties of the plastic, with aminated particles ingested and retained more frequently (ANOVA, P < 0.01). A strong, significant correlation between propensity for plastic consumption and plastic load per organism was identified (Spearmans, r = 0.95, P < 0.01). Exposure to 1 and 10 μm PS for up to 8 days had no significant effect on C. gigas feeding or growth at <100 microplastics mL(-1). In conclusion, whil micro- and nanoplastics were readily ingested by oyster larvae, exposure to plastic concentrations exceeding those observed in the marine environment resulted in no measurable effects on the development or feeding capacity of the larvae over the duration of the study.

  5. Two alternating motor programs drive navigation in Drosophila larva.


    Lahiri, Subhaneil; Shen, Konlin; Klein, Mason; Tang, Anji; Kane, Elizabeth; Gershow, Marc; Garrity, Paul; Samuel, Aravinthan D T


    When placed on a temperature gradient, a Drosophila larva navigates away from excessive cold or heat by regulating the size, frequency, and direction of reorientation maneuvers between successive periods of forward movement. Forward movement is driven by peristalsis waves that travel from tail to head. During each reorientation maneuver, the larva pauses and sweeps its head from side to side until it picks a new direction for forward movement. Here, we characterized the motor programs that underlie the initiation, execution, and completion of reorientation maneuvers by measuring body segment dynamics of freely moving larvae with fluorescent muscle fibers as they were exposed to temporal changes in temperature. We find that reorientation maneuvers are characterized by highly stereotyped spatiotemporal patterns of segment dynamics. Reorientation maneuvers are initiated with head sweeping movement driven by asymmetric contraction of a portion of anterior body segments. The larva attains a new direction for forward movement after head sweeping movement by using peristalsis waves that gradually push posterior body segments out of alignment with the tail (i.e., the previous direction of forward movement) into alignment with the head. Thus, reorientation maneuvers during thermotaxis are carried out by two alternating motor programs: (1) peristalsis for driving forward movement and (2) asymmetric contraction of anterior body segments for driving head sweeping movement.

  6. Smelling home can prevent dispersal of reef fish larvae

    PubMed Central

    Gerlach, Gabriele; Atema, Jelle; Kingsford, Michael J.; Black, Kerry P.; Miller-Sims, Vanessa


    Many marine fish and invertebrates show a dual life history where settled adults produce dispersing larvae. The planktonic nature of the early larval stages suggests a passive dispersal model where ocean currents would quickly cause panmixis over large spatial scales and prevent isolation of populations, a prerequisite for speciation. However, high biodiversity and species abundance in coral reefs contradict this panmixis hypothesis. Although ocean currents are a major force in larval dispersal, recent studies show far greater retention than predicted by advection models. We investigated the role of animal behavior in retention and homing of coral reef fish larvae resulting in two important discoveries: (i) Settling larvae are capable of olfactory discrimination and prefer the odor of their home reef, thereby demonstrating to us that nearby reefs smell different. (ii) Whereas one species showed panmixis as predicted from our advection model, another species showed significant genetic population substructure suggestive of strong homing. Thus, the smell of reefs could allow larvae to choose currents that return them to reefs in general and natal reefs in particular. As a consequence, reef populations can develop genetic differences that might lead to reproductive isolation. PMID:17213323

  7. Protein digestion in red aak borer larvae, Enaphalodes rufulus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In the Ozark Mountains of Arkansas, Oklahoma, and Missouri, a recent outbreak of red oak borer, Enaphalodes rufulus (Haldeman), contributed to the death of tens of thousands of red oaks. To better understand nutrient digestion in E. rufulus larvae, biochemical analyses were used to characterize dige...

  8. Mixing and pumping functions of the intestine of zebrafish larvae.


    Yang, Jinyou; Shimogonya, Yuji; Ishikawa, Takuji


    Due to its transparency, the intestine of zebrafish larvae has been widely used in studies of gastrointestinal diseases and the microbial flora of the gut. However, transport phenomena in the intestine of zebrafish larvae have not been fully clarified. In this study, therefore, transport caused by peristaltic motion in the intestine of zebrafish larvae was investigated by numerical simulation. An anatomically realistic three-dimensional geometric model of the intestine at various times after feeding was constructed based on the experimental data of Field et al. (2009). The flow of digested chyme was analyzed using the governing equations of fluid mechanics, together with peristaltic motion and long-term contraction of the intestinal wall. The results showed that retrograde peristaltic motion was the main contributor to the mixing function. The dispersion caused by peristalsis over 30min was in the order of 10(-12)m(2)/s, which is greater than the Brownian diffusion of a sphere of 0.4µm diameter. In contrast, anterograde peristaltic motion contributed mainly to the pumping function. The pressure decrease due to peristalsis was in the order of millipascals, which may reduce the activation and maintenance heat of intestinal muscle. These findings enhance our understanding of the mixing and pumping functions of the intestine of zebrafish larvae.

  9. A digestive prolyl carboxypeptidase in Tenebrio molitor larvae

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Prolyl carboxypeptidase (PRCP) was purified from the anterior midgut of larvae of a stored product pest, Tenebrio molitor. The cDNA of PRCP was cloned, and the predicted protein was identical to the proteomic sequences of the purified enzyme. The substrate specificity of the enzyme was studied, and ...

  10. New insights for Drosophila GAGA factor in larvae

    PubMed Central

    Blanch, Marta; Piñeyro, David; Bernués, Jordi


    GAGA factor plays important roles during Drosophila embryogenesis and its maternal contribution is essential for early development. Here, the role of GAGA factor was studied in 3rd instar larvae using depletion and overexpression conditions in wing disc and transcriptome analysis. We found that genes changing expression were different to those previously described using GAGA mutants in embryos. No apparent phenotypes on GAGA depletion could usually be observed at larval stages in imaginal discs but a strong effect on salivary gland polytene chromosomes was observed. In the adult, GAGA depletion produced many defects like abnormal cell proliferation in the wing, impaired dorsal closure and resulted in homeotic transformation of abdominal segment A5. Unexpectedly, no effects on Ultrabithorax expression were observed. Short overexpression of GAGA factor in 3rd instar larvae also resulted in activation of a set of genes not previously described to be under GAGA regulation, and in lethality at pupa. Our results suggest a little contribution of GAGA factor on gene transcription in wing discs and a change of the genes regulated in comparison with embryo. GAGA factor activity thus correlates with the global changes in gene expression that take place at the embryo-to-larva and, later, at the larva-to-pupa transitions. PMID:26064623

  11. Skeletogenesis in sea urchin larvae under modified gravity conditions.


    Marthy, H J; Gasset, G; Tixador, R; Eche, B; Schatt, P; Dessommes, A; Marthy, U; Bacchieri, R


    From many points of view, skeletogenesis in sea urchins has been well described. Based on this scientific background and considering practical aspects of sea urchin development (i.e. availability of material, size of larvae, etc.), we wanted to know whether orderly skeletogenesis requires the presence of gravity. The objective has been approached by three experiments successfully performed under genuine microgravity conditions (in the STS-65 IML-2 mission of 1994; in the Photon-10 IBIS mission of 1995 and in the STS-76 S/MM-03 mission of 1996). Larvae of the sea urchin Sphaerechinus granularis were allowed to develop in microgravity conditions for several days from blastula stage onwards (onset of skeletogenesis). At the end of the missions, the recovered skeletal structures were studied with respect to their mineral composition, architecture and size. Live larvae were also recovered for post-flight culture. The results obtained clearly show that the process of mineralisation is independent of gravity: that is, the skeletogenic cells differentiate correctly in microgravity. However, abnormal skeleton architectures were encountered, particularly in the IML-2 mission, indicating that the process of positioning of the skeletogenic cells may be affected, directly or indirectly, by environmental factors, including gravity. Larvae exposed to microgravity from blastula to prism/early pluteus stage for about 2 weeks (IBIS mission), developed on the ground over the next 2 months into normal metamorphosing individuals.

  12. Ingestion of microplastic has limited impact on a marine larva.


    Kaposi, Katrina L; Mos, Benjamin; Kelaher, Brendan P; Dworjanyn, Symon A


    There is increasing concern about the impacts of microplastics (<1 mm) on marine biota. Microplastics may be mistaken for food items and ingested by a wide variety of organisms. While the effects of ingesting microplastic have been explored for some adult organisms, there is poor understanding of the effects of microplastic ingestion on marine larvae. Here, we investigated the ingestion of polyethylene microspheres by larvae of the sea urchin, Tripneustes gratilla. Ingestion rates scaled with the concentration of microspheres. Ingestion rates were, however, reduced by biological fouling of microplastic and in the presence of phytoplankton food. T. gratilla larvae were able to egest microspheres from their stomach within hours of ingestion. A microsphere concentration far exceeding those recorded in the marine environment had a small nondose dependent effect on larval growth, but there was no significant effect on survival. In contrast, environmentally realistic concentrations appeared to have little effect. Overall, these results suggest that current levels of microplastic pollution in the oceans only pose a limited threat to T. gratilla and other marine invertebrate larvae, but further research is required on a broad range of species, trophic levels, and polymer types.

  13. [Effect of wound to growth of larva of host to Ophiocordyceps sinensis during artificial breeding].


    Liu, Fei; Zhang, De-li; Zeng, Wei; Li, Li; Luo, Qing-ming; Tu, Yong-qin; Chen, Shi-jiang; Yin, Ding-hua


    To clear the effect of the wound to the growth of the larva of the host to the Ophiocordyceps sinensis, the wounds of same severity at the same position were made artificially to the larva and which were artificial fed at the same environment and condition. The results indicated that, over the winter, the survival rate of the wounded of the infection larva was lower than that of the healthy larva, but the weight had no significant difference between the wounded and the healthy larva. The survival rate of the wounded of the no infection larva was lower than that of the healthy larva, but except with black skin, the wounded larva with offwhite and dusty red had no influence on the variety of the weight. In summery, wound had no advantage to the survival rate, but had no influence to the weight. The result had provided theoretical basis to the reforming of the system of the artificial culture O. sinensis.

  14. Effects of gamma irradiation as a quarantine treatment on development of codling moth larvae

    SciTech Connect

    Burditt, A.K. Jr.; Moffitt, H.R.; Hungate, F.P.


    Codling moth, Cydia pomonella (L.), larvae were exposed to gamma radiation at doses upto 160 Gy. Following irradiation the larvae were permited further development, pupation and adult emergence. The number of adults emerging, mature larvae and pupae present were determined. Data from these studies will be used to predict doses of gamma irradiation required as a quarantine treatment to prevent emergence of codling moth adults from fruit infested by larvae. 5 refs., 1 tab.

  15. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae

    PubMed Central

    Waldbusser, George G.; Hales, Burke; Langdon, Chris J.; Haley, Brian A.; Schrader, Paul; Brunner, Elizabeth L.; Gray, Matthew W.; Miller, Cale A.; Gimenez, Iria; Hutchinson, Greg


    Ocean acidification (OA) is altering the chemistry of the world’s oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4) with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material affected only by

  16. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae.


    Waldbusser, George G; Hales, Burke; Langdon, Chris J; Haley, Brian A; Schrader, Paul; Brunner, Elizabeth L; Gray, Matthew W; Miller, Cale A; Gimenez, Iria; Hutchinson, Greg


    Ocean acidification (OA) is altering the chemistry of the world's oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4) with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material affected only by

  17. Predaceous diving beetle, Dytiscus sharpi sharpi (Coleoptera: Dytiscidae) larvae avoid cannibalism by recognizing prey.


    Inoda, Toshio


    Larvae of diving beetles such as the various Dytiscus species (Coleoptera: Dytiscidae) are carnivorous and usually prey on other aquatic animals. Cannibalism among larvae of Dytiscus sharpi sharpi (Wehncke) was observed to begin when they were starved for more than two days under artificial breeding conditions. However, the 2-day starved larvae did not show cannibalism in the presence of intact, motionless, frozen tadpoles, or frozen shrimps. The beetle larvae attacked and captured intact tadpoles faster (15 sec) than other motionless and frozen tadpoles (120 sec), indicating that prey movement was an important factor in stimulating feeding behavior in larvae. Prey density does not have an effect on larval cannibalism. In cases in which preys are present at lower densities than that of larvae, a group of beetle larvae frequently fed on single prey. This feeding behavior, therefore, provides direct evidence of self-other recognition at the species level. Using two traps in one aquarium that allows the larvae to detect only prey smell, one containing tadpoles and another empty, the beetle larvae were attracted to the trap with tadpoles at high frequency, but not to the empty trap. In another experiment, the beetle larvae were not attracted to the trap containing a beetle larva. These results suggest that the larvae of D. sharpi sharpi are capable of recognizing prey scent, which enables the promotion of foraging behavior and the prevention of cannibalism.

  18. Nutritional Limitation on Growth and Development of Horn Fly (Diptera:Muscidae) Larvae

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Aging of bovine dung for 3-5 yr under refrigeration depleted nutrients required for growth and development of horn fly larvae. Growth of horn fly larvae in mixtures of nutrient-depleted dung and fresh dung resulted in production of larvae and pupae stunted in proportion to the relative amount of ag...

  19. First detection of Paenibacillus larvae the causative agent of American Foulbrood in a Ugandan honeybee colony.


    Chemurot, Moses; Brunain, Marleen; Akol, Anne M; Descamps, Tine; de Graaf, Dirk C


    Paenibacillus larvae is a highly contagious and often lethal widely distributed pathogen of honeybees, Apis mellifera but has not been reported in eastern Africa to date. We investigated the presence of P. larvae in the eastern and western highland agro-ecological zones of Uganda by collecting brood and honey samples from 67 honeybee colonies in two sampling occasions and cultivated them for P. larvae. Also, 8 honeys imported and locally retailed in Uganda were sampled and cultivated for P. larvae. Our aim was to establish the presence and distribution of P. larvae in honeybee populations in the two highland agro-ecological zones of Uganda and to determine if honeys that were locally retailed contained this lethal pathogen. One honeybee colony without clinical symptoms for P. larvae in an apiary located in a protected area of the western highlands of Uganda was found positive for P. larvae. The strain of this P. larvae was genotyped and found to be ERIC I. In order to compare its virulence with P. larvae reference strains, in vitro infection experiments were conducted with carniolan honeybee larvae from the research laboratory at Ghent University, Belgium. The results show that the virulence of the P. larvae strain found in Uganda was at least equally high. The epidemiological implication of the presence of P. larvae in a protected area is discussed.

  20. The migration of larvae of Toxascaris leonina (Linstow, 1909) in experimentally infected white mice.


    Prokopic, J; Figallová, V


    The migration of larvae of Toxascaris leonina was studied in 168 white mice. The larvae were found in lungs of 96% of infected mice on days 4-135, in genital organs (84%), intestinal mucosa (81%) and skeletal muscles (100%) on day 10 post infection. The maximum number of larvae were detected in intercostal muscles on day 105 post infection.

  1. A GPI-anchored alkaline phosphatase is a functional midgut receptor of Cry11Aa toxin in Aedes aegypti larvae

    PubMed Central

    Fernandez, Luisa E.; Aimanova, Karlygash G.; Gill, Sarjeet S.; Bravo, Alejandra; Soberón, Mario


    A 65 kDa GPI (glycosylphosphatidyl-inositol)-anchored ALP (alkaline phosphatase) was characterized as a functional receptor of the Bacillus thuringiensis subsp. israelensis Cry11Aa toxin in Aedes aegypti midgut cells. Two (a 100 kDa and a 65 kDa) GPI-anchored proteins that bound Cry11Aa toxin were preferentially extracted after treatment of BBMV (brush boder membrane vesicles) from Ae. aegypti midgut epithelia with phospholipase C. The 65 kDa protein was further purified by toxin affinity chromatography. The 65 kDa protein showed ALP activity. The peptide-displaying phages (P1.BBMV and P8.BBMV) that bound to the 65 kDa GPI–ALP (GPI-anchored ALP) and competed with the Cry11Aa toxin to bind to BBMV were isolated by selecting BBMV-binding peptide-phages by biopanning. GPI–ALP was shown to be preferentially distributed in Ae. aegypti in the posterior part of the midgut and in the caeca, by using P1.BBMV binding to fixed midgut tissue sections to determine the location of GPI–ALP. Cry11Aa binds to the same regions of the midgut and competed with P1.BBMV and P8.BBMV to bind to BBMV. The importance of this interaction was demonstrated by the in vivo attenuation of Cry11Aa toxicity in the presence of these phages. Our results shows that GPI–ALP is an important receptor molecule involved in Cry11Aa interaction with midgut cells and toxicity to Ae. aegypti larvae. PMID:16255715

  2. Description of the larva of Gynacantha millardi Selys, 1891 (Odonata: Aeshnidae) from Chhattisgarh, India.


    Dawn, Prosenjit; Chandra, Kailash


    The larva of Gynacantha millardi Selys is described here from female larvae and male and female exuviae collected from Chhattisgarh, India. Unlike other Gynacantha larvae known so far, G. millardi has 7 palpal setae almost equal in length; in other species, the palpal setae are of different lengths. The larvae lack a tooth on each side of the median cleft and have a distinct blunt tooth on the inner margin corner of each labial palp. The larvae were found in a semi-stagnant forest pool with enormous growth of aquatic vegetation.


    PubMed Central

    MARIGO, Juliana; TANIWAKI, Sueli Akemi; PINTO, Pedro Luiz Silva; SOARES, Rodrigo Martins; CATÃO-DIAS, José Luiz


    Anisakiasis and Pseudoterranovosis are human diseases caused by the ingestion of live Anisakidae larvae in raw, undercooked or lightly marinated fish. Larvae were collected from one salted cod sold for human consumption in a Sao Paulo market in 2013. One section of one brownish larva was used for molecular analyses. The partial COX2 gene sequence from the larva had a nucleotide identity of 99.8 % with Pseudoterranova azarasi, which belongs to the Pseudoterranova decipiens species complex. The risk of allergy when consuming dead larvae in salted fish is not well known and should be considered. PMID:27049712

  4. Integration of Insecticidal Protein Vip3Aa1 into Beauveria bassiana Enhances Fungal Virulence to Spodoptera litura Larvae by Cuticle and Per Os Infection▿

    PubMed Central

    Qin, Yi; Ying, Sheng-Hua; Chen, Ying; Shen, Zhi-Cheng; Feng, Ming-Guang


    The entomopathogenic fungus Beauveria bassiana acts slowly on insect pests through cuticle infection. Vegetative insecticidal proteins (Vip3A) of Bacillus thuringiensis kill lepidopteran pests rapidly, via per os infection, but their use for pest control is restricted to integration into transgenic plants. A transgenic B. bassiana strain (BbV28) expressing Vip3Aa1 (a Vip3A toxin) was thus created to infect the larvae of the oriental leafworm moth Spodoptera litura through conidial ingestion and cuticle adhesion. Vip3Aa1 (∼88 kDa) was highly expressed in the conidial cytoplasm of BbV28 and was detected as a digested form (∼62 kDa) in the larval midgut 18 and 36 h after conidial ingestion. The median lethal concentration (LC50) of BbV28 against the second-instar larvae feeding on cabbage leaves sprayed with conidial suspensions was 26.2-fold lower than that of the wild-type strain on day 3 and 1.1-fold lower on day 7. The same sprays applied to both larvae and leaves for their feeding reduced the LC50 of the transformant 17.2- and 1.3-fold on days 3 and 7, respectively. Median lethal times (LT50s) of BbV28 were shortened by 23 to 35%, declining with conidial concentrations. The larvae infected by ingestion of BbV28 conidia showed typical symptoms of Vip3A action, i.e., shrinkage and palsy. However, neither LC50 nor LT50 trends differed between BbV28 and its parental strain if the infection occurred through the cuticle only. Our findings indicate that fungal conidia can be used as vectors for spreading the highly insecticidal Vip3A protein for control of foliage feeders such as S. litura. PMID:20495052

  5. Integration of insecticidal protein Vip3Aa1 into Beauveria bassiana enhances fungal virulence to Spodoptera litura larvae by cuticle and per Os infection.


    Qin, Yi; Ying, Sheng-Hua; Chen, Ying; Shen, Zhi-Cheng; Feng, Ming-Guang


    The entomopathogenic fungus Beauveria bassiana acts slowly on insect pests through cuticle infection. Vegetative insecticidal proteins (Vip3A) of Bacillus thuringiensis kill lepidopteran pests rapidly, via per os infection, but their use for pest control is restricted to integration into transgenic plants. A transgenic B. bassiana strain (BbV28) expressing Vip3Aa1 (a Vip3A toxin) was thus created to infect the larvae of the oriental leafworm moth Spodoptera litura through conidial ingestion and cuticle adhesion. Vip3Aa1 ( approximately 88 kDa) was highly expressed in the conidial cytoplasm of BbV28 and was detected as a digested form ( approximately 62 kDa) in the larval midgut 18 and 36 h after conidial ingestion. The median lethal concentration (LC(50)) of BbV28 against the second-instar larvae feeding on cabbage leaves sprayed with conidial suspensions was 26.2-fold lower than that of the wild-type strain on day 3 and 1.1-fold lower on day 7. The same sprays applied to both larvae and leaves for their feeding reduced the LC(50) of the transformant 17.2- and 1.3-fold on days 3 and 7, respectively. Median lethal times (LT(50)s) of BbV28 were shortened by 23 to 35%, declining with conidial concentrations. The larvae infected by ingestion of BbV28 conidia showed typical symptoms of Vip3A action, i.e., shrinkage and palsy. However, neither LC(50) nor LT(50) trends differed between BbV28 and its parental strain if the infection occurred through the cuticle only. Our findings indicate that fungal conidia can be used as vectors for spreading the highly insecticidal Vip3A protein for control of foliage feeders such as S. litura.

  6. Starving honey bee (Apis mellifera) larvae signal pheromonally to worker bees

    PubMed Central

    He, Xu Jiang; Zhang, Xue Chuan; Jiang, Wu Jun; Barron, Andrew B.; Zhang, Jian Hui; Zeng, Zhi Jiang


    Cooperative brood care is diagnostic of animal societies. This is particularly true for the advanced social insects, and the honey bee is the best understood of the insect societies. A brood pheromone signaling the presence of larvae in a bee colony has been characterised and well studied, but here we explored whether honey bee larvae actively signal their food needs pheromonally to workers. We show that starving honey bee larvae signal to workers via increased production of the volatile pheromone E-β-ocimene. Analysis of volatile pheromones produced by food-deprived and fed larvae with gas chromatography-mass spectrometry showed that starving larvae produced more E-β-ocimene. Behavioural analyses showed that adding E-β-ocimene to empty cells increased the number of worker visits to those cells, and similarly adding E-β-ocimene to larvae increased worker visitation rate to the larvae. RNA-seq and qRT-PCR analysis identified 3 genes in the E-β-ocimene biosynthetic pathway that were upregulated in larvae following 30 minutes of starvation, and these genes also upregulated in 2-day old larvae compared to 4-day old larvae (2-day old larvae produce the most E-β-ocimene). This identifies a pheromonal mechanism by which brood can beg for food from workers to influence the allocation of resources within the colony. PMID:26924295

  7. The dynamical impact of mesoscale eddies on migration of Japanese eel larvae.


    Chang, Yu-Lin; Miyazawa, Yasumasa; Béguer-Pon, Mélanie


    In this study, we explore the dynamical role of mesoscale eddies on fish larvae migration using the example of Subtropical Counter Current eddies and the migration of Japanese eel larvae in the western North Pacific Ocean. An idealized experiment is conducted to isolate the effects of eddies, and use a three-dimensional particle-tracking method to simulate virtual eel larvae (v-larvae) migration, including both horizontal and vertical swimming behaviors. The impact of eddies strongly depends on the swimming speed of v-larvae relative to the eddy speed. Eddies accelerate the movement of v-larvae that swim slower than the propagation speed of the eddy, whereas faster-swimming v-larvae are dragged by eddies. A modified stream function that incorporates biological swimming ability explains the non-uniform trapping of v-larvae in mesoscale eddies. A high swimming speed and/or a small eddy rotation speed results in a weak trapping capacity. Simulations of v-larvae migration in realistic cases of eddy fields indicate that the abundance of eddies significantly affects the duration of larval migration, with the effects being largely dependent on the larvae swimming speed. We noted a negative relationship between the observed annual eel recruitment index in Taiwan and the eddy index subtropical countercurrent (STCC) region, which suggests a potentially important role of mesoscale eddies in eel larvae migration.

  8. The dynamical impact of mesoscale eddies on migration of Japanese eel larvae

    PubMed Central

    Chang, Yu-Lin; Miyazawa, Yasumasa; Béguer-Pon, Mélanie


    In this study, we explore the dynamical role of mesoscale eddies on fish larvae migration using the example of Subtropical Counter Current eddies and the migration of Japanese eel larvae in the western North Pacific Ocean. An idealized experiment is conducted to isolate the effects of eddies, and use a three-dimensional particle-tracking method to simulate virtual eel larvae (v-larvae) migration, including both horizontal and vertical swimming behaviors. The impact of eddies strongly depends on the swimming speed of v-larvae relative to the eddy speed. Eddies accelerate the movement of v-larvae that swim slower than the propagation speed of the eddy, whereas faster-swimming v-larvae are dragged by eddies. A modified stream function that incorporates biological swimming ability explains the non-uniform trapping of v-larvae in mesoscale eddies. A high swimming speed and/or a small eddy rotation speed results in a weak trapping capacity. Simulations of v-larvae migration in realistic cases of eddy fields indicate that the abundance of eddies significantly affects the duration of larval migration, with the effects being largely dependent on the larvae swimming speed. We noted a negative relationship between the observed annual eel recruitment index in Taiwan and the eddy index subtropical countercurrent (STCC) region, which suggests a potentially important role of mesoscale eddies in eel larvae migration. PMID:28253293

  9. Hookworm-related cutaneous larva migrans acquired in the UK.


    Baple, Katy; Clayton, James


    Hookworm-related cutaneous larva migrans (HrCLM) is a skin disease caused by infection with the larvae of animal hookworms. With conditions for infection more favourable in tropical climates, HrCLM in the UK is classically diagnosed in the returning traveller. We present two cases of clinically diagnosed UK-acquired HrCLM from a district general hospital in the south of England. A 68-year-old woman presented with a pruritic serpiginous tract on the right hand. She was a keen gardener and had been handling compost. A 50-year-old man, a long distance runner, presented with a similar lesion on the dorsum of his foot. Both patients were treated with a single dose of albendazole. These cases may represent an emerging infection in the UK. In the absence of a suggestive travel history, early recognition followed by efficient access to therapy is vital for treating HrCLM transmitted in the UK.

  10. Bed bugs, leeches and hookworm larvae in the skin.


    Heukelbach, Jorg; Hengge, Ulrich R


    Bed bugs, leeches, and hookworm-related cutaneous larva migrans are skin infestations that are usually considered of minor importance because they produce discomfort rather than cause or transmit disease. Bed bugs have been increasing tremendously in high-income countries in recent years, causing distress to affected individuals and economic loss. Infestation by land leeches causes mainly unpleasant skin reactions, whereas infestation by aquatic leeches may be more dangerous, leading to anemia and in severe cases, to death. Cutaneous larva migrans produces an intense pruritus that can be exasperating for the patient and cause sleep disturbance. An overview is given of these three infestations with a discussion of the causative agents, transmission, clinical manifestations, diagnosis, and treatment.

  11. A feeding model of oyster larvae (Crassostrea angulata).


    Qiu, Tianlong; Liu, Ying; Zheng, Jimeng; Zhang, Tao; Qi, Jianfei


    There is a need to develop more efficient rearing systems for the aquaculture of economically important bivalves, such as oysters. Here, we constructed a model that describes the feeding behavior of larval Crassostrea angulata oysters and tested it in an experimental setting. Larval ingestion rate is closely correlated with larval length. Based on our model, we showed that larval swimming speed, velum diameter and the filtration coefficient, which also determine the ingestion rate, are also correlated with larval length. Our model integrates morphological, locomotory and feeding behavior parameters to establish a relation between them and so provides a mathematical way to describe variation in the feeding behavior of bivalve larvae. The results of this study could facilitate the precise management of the aquaculture of bivalve larvae, in particular the optimum prey density and feeding rate of these important organisms.

  12. Digestion in sea urchin larvae impaired under ocean acidification

    NASA Astrophysics Data System (ADS)

    Stumpp, Meike; Hu, Marian; Casties, Isabel; Saborowski, Reinhard; Bleich, Markus; Melzner, Frank; Dupont, Sam


    Larval stages are considered as the weakest link when a species is exposed to challenging environmental changes. Reduced rates of growth and development in larval stages of calcifying invertebrates in response to ocean acidification might be caused by energetic limitations. So far no information exists on how ocean acidification affects digestive processes in marine larval stages. Here we reveal alkaline (~pH 9.5) conditions in the stomach of sea urchin larvae. Larvae exposed to decreased seawater pH suffer from a drop in gastric pH, which directly translates into decreased digestive efficiencies and triggers compensatory feeding. These results suggest that larval digestion represents a critical process in the context of ocean acidification, which has been overlooked so far.

  13. The larva of Athripsodes genei (Rambur 1842) (Trichoptera, Leptoceridae).


    Waringer, Johann; Graf, Wolfram


    This paper describes the previously unknown larva of Athripsodes genei (Rambur 1842). Information on the morphology of the 5th larval instar is given and the most important diagnostic features are illustrated. In the context of existing identification keys the larva of A. genei keys together with A. albifrons (Linnaeus 1758), A. commutatus (Rostock 1874), A. leucophaeus (Rambur 1842) and Athripsodes tavaresi (Navás 1916). These species differ in the number of ventral edge setae at the 1st tibia and in the shape and colour of the submentum. With respect to zoogeography, Athripsodes genei is a (micro-)endemic of the collin and planar regions of Sardinia and Corsica (Graf et al. 2008). According to mandible morphology, A. genei is a collector-gatherer, shredder and, to a minor extent, also a predator.

  14. Extreme adaptations for aquatic ectoparasitism in a Jurassic fly larva.


    Chen, Jun; Wang, Bo; Engel, Michael S; Wappler, Torsten; Jarzembowski, Edmund A; Zhang, Haichun; Wang, Xiaoli; Zheng, Xiaoting; Rust, Jes


    The reconstruction of ancient insect ectoparasitism is challenging, mostly because of the extreme scarcity of fossils with obvious ectoparasitic features such as sucking-piercing mouthparts and specialized attachment organs. Here we describe a bizarre fly larva (Diptera), Qiyia jurassica gen. et sp. nov., from the Jurassic of China, that represents a stem group of the tabanomorph family Athericidae. Q. jurassica exhibits adaptations to an aquatic habitat. More importantly, it preserves an unusual combination of features including a thoracic sucker with six radial ridges, unique in insects, piercing-sucking mouthparts for fluid feeding, and crocheted ventral prolegs with upward directed bristles for anchoring and movement while submerged. We demonstrate that Q. jurassica was an aquatic ectoparasitic insect, probably feeding on the blood of salamanders. The finding reveals an extreme morphological specialization of fly larvae, and broadens our understanding of the diversity of ectoparasitism in Mesozoic insects.DOI:

  15. Symmetry of priapulids (Priapulida). 2. Symmetry of larvae.


    Adrianov, A V; Malakhov, V V


    Larvae of priapulids are characterized by radial symmetry evident from both external and internal characters of the introvert and lorica. The bilaterality appears as a result of a combination of several radial symmetries: pentaradial symmetry of the teeth, octaradial symmetry of the primary scalids, 25-radial symmetry of scalids, biradial symmetry of the neck, and biradial and decaradial symmetry of the trunk. Internal radiality is exhibited by musculature and the circumpharyngeal nerve ring. Internal bilaterality is evident from the position of the ventral nerve cord and excretory elements. Externally, the bilaterality is determined by the position of the anal tubulus and two shortened midventral rows of scalids bordering the ventral nerve cord. The lorical elements define the biradial symmetry that is missing in adult priapulids. The radial symmetry of larvae is a secondary appearance considered an evolutionary adaptation to a lifestyle within the three-dimensional environment of the benthic sediment.



    Silapanuntakul, Suthep; Keanjoom, Romnalin; Pandii, Wongdyan; Boonchuen, Supawadee; Sombatsiri, Kwanchai


    Trees with larvicidal activity may be found in Thailand. We conducted this study to evaluate the efficacy and length of efficacy of Thai neem (Azadirachta siamensis) oil emulsion and an alginate bead of Thai neem oil formulation against early fourth stage Aedes aegypti larvae using a dipping test. The Thai neem oil emulsion had significantly greater larvicidal activity than the alginate bead formulation at 12 to 60 hours post-exposure (p < 0.01). The Thai neem oil formulation resulted in 100% mortality among the early fourth stage Aedes aegypti larvae at 48 hours, while the alginate bead formulation resulted in 98% larval mortality at 84 hours and 100% mortality at 96 hours. The mean larval mortality using the Thai neem oil emulsion dropped to < 25% by 12 days and with the alginate beads dropped to < 25% by 15 days of exposure.

  17. Passive internal dispersal of insect larvae by migratory birds

    PubMed Central

    Green, Andy J; Sánchez, Marta I


    It has long been assumed that the resistant eggs of many zooplankton are able to survive passage through the gut of migratory waterbirds, thus facilitating their dispersal between isolated aquatic habitats. We present the first evidence that such passive internal transport within birds may be relevant for insect populations. In three out of six faecal samples from black-tailed Godwits on autumn migration in southwest Spain, we found larvae of the chironomid Chironomus salinarius which had survived gut passage. Although adult chironomids can fly, they are likely to disperse greater distances when transported as larvae via birds. In insects with discrete generations, such passive transport also enables colonization of new habitats at times when flight by adults is not an option. PMID:17148325

  18. [Eosinophilic pneumonia in response to cutaneous larva migrans syndrome--a case report].


    Darocha, Szymon; Wawrzyńska, Liliana; Oniszh, Karina; Dziewulska, Barbara


    Cutaneous larva migrans is a parasitic dermatosis imported by travelers returning from tropical and subtropical regions. In cutaneous larva migrans syndrome humans are incidental hosts and the larvae are unable to complete their natural cycle. Adult hookworms live in the intestines of dogs and cats, shedding eggs in feces that hatch and mature into larvae that can remain infective for months in the soil. Larvae penetrate the skin after contact with infected soil and cause an itchy creeping eruption. Cutaneous larva migrans is not usually associated with systemic symptoms and is rarely accompanied by peripheral blood eosinophilia. We report a patient who had both cutaneous larva migrans syndrome caused by Ancylostoma brasiliense and eosinophilic pneumonia after returning from Sri Lanka. The patient has been applied intravenous corticosteroids and local treatment with albendazole ointment with a very good clinical response.

  19. Enhanced ammonia content in compost leachate processed by black soldier fly larvae.


    Green, Terrence R; Popa, Radu


    Black soldier fly (BSF) larvae (Hermetia illucens), feeding on leachate from decaying vegetable and food scrap waste, increase ammonia (NH (4) (+) ) concentration five- to sixfold relative to leachate unprocessed by larvae. NH (4) (+) in larva-processed leachate reached levels as high as ∼100 mM. Most of this NH (4) (+) appears to have come from organic nitrogen within the frass produced by the larvae as they fed on leachate. In nitrate-enriched solutions, BSF larvae also facilitate dissimilatory nitrate reduction to ammonia. The markedly higher concentration of NH (4) (+) recovered in leachates processed with BSF larvae and concomitant diversion of nutrients into insect biomass (itself a valuable feedstock) indicate that the use of BSF larvae in processing leachate of decaying organic waste could be advantageous in offsetting capital and environmental costs incurred in composting.

  20. Recording Field Potentials From Zebrafish Larvae During Escape Responses

    PubMed Central

    Monesson-Olson, Bryan D.; Troconis, Eileen L.; Trapani, Josef G.


    Among vertebrates, startle responses are a ubiquitous method for alerting, and avoiding or escaping from alarming or dangerous stimuli. In zebrafish larvae, fast escape behavior is easily evoked through either acoustic or tactile stimuli. For example, a light touch to the head will excite trigeminal neurons that in turn excite a large reticulospinal neuron in the hindbrain called the Mauthner cell (M-cell). The M-cell action potential then travels down the contralateral trunk of the larva exciting motoneurons, which subsequently excite the entire axial musculature, producing a large amplitude body bend away from the source of the stimulus. This body conformation is known as the “C-bend” due to the shape of the larva during the behavior. As a result of the semi-synchronized activation of the M-cell, the population of motor neurons, and the axial trunk muscles, a large field potential is generated and can be recorded from free-swimming or fixed-position larvae. Undergraduate laboratories that record field potentials during escape responses in larval zebrafish are relatively simple to setup and allow students to observe and study the escape reflex circuit. Furthermore, by testing hypotheses, analyzing data and writing journal-style laboratory reports, students have multiple opportunities to learn about many neuroscience topics including vertebrate reflexes; sensory transduction; synaptic-, neuro-, and muscle-physiology; the M-cell mediated escape response; and the zebrafish as a model organism. Here, we detail the equipment, software, and recording setup necessary to observe field potentials in an undergraduate teaching lab. Additionally, we discuss potential advanced laboratory exercises and pedagogical outcomes. Finally, we note possible low-cost alternatives for recording field potentials. PMID:25565920

  1. A Ventromedian Cervical Sclerite of Mosquito Larvae (Diptera: Culicidae)

    DTIC Science & Technology


    Mosquito Sys tematics VOL. 8(2) 1976 205 A Ventromedian Cervical Sclerite oflMosquito Larvae (Diptera: Culicidae) John F. Rein& Department of...aegypt; (Linnaeus) by Hochman and Reinert (1974). The ventromedian cervical sclerite has a frag- mented appearance in a number of species of the...Dyar and Knab and dupreei (Coquillett)). Seventy-four species in 19 subgenera of Aedes examined possessed a ven- tromedian cervical sclerite. These

  2. Cutaneous larva migrans masquerading as tinea corporis: a case report.


    Dhanaraj, Manoharan; Ramalingam, Manoharan


    A 25-year-old male was seen with complaints of itchy skin lesions over left thigh. On examination multiple annular scaly plaques with wavy borders, peripheral papules and central clearing was seen. Closer examination revealed multiple forked tracts with excoriated papules. A diagnosis of cutaneous larva migrans was made and the patient treated using T.Albendazole 400 mg twice daily for 7 days which resulted in complete clinical cure.

  3. Toxic Peptides Occur Frequently in Pergid and Argid Sawfly Larvae

    PubMed Central

    Boevé, Jean-Luc; Rozenberg, Raoul; Shinohara, Akihiko; Schmidt, Stefan


    Toxic peptides containing D-amino acids are reported from the larvae of sawfly species. The compounds are suspected to constitute environmental contaminants, as they have killed livestock grazing in areas with congregations of such larvae, and related larval extracts are deleterious to ants. Previously, two octapeptides (both called lophyrotomin) and three heptapeptides (pergidin, 4-valinepergidin and dephosphorylated pergidin) were identified from three species in the family Pergidae and one in Argidae. Here, the hypothesis of widespread occurrence of these peptides among sawflies was tested by LC-MS analyses of single larvae from eight pergid and 28 argid species, plus nine outgroup species. At least two of the five peptides were detected in most sawfly species, whereas none in any outgroup taxon. Wherever peptides were detected, they were present in each examined specimen of the respective species. Some species show high peptide concentrations, reaching up to 0.6% fresh weight of 4-valinepergidin (1.75 mg/larva) in the pergid Pterygophorus nr turneri. All analyzed pergids in the subfamily Pterygophorinae contained pergidin and 4-valinepergidin, all argids in Arginae contained pergidin and one of the two lophyrotomins, whereas none of the peptides was detected in any Perginae pergid or Sterictiphorinae argid (except in Schizocerella pilicornis, which contained pergidin). Three of the four sawfly species that were previously known to contain toxins were reanalyzed here, resulting in several, often strong, quantitative and qualitative differences in the chemical profiles. The most probable ecological role of the peptides is defense against natural enemies; the poisoning of livestock is an epiphenomenon. PMID:25121515

  4. The diversity, development and evolution of polyclad flatworm larvae

    PubMed Central


    Polyclad flatworms offer an excellent system with which to explore the evolution of larval structures and the ecological and developmental mechanisms driving flatworm and marine invertebrate life history evolution. Although the most common mode of development in polyclads might be direct development (where the embryo develops directly into a form resembling the young adult), there are many species that develop indirectly, through a planktonic phase with transient larval features, before settling to the sea floor. In this review, I introduce polyclad life history strategies, larval diversity and larval anatomical features (presenting previously unpublished micrographs of a diversity of polyclad larvae). I summarize what is known about polyclad larval development during the planktonic phase and the transition to the benthic juvenile. Finally, I discuss evolutionary and developmental scenarios on the origin of polyclad larval characters. The most prominent characters that are found exclusively in the larval stages are lobes that protrude from the body and a ciliary band, or ciliary tufts, at the peripheral margins of the lobes. Larvae with 4–8 and 10 lobes have been described, with most indirect developing species hatching with 8 lobes. A ventral sucker develops in late stage larvae, and I put forward the hypothesis that this is an organ for larval settlement for species belonging to the Cotylea. Historically, the biphasic life cycle of polyclads was thought to be a shared primitive feature of marine invertebrates, with similarities in larval features among phyla resulting from evolutionary conservation. However, our current understanding of animal phylogeny suggests that indirect development in polyclads has evolved independently of similar life cycles found in parasitic flatworms and some other spiralian taxa, and that morphological similarities between the larvae of polyclads and other spiralians are likely a result of convergent evolution. PMID:24602223

  5. Cockchafer Larvae Smell Host Root Scents in Soil

    PubMed Central

    Weissteiner, Sonja; Huetteroth, Wolf; Kollmann, Martin; Weißbecker, Bernhard; Romani, Roberto; Schachtner, Joachim; Schütz, Stefan


    In many insect species olfaction is a key sensory modality. However, examination of the chemical ecology of insects has focussed up to now on insects living above ground. Evidence for behavioral responses to chemical cues in the soil other than CO2 is scarce and the role played by olfaction in the process of finding host roots below ground is not yet understood. The question of whether soil-dwelling beetle larvae can smell their host plant roots has been under debate, but proof is as yet lacking that olfactory perception of volatile compounds released by damaged host plants, as is known for insects living above ground, occurs. Here we show that soil-dwelling larvae of Melolontha hippocastani are well equipped for olfactory perception and respond electrophysiologically and behaviorally to volatiles released by damaged host-plant roots. An olfactory apparatus consisting of pore plates at the antennae and about 70 glomeruli as primary olfactory processing units indicates a highly developed olfactory system. Damage induced host plant volatiles released by oak roots such as eucalyptol and anisol are detected by larval antennae down to 5 ppbv in soil air and elicit directed movement of the larvae in natural soil towards the odor source. Our results demonstrate that plant-root volatiles are likely to be perceived by the larval olfactory system and to guide soil-dwelling white grubs through the dark below ground to their host plants. Thus, to find below-ground host plants cockchafer larvae employ mechanisms that are similar to those employed by the adult beetles flying above ground, despite strikingly different physicochemical conditions in the soil. PMID:23049688

  6. Observations of cocooned Hydrobaenus (Diptera: Chironomidae) larvae in Lake Michigan

    USGS Publications Warehouse

    Tucker, Taaja R.; Hudson, Patrick L.; Riley, Stephen


    Larvae of the family Chironomidae have developed a variety of ways to tolerate environmental stress, including the formation of cocoons, which allows larvae to avoid unfavorable temperature conditions, drought, or competition with other chironomids. Summer cocoon formation by younger instars of the genus Hydrobaenus Fries allows persistence through increased temperatures and/or intermittent dry periods in arid regions or temporary habitats, but this behavior was not observed in the Great Lakes until the current study. Cocoon-aestivating Hydrobaenus sp. larvae were found in benthic grab samples collected in 2010–2013 near Sleeping Bear Dunes National Lakeshore in northern Lake Michigan with densities up to 7329/m2. The aestivating species was identified as Hydrobaenus johannseni (Sublette, 1967), and the associated chironomid community was typical for an oligotrophic nearshore system. Hydrobaenus cocoon formation in the Great Lakes was likely previously unnoticed due to the discrepancies between the genus' life history and typical benthos sampling procedures which has consequences for describing chironomid communities where Hydrobaenus is present.

  7. Identification of Ruffe larvae (Gymnocephalus cernuus) in the ...

    EPA Pesticide Factsheets

    Non-native Ruffe (Gymnocephalus cernua; family Percidae) were first detected in the Laurentian Great Lakes in 1986, and are not included in the Great Lakes larval fish key which was published several years prior to their discovery. In addition, subsequent scientific literature has inconsistently described Ruffe larvae. As a result, identification of larval Ruffe remains challenging. We used traditional morphology paired with DNA technology to develop diagnostics for Ruffe larvae collected in the lower St. Louis River, and compared them to similar species. Ruffe < 6 mm total length have myomere counts and a phenotype that more closely resemble centrarchids like Black Crappie, Bluegill and Pumpkinseed rather than percids. However, morphometrics and pigment patterns can be used to distinguish Ruffe from similar centrarchids at this size. As Ruffe larvae develop, they increasingly resemble other percids such as Yellow Perch, but can be distinguished using myomere counts and morphological features. The findings presented here clarify conflicting descriptions in the scientific literature, and provide additional data to support more confident morphological identification of larval Ruffe. The impact of invasive Ruffe (Gymnocephalus cernuus) on the ecology of Great Lakes systems is currently being studied. Reproduction and early life history data, however, may be hampered by a general lack of information regarding their early life stage morphological description.

  8. Probiotic legacy effects on gut microbial assembly in tilapia larvae

    PubMed Central

    Giatsis, Christos; Sipkema, Detmer; Ramiro-Garcia, Javier; Bacanu, Gianina M.; Abernathy, Jason; Verreth, Johan; Smidt, Hauke; Verdegem, Marc


    The exposure of fish to environmental free-living microbes and its effect on early colonization in the gut have been studied in recent years. However, little is known regarding how the host and environment interact to shape gut communities during early life. Here, we tested whether the early microbial exposure of tilapia larvae affects the gut microbiota at later life stages. The experimental period was divided into three stages: axenic, probiotic and active suspension. Axenic tilapia larvae were reared either under conventional conditions (active suspension systems) or exposed to a single strain probiotic (Bacillus subtilis) added to the water. Microbial characterization by Illumina HiSeq sequencing of 16S rRNA gene amplicons showed the presence of B. subtilis in the gut during the seven days of probiotic application. Although B. subtilis was no longer detected in the guts of fish exposed to the probiotic after day 7, gut microbiota of the exposed tilapia larvae remained significantly different from that of the control treatment. Compared with the control, fish gut microbiota under probiotic treatment was less affected by spatial differences resulting from tank replication, suggesting that the early probiotic contact contributed to the subsequent observation of low inter-individual variation. PMID:27670882

  9. Candidate ionotropic taste receptors in the Drosophila larva.


    Stewart, Shannon; Koh, Tong-Wey; Ghosh, Arpan C; Carlson, John R


    We examine in Drosophila a group of ∼35 ionotropic receptors (IRs), the IR20a clade, about which remarkably little is known. Of 28 genes analyzed, GAL4 drivers representing 11 showed expression in the larva. Eight drivers labeled neurons of the pharynx, a taste organ, and three labeled neurons of the body wall that may be chemosensory. Expression was not observed in neurons of one taste organ, the terminal organ, although these neurons express many drivers of the Gr (Gustatory receptor) family. For most drivers of the IR20a clade, we observed expression in a single pair of cells in the animal, with limited coexpression, and only a fraction of pharyngeal neurons are labeled. The organization of IR20a clade expression thus appears different from the organization of the Gr family or the Odor receptor (Or) family in the larva. A remarkable feature of the larval pharynx is that some of its organs are incorporated into the adult pharynx, and several drivers of this clade are expressed in the pharynx of both larvae and adults. Different IR drivers show different developmental dynamics across the larval stages, either increasing or decreasing. Among neurons expressing drivers in the pharynx, two projection patterns can be distinguished in the CNS. Neurons exhibiting these two kinds of projection patterns may activate different circuits, possibly signaling the presence of cues with different valence. Taken together, the simplest interpretation of our results is that the IR20a clade encodes a class of larval taste receptors.

  10. Simple and Rapid Quantification of Thrombocytes in Zebrafish Larvae

    PubMed Central

    Huarng, Michael C.


    Abstract Platelets are a critical component of hemostasis, with disorders of number or function resulting in coagulation disturbances. Insights into these processes have primarily been realized through studies using mammalian models or tissues. Increasingly, zebrafish embryos and larvae have been used to study the protein and cellular components of hemostasis and thrombosis, including the thrombocyte, a nucleated platelet analog. However, investigations of thrombocytes have been somewhat limited due to lack of a robust and simple methodology for quantitation, an important component of platelet studies in mammals. Using video capture, we have devised an assay that produces a rapid, reproducible, and precise measurement of thrombocyte number in zebrafish larvae by counting fluorescently tagged cells. Averaging 1000 frames, we were able to subtract background fluorescence, thus limiting assessment to circulating thrombocytes. This method facilitated rapid assessment of relative thrombocyte counts in a population of 372 zebrafish larvae by a single operator in less than 3 days. This technique requires basic microscopy equipment and rudimentary programming, lends itself to high throughput analysis, and will enhance future studies of thrombopoiesis in the zebrafish. PMID:25790244

  11. Monarch larvae sensitivity to Bacillus thuringiensis- purified proteins and pollen.


    Hellmich, R L; Siegfried, B D; Sears, M K; Stanley-Horn, D E; Daniels, M J; Mattila, H R; Spencer, T; Bidne, K G; Lewis, L C


    Laboratory tests were conducted to establish the relative toxicity of Bacillus thuringiensis (Bt) toxins and pollen from Bt corn to monarch larvae. Toxins tested included Cry1Ab, Cry1Ac, Cry9C, and Cry1F. Three methods were used: (i) purified toxins incorporated into artificial diet, (ii) pollen collected from Bt corn hybrids applied directly to milkweed leaf discs, and (iii) Bt pollen contaminated with corn tassel material applied directly to milkweed leaf discs. Bioassays of purified Bt toxins indicate that Cry9C and Cry1F proteins are relatively nontoxic to monarch first instars, whereas first instars are sensitive to Cry1Ab and Cry1Ac proteins. Older instars were 12 to 23 times less susceptible to Cry1Ab toxin compared with first instars. Pollen bioassays suggest that pollen contaminants, an artifact of pollen processing, can dramatically influence larval survival and weight gains and produce spurious results. The only transgenic corn pollen that consistently affected monarch larvae was from Cry1Ab event 176 hybrids, currently <2% corn planted and for which re-registration has not been applied. Results from the other types of Bt corn suggest that pollen from the Cry1Ab (events Bt11 and Mon810) and Cry1F, and experimental Cry9C hybrids, will have no acute effects on monarch butterfly larvae in field settings.

  12. Using black soldier fly larvae for processing organic leachates.


    Popa, Radu; Green, Terrence R


    A large number of biodegradable byproducts including alcohols, soluble saccharides, volatile organic acids, and amines accumulate in the liquid fraction (leachate) produced as vegetal and food scrap waste decomposes. Untreated leachate, because it is rich in nutrients and organic byproducts, has a high chemical oxygen demand and is normally cleared of soluble organic byproducts by mineralization before its discharge into waterways. Mineralizing leachates using chemical and microbial biotechnologies is, however, a lengthy and costly process. We report here that the larvae of the black soldier fly Hermetia illucens (L.) (Diptera: Stratiomyidae), an insect rich in protein and lipids, and having significant commercial value, while feeding and growing off of compost leachate, lowers its chemical oxygen demand relative to that of leachate unexposed to larvae, neutralizes its acidity, and clears it of volatile organic acids, amines, and alcohols. These observations demonstrate that black soldier fly larvae could be used to help offset the cost and clean up of organic solutes in leachate waste streams while recycling carbon, nitrogen, and phosphate into usable and commercially valuable biomass.

  13. Activity of Selected Formulated Biorational and Synthetic Insecticides Against Larvae of Helicoverpa armigera (Lepidoptera: Noctuidae).


    Vivan, L M; Torres, J B; Fernandes, P L S


    This work studied 17 insecticides belonging to nucleopolyhedrovirus (NPV), Bacillus thuringiensis (Bt kurstaki and Bt aizawai), benzoylureas (insect growth regulators [IGRs]), carbamates, organophosphates, spinosyns, and diamides against larvae of Helicoverpa armigera (Hübner), invasive species in the South American continent. Larvae of different instars were fed for 7 d with untreated or insecticide-treated diets. Mortality was recorded daily for 7 d, and surviving larvae were individually weighed on the seventh day. The NPV and Bt insecticides caused 100% mortality of first-instar larvae and first-instar and second-instar larvae, respectively. However, both NPV and Bt-based products caused low mortality of third-instar larvae and did not kill older larvae. The IGR lufenuron was highly effective against all three ages of larvae tested, whereas teflubenzuron and triflumuron produced maximum 60% mortality of second-instar larvae and lower than 50% to older larvae. Thiodicarb, chlorantraniliprole, indoxacarb, chlorpyrifos, and chlorfenapyr, irrespective of tested age, caused 100% mortality of larvae, with the last two insecticides reaching 100% mortality within 2 d of feeding on the treated diet. Flubendiamide caused lower mortality but significantly affected the weight of surviving larvae, whereas neither spinosad nor methomyl produced significant mortality or affected the weight of larvae. Based on the results, the age of H. armigera larvae plays an important role in the recommendation of NPV and Bt insecticides. Furthermore, there are potential options between biological and synthetic insecticides tested against H. armigera, and recording larval size during monitoring, in addition to the infestation level, should be considered when recommending biological-based insecticides to control this pest.

  14. Feeding behavior and growth of turkey poults fed larvae of the darkling beetle, Alphitobius diaperinus.


    Despins, J L; Axtell, R C


    Experiments were conducted to determine the effects of feeding larvae of the darkling beetle (lesser mealworm), Alphitobius diaperinus (Panzer) [Coleoptera:Tenebrionidae], to turkey poults on poult growth and of beak trimming on poult feeding on the larvae. Young turkey poults readily fed on the larvae and exhibited reduced growth in the absence of other feed. Poults 3 to 5 d old restricted to a diet of only larvae consumed 259 +/- 99 (+/- SD) larvae per poult per day and their body weights were significantly lower (mean = 30 g) at the end of the 3 d than for poults on starter feed during the same time. After return to starter feed for 16 d after feeding on larvae for 3 d, the poults did not compensate for the weight loss although weight gains were normal. Poults from 2 through 10 d of age were given a choice between starter turkey feed and darkling beetle larvae. The numbers of larvae consumed per poult per day were: 174 +/- 8 for Days 2 to 4, 221 +/- 3 for Days 5 to 7, and 189 +/- 80 for Days 8 to 10. There was no significant difference between the body weight of poults feeding on larvae and starter feed compared with that of poults consuming feed only. In the presence of larvae, the mean feed consumption per poult was lower than for poults provided with only starter feed. The beetle larvae were 68% crude protein and 21% fat (DM basis) and had higher amounts of 18 amino acids than the starter feed. Poults that were beak trimmed consumed only about one-third as many larvae as poults with intact beaks. Poults (1 to 3 d old) with intact beaks consumed 169 +/- 20 larvae per poult per day; poults with trimmed beaks consumed 58 +/- 23 larvae per poult per day.



    Singh, Chabungbam Orville; Xin, Hu-hu; Chen, Rui-ting; Wang, Mei-xian; Liang, Shuang; Lu, Yan; Cai, Zi-zheng; Zhang, Deng-pan; Miao, Yun-gen


    Rab3 GTPases are known to play key a role in vesicular trafficking, and express highest in brain and endocrine tissues. In mammals, Rab3 GTPases are paralogs unlike in insect. In this study, we cloned Rab3 from the silk gland tissue of silkworm Bombyx mori, and identified it as BmRab3. Our in silico analysis indicated that BmRab3 is an isoform with a theoretical isoelectric point and molecular weight of 5.52 and 24.3 kDa, respectively. Further, BmRab3 showed the C-terminal hypervariability for GGT2 site but having two other putative guanine nucleotide exchange factor/GDP dissociation inhibitor interaction sites. Multiple alignment sequence indicated high similarities of BmRab3 with Rab3 isoforms of other species. The phylogeny tree showed BmRab3 clustered between the species of Tribolium castaneum and Aedes aegypti. Meanwhile, the expression analysis of BmRab3 showed the highest expression in middle silk glands (MSGs) than all other tissues in the third day of fifth-instar larva. Simultaneously, we showed the differential expression of BmRab3 in the early instar larva development, followed by higher expression in male than female pupae. In vivo dsRNA interference of BmRab3 reduced the expression of BmRab3 by 75% compared to the control in the MSGs in the first day. But as the worm grew to the third day, the difference of BmRab3 between knockdown and control was only about 10%. The knockdown later witnessed underdevelopment of the larvae and pharate pupae lethality in the overall development of silkworm B. mori L.

  16. Development and functional morphology of the mouthparts and foregut in larvae and post-larvae of Macrobrachium jelskii (Decapoda: Palaemonidae).


    Rocha, Cristina Pantoja; Souza, Adelson Silva de; Maciel, Murilo; Maciel, Cristiana R; Abrunhosa, Fernando Araújo


    The morphology of the mouthparts and foregut of the larvae and post-larvae of Macrobrachium jelskii was investigated to determine their functional roles in feeding, in order to understand the larval feeding behaviour and the changes that occur during its development. The mouthparts and foregut of the zoea I and II are morphologically similar, rudimentary and non-functional in feeding. Only in the final larval stage, zoea III, do the external mouthparts and foregut become structurally more complex and thus likely to play a potential role in feeding. Two behavioral trials (point of no return, point of reserve saturation) evaluated the resistance to starvation in zoea I, II, and III. The results indicate that they have sufficient nutritional reserves to permit them to complete metamorphosis without feeding. Overall, our results suggest that the zoea I and II of Macrobrachium jelskii engage in obligate lecithotrophy and zoea III in facultative lecithotrophy.

  17. Radiolabeling of infective third-stage larvae of Strongyloides stercoralis by feeding ( sup 75 Se)selenomethionine-labeled Escherichia coli to first- and second-stage larvae

    SciTech Connect

    Aikens, L.M.; Schad, G.A. )


    A technique is described for radiolabeling Strongyloides stercoralis larvae with ({sup 75}Se)selenomethionine. Cultures of an auxotrophic methionine-dependent stain of Escherichia coli were grown in a medium containing Dulbecco's modified Eagle's medium supplemented with 5% nutrient broth, amino acids, and ({sup 75}Se)selenomethionine. When the {sup 75}Se-labeled bacterial populations were in the stationary phase of growth, cultures were harvested and the bacteria dispersed on agar plates to serve as food for S. stercoralis larvae. Use of nondividing bacteria is important for successful labeling because the isotope is not diluted by cell division and death of larvae attributable to overgrowth by bacteria is prevented. First-stage S. stercoralis larvae were recovered from feces of infected dogs and reared in humid air at 30 C on agar plates seeded with bacteria. After 7 days, infective third-stage larvae were harvested. The mean specific activity of 6 different batches of larvae ranged from 75 to 330 counts per min/larva with 91.8 +/- 9.5% of the population labeled sufficiently to produce an autoradiographic focus during a practicable, 6-wk period of exposure. Labeled infective larvae penetrated the skin of 10-day-old puppies and migrated to the small intestine, where the developed to adulthood.

  18. Combinatorial effect of Bacillus amyloliquefaciens AG1 biosurfactant and Bacillus thuringiensis Vip3Aa16 toxin on Spodoptera littoralis larvae.


    Ben Khedher, Saoussen; Boukedi, Hanen; Dammak, Mariam; Kilani-Feki, Olfa; Sellami-Boudawara, Tahya; Abdelkefi-Mesrati, Lobna; Tounsi, Slim


    Spodoptera littoralis, one of the most serious and destructive agricultural pests in the world, is very susceptible to Vip3 toxin. In order to develop a new efficient bioinsecticide and to prevent the development of resistance by the target pest, insecticidal activity of biosurfactant produced by Bacillus amyloliquefaciens AG1 was evaluated against S. littoralis. Bioassays revealed the susceptibility of the first instar larvae of this pest to AG1 biosurfactant with an LC50 of 245ng/cm(2). Moreover, the histopathology examination of the larval midgut treated by AG1 biosurfactant showed vacuolization, necrosis and disintegration of the basement membrane. Binding experiments revealed that the AG1 biosurfactant recognized three putative receptors located in the brush border membrane vesicles of S. littoralis with sizes of 91, 72 and 64kDa. Competition assays using biotinylated metabolites indicated that AG1 biosurfactant and Vip3Aa16 toxin did not compete for the same S. littoralis receptors. When combined, AG1 biosurfactant and Vip3Aa16 showed an additive effect against S. littoralis larvae. These findings suggested that B. amyloliquefaciens AG1 biosurfactant could be a promising biocontrol agent to eradicate S. littoralis and to prevent resistance development by this pest.

  19. Acanthocheilonema viteae: Vaccination of jirds with irradiation-attenuated stage-3 larvae and with exported larval antigens

    SciTech Connect

    Lucius, R.; Textor, G.; Kern, A.; Kirsten, C. )


    Jirds (Meriones unguiculatus) were immunized with irradiated (35 krad) stage-3 larvae (L3) of Acanthocheilonema viteae. The induced resistance against homologous challenge infection and the antibody response of the animals were studied. Immunization with 3, 2, or 1 dose of 50 irradiated L3 induced approximately 90% resistance. Immunization with a single dose of only 5 irradiated L3 resulted in 60.8% protection while immunization with a single dose of 25 L3 induced 94.1% protection. The protection induced with 3 doses of 50 irradiated L3 did not decrease significantly during a period of 6 months. Sera of a proportion, but not all resistant jirds, contained antibodies against the surface of vector derived L3 as defined by IFAT. No surface antigens of microfilariae or adult worms were recognized by the sera. Vaccinated animals had antibody responses against antigens in the inner organs of L3 and in the cuticle and reproductive organs of adult worms as shown by IFAT. Immunoblotting with SDS-PAGE-separated L3 antigens and L3-CSN revealed that all sera contained antibodies against two exported antigens of 205 and 68 kDa, and against a nonexported antigen of 18 kDa. The 205-kDa antigen easily degraded into fragments of 165, 140, 125, and 105 kDa which were recognized by resistant jird sera. Various antigens of adult worms, but relatively few antigens of microfilariae, were also recognized. To test the relevance of exported antigens of L3 to resistance, jirds were immunized with L3-CSN together with a mild adjuvant. This immunization induced 67.7% resistance against challenge infection and sera of the immunized animals recognized the 205- and 68-kDa antigens of L3.

  20. Transcriptome Sequencing Reveals Large-Scale Changes in Axenic Aedes aegypti Larvae

    PubMed Central

    Vogel, Kevin J.; Valzania, Luca; Coon, Kerri L.; Brown, Mark R.; Strand, Michael R.


    Mosquitoes host communities of microbes in their digestive tract that consist primarily of bacteria. We previously reported that Aedes aegypti larvae colonized by a native community of bacteria and gnotobiotic larvae colonized by only Escherichia coli develop very similarly into adults, whereas axenic larvae never molt and die as first instars. In this study, we extended these findings by first comparing the growth and abundance of bacteria in conventional, gnotobiotic, and axenic larvae during the first instar. Results showed that conventional and gnotobiotic larvae exhibited no differences in growth, timing of molting, or number of bacteria in their digestive tract. Axenic larvae in contrast grew minimally and never achieved the critical size associated with molting by conventional and gnotobiotic larvae. In the second part of the study we compared patterns of gene expression in conventional, gnotobiotic and axenic larvae by conducting an RNAseq analysis of gut and nongut tissues (carcass) at 22 h post-hatching. Approximately 12% of Ae. aegypti transcripts were differentially expressed in axenic versus conventional or gnotobiotic larvae. However, this profile consisted primarily of transcripts in seven categories that included the down-regulation of select peptidases in the gut and up-regulation of several genes in the gut and carcass with roles in amino acid transport, hormonal signaling, and metabolism. Overall, our results indicate that axenic larvae exhibit alterations in gene expression consistent with defects in acquisition and assimilation of nutrients required for growth. PMID:28060822

  1. Production of the Catechol Type Siderophore Bacillibactin by the Honey Bee Pathogen Paenibacillus larvae

    PubMed Central

    Garcia-Gonzalez, Eva; Poppinga, Lena; Süssmuth, Roderich D.; Genersch, Elke


    The Gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood. This bacterial infection of honey bee brood is a notifiable epizootic posing a serious threat to global honey bee health because not only individual larvae but also entire colonies succumb to the disease. In the recent past considerable progress has been made in elucidating molecular aspects of host pathogen interactions during pathogenesis of P. larvae infections. Especially the sequencing and annotation of the complete genome of P. larvae was a major step forward and revealed the existence of several giant gene clusters coding for non-ribosomal peptide synthetases which might act as putative virulence factors. We here present the detailed analysis of one of these clusters which we demonstrated to be responsible for the biosynthesis of bacillibactin, a P. larvae siderophore. We first established culture conditions allowing the growth of P. larvae under iron-limited conditions and triggering siderophore production by P. larvae. Using a gene disruption strategy we linked siderophore production to the expression of an uninterrupted bacillibactin gene cluster. In silico analysis predicted the structure of a trimeric trithreonyl lactone (DHB-Gly-Thr)3 similar to the structure of bacillibactin produced by several Bacillus species. Mass spectrometric analysis unambiguously confirmed that the siderophore produced by P. larvae is identical to bacillibactin. Exposure bioassays demonstrated that P. larvae bacillibactin is not required for full virulence of P. larvae in laboratory exposure bioassays. This observation is consistent with results obtained for bacillibactin in other pathogenic bacteria. PMID:25237888

  2. Production of the catechol type siderophore bacillibactin by the honey bee pathogen Paenibacillus larvae.


    Hertlein, Gillian; Müller, Sebastian; Garcia-Gonzalez, Eva; Poppinga, Lena; Süssmuth, Roderich D; Genersch, Elke


    The Gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood. This bacterial infection of honey bee brood is a notifiable epizootic posing a serious threat to global honey bee health because not only individual larvae but also entire colonies succumb to the disease. In the recent past considerable progress has been made in elucidating molecular aspects of host pathogen interactions during pathogenesis of P. larvae infections. Especially the sequencing and annotation of the complete genome of P. larvae was a major step forward and revealed the existence of several giant gene clusters coding for non-ribosomal peptide synthetases which might act as putative virulence factors. We here present the detailed analysis of one of these clusters which we demonstrated to be responsible for the biosynthesis of bacillibactin, a P. larvae siderophore. We first established culture conditions allowing the growth of P. larvae under iron-limited conditions and triggering siderophore production by P. larvae. Using a gene disruption strategy we linked siderophore production to the expression of an uninterrupted bacillibactin gene cluster. In silico analysis predicted the structure of a trimeric trithreonyl lactone (DHB-Gly-Thr)3 similar to the structure of bacillibactin produced by several Bacillus species. Mass spectrometric analysis unambiguously confirmed that the siderophore produced by P. larvae is identical to bacillibactin. Exposure bioassays demonstrated that P. larvae bacillibactin is not required for full virulence of P. larvae in laboratory exposure bioassays. This observation is consistent with results obtained for bacillibactin in other pathogenic bacteria.

  3. Transcriptome Sequencing Reveals Large-Scale Changes in Axenic Aedes aegypti Larvae.


    Vogel, Kevin J; Valzania, Luca; Coon, Kerri L; Brown, Mark R; Strand, Michael R


    Mosquitoes host communities of microbes in their digestive tract that consist primarily of bacteria. We previously reported that Aedes aegypti larvae colonized by a native community of bacteria and gnotobiotic larvae colonized by only Escherichia coli develop very similarly into adults, whereas axenic larvae never molt and die as first instars. In this study, we extended these findings by first comparing the growth and abundance of bacteria in conventional, gnotobiotic, and axenic larvae during the first instar. Results showed that conventional and gnotobiotic larvae exhibited no differences in growth, timing of molting, or number of bacteria in their digestive tract. Axenic larvae in contrast grew minimally and never achieved the critical size associated with molting by conventional and gnotobiotic larvae. In the second part of the study we compared patterns of gene expression in conventional, gnotobiotic and axenic larvae by conducting an RNAseq analysis of gut and nongut tissues (carcass) at 22 h post-hatching. Approximately 12% of Ae. aegypti transcripts were differentially expressed in axenic versus conventional or gnotobiotic larvae. However, this profile consisted primarily of transcripts in seven categories that included the down-regulation of select peptidases in the gut and up-regulation of several genes in the gut and carcass with roles in amino acid transport, hormonal signaling, and metabolism. Overall, our results indicate that axenic larvae exhibit alterations in gene expression consistent with defects in acquisition and assimilation of nutrients required for growth.

  4. Exposure to lead induces hypoxia-like responses in bullfrog larvae (Rana catesbeiana)

    SciTech Connect

    Rice, T.M.; Blackstone, B.J.; Nixdorf, W.L.; Taylor, D.H.


    Amphibians collected around mining sites, areas with extensive automobile traffic, and shooting ranges have been documented to contain high levels of lead. Lead-exposed amphibians might respond as if in hypoxic conditions because exposure is known to decrease hemoglobin levels, damage erythrocytes, and alter respiratory surfaces. Therefore, the authors exposed bullfrog larvae to either 0 or 780 {micro}g/L Pb and either 3.50 or 7.85 mg/L oxygen for 7 d and monitored activity, trips to the surface, and buccal ventilation rates. Activity was significantly decreased in larvae exposed to low oxygen, Pb, or both compared to activity of larvae in high oxygen with no Pb. Larvae exposed to both Pb and low oxygen displayed higher buccal ventilation rates than larvae exposed to either treatment separately. Lead-exposed larvae surfaced significantly more often than unexposed larvae even under high-oxygen conditions. Lead-exposed larvae decreased in mass during the exposure period, whereas unexposed larvae increased in mass. Lead exposure could decrease survival of larvae in the field not only because of physiological problems due to decreased oxygen uptake but also because of greater predation pressure due to increased presence at the surface and reduced growth rates.

  5. Transmission of a Gammabaculovirus within Cohorts of Balsam Fir Sawfly (Neodiprion abietis) Larvae

    PubMed Central

    Graves, Roger; Quiring, Dan T.; Lucarotti, Christopher J.


    Nucleopolyhedroviruses (NPV: Gammabaculovirus: Baculoviridae) of diprionid sawflies (Diprionidae: Hymenoptera) are highly host specific and only infect the midgut epithelium. While still alive, infected sawfly larvae excrete NPV-laden diarrhea that contaminates food sources. The diarrhea can then be consumed by conspecific larvae, resulting in rapid horizontal transmission of the virus. To better understand the efficacy of Gammabaculovirus-based biological control products, the horizontal spread of such a virus (NeabNPV) within cohorts of balsam fir sawfly (Neodiprion abietis) larvae was studied by introducing NeabNPV-treated larvae into single-cohort groups at densities similar to those observed during the increasing (field study) and peak (laboratory study) phases of an outbreak. In field studies (~200 N. abietis larvae/m2 of balsam fir (Abies balsamea) foliage), NeabNPV-induced mortality increased positively in a density-dependent manner, from 23% (in control groups) to 51% with the addition of one first-instar NeabNPV-treated larva, to 84% with 10 first–instar-treated larvae. Mortality was 60% and 63% when one or 10 NeabNPV-treated third-instar larva(e), respectively, were introduced into groups. Slightly higher levels of NeabNPV-induced mortality occurring when NeabNPV-treated larvae were introduced into first- rather than third-instar cohorts suggests that early instars are more susceptible to the virus. In the laboratory (~1330 N. abietis larvae/ m2 of foliage), NeabNPV-caused mortality increased from 20% in control groups to over 80% with the introduction of one, five or 10 NeabNPV-treated larvae into treatment groups of first-instar larvae. PMID:26466722

  6. Biophysical processes leading to the ingress of temperate fish larvae into estuarine nursery areas: A review

    NASA Astrophysics Data System (ADS)

    Teodósio, Maria Alexandra; Paris, Claire B.; Wolanski, Eric; Morais, Pedro


    A series of complementary hypotheses have been proposed to explain the recruitment of marine and temperate pelagic fish larvae originated from pelagic eggs in coastal environments. In this review, we propose a new and complementary hypothesis describing the biophysical processes intervening in the recruitment of temperate fish larvae into estuaries. This new hypothesis, the Sense Acuity And Behavioral (SAAB) hypothesis, recognizes that recruitment is unlikely if the larvae drift passively with the water currents, and that successful recruitment requires the sense acuity of temperate fish larvae and their behavioral response to the estuarine cues present in coastal areas. We propose that temperate fish larvae use a hierarchy of sensory cues (odor, sound, visual and geomagnetic cues) to detect estuarine nursery areas and to aid during navigation towards these areas. The sensorial acuity increases along ontogeny, which coincides with increased swimming capabilities. The swimming strategies of post-flexion larvae differ from offshore areas to the tidal zone. In offshore areas, innate behavior might lead larvae towards the coast guided by a sun compass or by the earth's geomagnetic field. In areas under limited influence of estuarine plumes (either in energetic nearshore areas or offshore), post-flexion larvae display a searching swimming behavior for estuarine disconnected patches (infotaxis strategy). After finding an estuarine plume, larvae may swim along the increasing cue concentration to ingress into the estuary. Here, larvae exhibit a rheotaxis behavior and avoid displacement by longshore currents by keeping bearing during navigation. When larvae reach the vicinity of an estuary, merging diel rhythms with feeding and predator avoidance strategies with tidally induced movements is essential to increase their chances of estuarine ingress. A fish larva recruitment model developed for the Ria Formosa lagoon supports the general framework of the SAAB hypothesis. In

  7. Description of the larva of Tetragonoderus (Crossonychus) variegatus Dejean, 1829 (Coleoptera: Carabidae: Cyclosomini) with notes on biology.


    Santos, Guilherme Ide Marques Dos


    A late instar of the Tetragonoderus (Crossonychus) variegatus Dejean, 1829 larva is described for the first time, and is compared with its first instar, with the larva of another Tetragonoderus species, and with the larva of one Cyclicus species. Habitus and important structures of the larva are illustrated, as well the adult's membranous wings. Some aspects of the natural history of the larva and adult are also noted.

  8. A description of the Larva of Metapteron xanthomelas (Lucas, 1857) from the Restinga Forest of Southeastern Brazil (Coleoptera: Lycidae, Calopterini).


    Ferreira, Vinicius De Souza; Costa, Cleide


    The last instar larva of Metapteron xanthomelas (Lucas, 1857) is described. This is the first description of a larva for the genus. Two live larvae collected in the Brazilian Atlantic coast Restinga Forest of Itanhaém, São Paulo, were reared, one to adult and one was fixed in the last instar. This larva differs from the known Calopterini larvae by the absence of urogomphi, the dorsal abdominal segments undivided and strongly alveolate ornamentation on the head. 

  9. Immunomodulatory potential of particular Trichinella spiralis muscle larvae excretory-secretory components.


    Cvetkovic, J; Sofronic-Milosavljevic, Lj; Ilic, N; Gnjatovic, M; Nagano, I; Gruden-Movsesijan, A


    Excretory-secretory antigens of Trichinella spiralis muscle larvae can induce the semi-matured status of rat dendritic cells. This may at least partly be the consequence of transient activation of extracellular signal-regulated kinases 1/2 (ERK1/2). Here we investigated the potential of several components of excretory-secretory antigens (native fraction containing 45, 49 and 53kDa proteins and recombinant Tsp53, representing one of the constituents of this fraction) to demonstrate previously observed effects of excretory-secretory antigens on dendritic cells in vitro, characterised by establishment of a particular phenotype (very low MHC II expression, moderate CD86 expression and significant ICAM-1 expression) and functional properties (low production of pro-inflammatory cytokine IL-12p70, and high production of IL-10 and TGF-β). Dendritic cells activated by these components were able to provoke proliferation of naïve T cells and their polarisation towards Th2 and anti-inflammatory responses. The investigated antigens had almost the same capacity to induce IL-4 and IL-10 production from T cells as excretory-secretory antigens, but failed to induce significant TGF-β synthesis. It could be concluded that the investigated excretory-secretory antigens components can largely reproduce the immunomodulatory effects of the complete excretory-secretory antigens and therefore may be considered as molecules important for creation of the anti-inflammatory milieu achieved by the parasite.

  10. Purification and characterization of a novel antibacterial peptide from black soldier fly (Hermetia illucens) larvae.


    Park, Soon-Ik; Kim, Jong-Wan; Yoe, Sung Moon


    In this study, we induced and purified a novel antimicrobial peptide exhibiting activity against Gram-positive bacteria from the immunized hemolymph of Hermetia illucens larvae. The immunized hemolymph was extracted, and the novel defensin-like peptide 4 (DLP4) was purified using solid-phase extraction and reverse-phase chromatography. The purified DLP4 demonstrated a molecular weight of 4267 Da, as determined using the matrix-assisted laser desorption/ionization-time-of-flight (MALDI-TOF) method. From analysis of DLP4 by N-terminal amino acid sequencing using Edman degradation, combined with MALDI-TOF and rapid amplification of cDNA ends-polymerase chain reaction (RACE-PCR), the amino acid sequence of the mature peptide was determined to be ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK. In NCBI BLAST, the amino acid sequence of DPL4 was found to be 75% identical to the Phlebotomus duboscqi defensin. Analysis of the minimal inhibitory concentration (MIC) revealed that DLP4 have antibacterial effects against Gram-positive bacteria including methicillin-resistant Staphylococcus aureus (MRSA). The expression of DLP4 transcripts in several tissues after bacterial challenge was measured by quantitative real-time PCR. Expression of the DLP4 gene hardly occurred throughout the body before immunization, but was mostly evident in the fat body after immunization.

  11. Selective Antibiofilm Effects of Lucilia sericata Larvae Secretions/Excretions against Wound Pathogens

    PubMed Central

    Bohova, Jana; Majtan, Viktor; Takac, Peter


    Background. Maggot debridement therapy (MDT), using Lucilia sericata larvae, represents efficient, simple, and low-cost therapy for the treatment of chronic wounds. Aim. The aim was to investigate the antibiofilm activity of maggot excretions/secretions (ES) against biofilm of wound isolates Staphylococcus aureus (S. aureus), Enterobacter cloacae (E. cloacae), and Proteus mirabilis (P. mirabilis). Methods. Quantification of biofilm formation, was carried out using a microtiter plate assay. Proteolytic activity of maggot ES was performed using skim milk agar plates. A solid phase extraction and reverse phase HPLC C18 chromatography were employed to the isolate of maggot ES antibiofilm compounds. Results. Maggot ES at 100 mg/mL concentration significantly reduced biofilm formation thus disrupting established biofilm of E. cloacae. Heat-treated ES did not show any antibiofilm activity towards E. cloacae. Similar results were obtained in the case of S. aureus; however, the heat-treatment of maggot ES did not affect its antibiofilm activity. Moreover, a compound with molecular weight of 25 kDa exhibiting antibiofilm activity was identified in maggot ES. On the other hand, maggot ES protected and even stimulated P. mirabilis biofilm formation. Conclusions. Our results suggest that maggot ES may act selectively against different bacterial strain. PMID:25013449

  12. Nematode larvae infecting Priacanthus arenatus Cuvier, 1829 (Pisces: Teleostei) in Brazil.


    Kuraiem, Bianca P; Knoff, Marcelo; Felizardo, Nilza N; Gomes, Delir C; Clemente, Sérgio C São


    From July to December, 2013, thirty Priacanthus arenatus specimens commercialized in the cities of Niterói and Rio de Janeiro, State of Rio de Janeiro, were acquired. The fish were necropsied and filleted to investigate the presence of nematode larvae. Twenty fish (66.7%) out of the total were parasitized by nematode larvae. A total of 2024 larvae were collected; among them, 30 third-instar larvae of Anisakis sp. showed prevalence (P) = 20%, mean abundance (MA) = 1, and the mean intensity (MI) = 5, and infection sites (IS) = caecum, stomach, liver, and mesentery; and 1,994 third-instar larvae (1,757 encysted and 237 free) of Hysterothylacium deardorffoverstreetorum with P = 66.7%, MA = 66.5, and MI = 99.7, and IS = spleen, caecum, stomach, liver, mesentery, and abdominal muscle. This is the first study to report H. deardorffoverstreetorum and Anisakis sp. larvae parasitizing P. arenatus.

  13. Seasonal dynamics of cyathostomin (Nematoda - Cyathostominae) infective larvae in Brachiaria humidicola grass in tropical southeast Brazil.


    dos Santos, Claudia N; de Souza, Luciene S; Quinelato, Simone B; do Couto, Melissa C M; Pinheiro, Jairo; Rodrigues, M Lurdes de A


    The ecology of cyathostomin larvae was evaluated in different seasons, from July 2007 to June 2008, in the municipality of Seropédica, Rio de Janeiro state, southeastern Brazil. Samples of feces and grass were collected every 15 days at 8 AM and 5 PM and the infective larvae were recovered by the Baermann technique. Leaves of the grass Brachiaria humidicola were cut to 20 cm, which is the length containing most of the larvae. The highest number of larvae was recorded at 8 AM the winter (8300 L(3)kg(-1)dm) and spring (5300 L(3)kg(-1)dm). These results demonstrate that climate conditions can affect the recovery of larvae and that rain and temperature contributed to the migration and survival of the larvae, which were available throughout the year in the study area.

  14. Adult fruit fly attraction to larvae biases experience and mediates social learning.


    Durisko, Zachary; Anderson, Blake; Dukas, Reuven


    We investigated whether adult fruit flies (Drosophila melanogaster) use cues of larvae as social information in their food patch choice decisions. Adult male and female fruit flies showed attraction to odours emanating from foraging larvae, and females preferred to lay eggs on food patches occupied by larvae over similar unoccupied patches. Females learned and subsequently preferred to lay eggs at patches with novel flavours previously associated with feeding larvae over patches with novel flavours previously associated with no larvae. However, when we controlled for the duration of exposure to each flavoured patch, females no longer preferred the flavour previously associated with feeding larvae. This suggests that social learning in this context is indirect, as a result of strong social attraction biasing experience.

  15. Ex situ transportation of coral larvae for research, conservation, and aquaculture

    NASA Astrophysics Data System (ADS)

    Petersen, D.; Hatta, M.; Laterveer, M.; Bergen, D. Van.


    Due to the lack of appropriate methods to transport high amounts of larvae ex situ over large distances, the availability of coral larvae was so far mainly limited to their place of origin. For a research project at Rotterdam Zoo, The Netherlands, we transported several thousand larvae of three broadcast spawners ( Acropora tenuis, A. digitifera, Diploria strigosa) from the Indo Pacific and the Caribbean to Europe. Beside logistics and packing techniques, post-transport survival rates were mainly influenced by larvae density and transport duration. Our results indicate optimum survival rates of >90% at densities of 4 larvae ml-1 when not exceeding a transportation time of 4 days. The ex situ transport of coral larvae over large distances might offer new possibilities for research, conservation, and aquaculture.

  16. Natural hosts of the larvae of Nuttalliella sp. (N. namaqua?) (Acari: Nuttalliellidae).


    Horak, Ivan G; Lutermann, Heike; Medger, Katarina; Apanaskevich, Dmitry A; Matthee, Conrad A


    The first collection of unengorged and fully engorged larvae of Nuttalliella sp. (N. namaqua?) from the murid rodents Micaelamys namaquensis, Aethomys chrysophilus and Acomys spinosissimus in Limpopo Province and from M. namaquensis in the Northern Cape Province, South Africa, is documented. A total of nine larvae were collected from two M. namaquensis in the Soutpansberg mountain range in the Limpopo Province during April 2009. During the last week of September 2011, 221 larvae were collected from rodents at the same locality and 10 of 48 M. namaquensis, 6 of 12 Ae. chrysophilus and 3 of 14 Ac. spinosissimus were infested. One of the M. namaquensis harboured 53 larvae. Five larvae were collected from two M. namaquensis in the Northern Cape Province. Total genomic DNA was extracted from two larvae and a region of the 18S rRNA gene was sequenced for these. BLASTn searches revealed similarity between these specimens and the Nuttalliella sequences published on GenBank.

  17. Cumulative mortality of Aedes aegypti larvae treated with compounds

    PubMed Central

    Torres, Sandra Maria; da Cruz, Nadine Louise Nicolau; Rolim, Vitor Pereira de Matos; Cavalcanti, Maria Inês de Assis; Alves, Leucio Câmara; da Silva, Valdemiro Amaro


    OBJECTIVE To evaluate the larvicidal activity of Azadirachta indica, Melaleuca alternifolia, carapa guianensis essential oils and fermented extract of Carica papaya against Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae). METHODS The larvicide test was performed in triplicate with 300 larvae for each experimental group using the third larval stage, which were exposed for 24h. The groups were: positive control with industrial larvicide (BTI) in concentrations of 0.37 ppm (PC1) and 0.06 ppm (PC2); treated with compounds of essential oils and fermented extract, 50.0% concentration (G1); treated with compounds of essential oils and fermented extract, 25.0% concentration (G2); treated with compounds of essential oils and fermented extract, 12.5% concentration (G3); and negative control group using water (NC1) and using dimethyl (NC2). The larvae were monitored every 60 min using direct visualization. RESULTS No mortality occurred in experimental groups NC1 and NC2 in the 24h exposure period, whereas there was 100% mortality in the PC1 and PC2 groups compared to NC1 and NC2. Mortality rates of 65.0%, 50.0% and 78.0% were observed in the groups G1, G2 and G3 respectively, compared with NC1 and NC2. CONCLUSIONS The association between three essential oils from Azadirachta indica, Melaleuca alternifolia, Carapa guianensis and fermented extract of Carica papaya was efficient at all concentrations. Therefore, it can be used in Aedes aegypti Liverpool third larvae stage control programs. PMID:25119939

  18. Thyroid endocrine disruption of acetochlor on zebrafish (Danio rerio) larvae.


    Yang, Mei; Hu, Jingjin; Li, Shuying; Ma, Youning; Gui, Wenjun; Zhu, Guonian


    The herbicide acetochlor is widely used and detected in the environment and biota, and has been suspected to disrupt the thyroid endocrine system, but underlying mechanisms have not yet been clarified. In the present study, zebrafish larvae (7 days post-fertilization) were exposed to a series concentration of acetochlor (0, 1, 3, 10, 30, 100 and 300 µg l(-1) ) within a 14-day window until 21 days post-fertilization. Thyroid hormones and mRNA expression profiles of genes involved in the hypothalamic-pituitary-thyroid (HPT) axis were analyzed. Exposure to the positive control, 3,5,3'-triiodothyronine (T3 ), altered the mRNA expression, suggesting that the HPT axis in the critical window of zebrafish responded to chemical exposure and could be used to evaluate the effects of chemicals on the thyroid endocrine system. The mRNA expressions of genes involved in thyroid hormone synthesis (tshβ, slc5a5 and tpo) were upregulated significantly with acetochlor treatment, which might be responsible for the increased thyroxine concentrations. The downregulation of genes related to thyroid hormone metabolism (dio1 and ugt1ab) and transport (ttr) in zebrafish larvae exposed to acetochlor might further explain the increased thyroxine levels and decreased T3 levels. The mRNA expression of the thyroid hormone receptor (trα) was also upregulated upon acetochlor exposure. Results suggested that acetochlor altered mRNA expression of the HPT axis-related genes and changed the whole body thyroid hormone levels in zebrafish larvae. It demonstrated that acetochlor could cause endocrine disruption of the thyroid system by simulating the biological activity of T3 . Copyright © 2015 John Wiley & Sons, Ltd.

  19. Ontogeny of redox regulation in Atlantic cod (Gadus morhua) larvae.


    Hamre, Kristin; Penglase, Samuel J; Rasinger, Josef D; Skjærven, Kaja H; Olsvik, Pål A


    The reduction potential of a cell is related to its fate. Proliferating cells are more reduced than those that are differentiating, whereas apoptotic cells are generally the most oxidized. Glutathione is considered the most important cellular redox buffer and the average reduction potential (Eh) of a cell or organism can be calculated from the concentrations of glutathione (GSH) and glutathione disulfide (GSSG). In this study, triplicate groups of cod larvae at various stages of development (3 to 63 days post-hatch; dph) were sampled for analyses of GSSG/2GSH concentrations, together with activities of antioxidant enzymes and expression of genes encoding proteins involved in redox metabolism. The concentration of total GSH (GSH+GSSG) increased from 610 ± 100 to 1260 ± 150 μmol/kg between 7 and 14 dph and was then constant until 49 dph, after which it decreased to 810 ± 100 μmol/kg by 63 dph. The 14- to 49-dph period, when total GSH concentrations were stable, coincides with the proposed period of metamorphosis in cod larvae. The concentration of GSSG comprised approximately 1% of the total GSH concentration and was stable throughout the sampling series. This resulted in a decreasing Eh from -239 ± 1 to -262 ± 7 mV between 7 and 14 dph, after which it remained constant until 63 dph. The changes in GSH and Eh were accompanied by changes in the expression of several genes involved in redox balance and signaling, as well as changes in activities of antioxidant enzymes, with the most dynamic responses occurring in the early phase of cod larval development. It is hypothesized that metamorphosis in cod larvae starts with the onset of mosaic hyperplasia in the skeletal muscle at approximately 20 dph (6.8mm standard length (SL)) and ends with differentiation of the stomach and disappearance of the larval finfold at 40 to 50 dph (10-15 mm SL). Thus, metamorphosis in cod larvae seems to coincide with high and stable total concentrations of GSH.

  20. Lobesia botrana larvae develop faster in the presence of parasitoids.


    Vogelweith, Fanny; Moret, Yannick; Thiery, Denis; Moreau, Jérôme


    To combat parasitism hosts often rely on their immune system, which is the last line of defense. However, the immune system may not always be effective, and other non-immunological defenses might be favored to reduce the cost of parasite infection. Here we report that larvae of the moth Lobesia botrana can rapidly accelerate their development and reach maturity earlier in response to cues perceived at a distance from parasitoids. Such a phenotypically plastic life history shift, induced by the perception of deadly enemies in the environment, is likely to be an adaptive defensive strategy to prevent parasitoid attack, and has important implications in host-parasite dynamics.

  1. Lobesia botrana Larvae Develop Faster in the Presence of Parasitoids

    PubMed Central

    Vogelweith, Fanny; Moret, Yannick; Thiery, Denis; Moreau, Jérôme


    To combat parasitism hosts often rely on their immune system, which is the last line of defense. However, the immune system may not always be effective, and other non-immunological defenses might be favored to reduce the cost of parasite infection. Here we report that larvae of the moth Lobesia botrana can rapidly accelerate their development and reach maturity earlier in response to cues perceived at a distance from parasitoids. Such a phenotypically plastic life history shift, induced by the perception of deadly enemies in the environment, is likely to be an adaptive defensive strategy to prevent parasitoid attack, and has important implications in host–parasite dynamics. PMID:24015260

  2. Generation of aneurogenic larvae by parabiosis of salamander embryos.


    Kumar, Anoop; Delgado, Jean Paul


    Limb regeneration of salamanders is nerve dependent, and the removal of the nerves in early stages of limb regeneration severely curtails the proliferation of the blastemal cells and growth of the regenerate. The removal of the neural tube from a developing salamander embryo results in an aneurogenic larva and the aneurogenic limb (ANL) develops independently without innervation. Paradoxically, the limb in an ANL is capable of regeneration in a nerve-independent manner. Here, we describe a detailed method for the generation of ANL in the spotted salamander, Ambystoma maculatum, for regeneration studies.

  3. Drosophila melanogaster larvae make nutritional choices that minimize developmental time.


    Rodrigues, Marisa A; Martins, Nelson E; Balancé, Lara F; Broom, Lara N; Dias, António J S; Fernandes, Ana Sofia D; Rodrigues, Fábio; Sucena, Élio; Mirth, Christen K


    Organisms from slime moulds to humans carefully regulate their macronutrient intake to optimize a wide range of life history characters including survival, stress resistance, and reproductive success. However, life history characters often differ in their response to nutrition, forcing organisms to make foraging decisions while balancing the trade-offs between these effects. To date, we have a limited understanding of how the nutritional environment shapes the relationship between life history characters and foraging decisions. To gain insight into the problem, we used a geometric framework for nutrition to assess how the protein and carbohydrate content of the larval diet affected key life history traits in the fruit fly, Drosophila melanogaster. In no-choice assays, survival from egg to pupae, female and male body size, and ovariole number - a proxy for female fecundity - were maximized at the highest protein to carbohydrate (P:C) ratio (1.5:1). In contrast, development time was minimized at intermediate P:C ratios, around 1:2. Next, we subjected larvae to two-choice tests to determine how they regulated their protein and carbohydrate intake in relation to these life history traits. Our results show that larvae targeted their consumption to P:C ratios that minimized development time. Finally, we examined whether adult females also chose to lay their eggs in the P:C ratios that minimized developmental time. Using a three-choice assay, we found that adult females preferentially laid their eggs in food P:C ratios that were suboptimal for all larval life history traits. Our results demonstrate that D. melanogaster larvae make foraging decisions that trade-off developmental time with body size, ovariole number, and survival. In addition, adult females make oviposition decisions that do not appear to benefit the larvae. We propose that these decisions may reflect the living nature of the larval nutritional environment in rotting fruit. These studies illustrate the

  4. Gastrointestinal symptoms resembling ulcerative proctitis caused by larvae of the drone fly Eristalis tenax

    PubMed Central

    Desoubeaux, Guillaume; Gaillard, Julien; Borée-Moreau, Diane; Bailly, Éric; Andres, Christian R; Chandenier, Jacques


    We report a case of facultative intestinal myiasis due to larvae of the drone fly Eristalis tenax, also named the rat-tailed maggots. The development of larvae in the lower bowel was responsible for non-specific gastrointestinal symptoms that resembled ulcerative proctitis. The diagnosis was established upon the observation of four spontaneously excreted mobile larvae. The definite identification of the E. tenax species was made possible by scanning electron microscopy. The clinical outcome was satisfactory. PMID:24766340

  5. Gastrointestinal symptoms resembling ulcerative proctitis caused by larvae of the drone fly Eristalis tenax.


    Desoubeaux, Guillaume; Gaillard, Julien; Borée-Moreau, Diane; Bailly, Éric; Andres, Christian R; Chandenier, Jacques


    We report a case of facultative intestinal myiasis due to larvae of the drone fly Eristalis tenax, also named the rat-tailed maggots. The development of larvae in the lower bowel was responsible for non-specific gastrointestinal symptoms that resembled ulcerative proctitis. The diagnosis was established upon the observation of four spontaneously excreted mobile larvae. The definite identification of the E. tenax species was made possible by scanning electron microscopy. The clinical outcome was satisfactory.

  6. Larva Migration and Eosinophilia in Mice Experimentally Infected With Gnathostoma spinigerum

    PubMed Central

    Saksirisampant, W.; Choomchuay, N.; Kraivichian, K.; Thanomsub, B. Wongsatayanon


    Background Gnathostoma spinigerum causes larva migran in human which is endemic in Southeast Asia. Information regarding larva migration is limited. In this study, we investigated the parasite migration by recovery of worms from the whole body of mouse after oral infection with advanced third stage larvae (AL3). The percentage of blood eosinophils was examined in parallel. Methods Mice were orally infected with AL3 and histological study of organs was investigated in order to study the migration of AL3, along with blood eosinophilia. Results At 1 hr post infection (PI), the larvae remained in the stomach, thereafter at 3, 5, 7, 10 and 24 hr PI; they were recovered from various organs including liver, mesentery, esophagus, diaphragm, lung, heart and dorsal fat. At day 15 PI, they were mostly found in muscles (76.47%). The average worm recovery (5 months) was 78.03%. The worms were found in the liver at every time point. Larva encystment was detected. There was a significant difference in blood eosinophils between the 8 larvae- (average 9.33% + 6.25%) and the 15 larvae-infected groups (average 22.66% + 11.03%). Surprisingly, the blood eosinophils (average 19.00% + 2.92%) were not higher in the higher infective dose- group (25 larvae). Conclusion Liver was involved by G. spinigerum throughout the study. We detected larva encystment which had never been reported in human gnathostomiasis. The highest percentage of eosinophil occurred during the invasive stage. PMID:23109965

  7. High infectivity of Toxocara cati larvae from muscles of experimentally infected rats.


    Taira, Kensuke; Yanagida, Tomonori; Akazawa, Naoko; Saitoh, Yasuhide


    The organ distribution of Toxocara cati larvae in albino rats Rattus norvegicus (n=6/group) experimentally inoculated with 1000 embryonated eggs was examined 1, 2, 3, 7, 30, 90, and 180 days post inoculation (dpi), and the infectivity of recovered larvae was evaluated by bioassay in mice. The intestines, liver, lungs, muscles (carcass) and other organs (heart, brain, spleen, kidneys and genital organs) were digested for larval recovery. Larvae were recovered from all rats, with the mean number of recovered larvae ranging from 13.3 at 1 dpi to 135.6 at 90 dpi. Most of the larvae recovered were detected in the intestines (56.3%) and liver (43.8%) at 1 dpi; liver (21.6%) and lungs (69.6%) at 2 dpi; muscles (45.9%) and lungs (36.9%) at 3 dpi. Subsequently, most of larvae were recovered from muscles at 7 dpi (92.5%), 30 dpi (97.8%), 90 dpi (99.4%) and 180 dpi (99.1%). In the mouse bioassay, 43.8% of 90-day-old larvae and 43.0% of 180-day-old larvae recovered from rats established in mice. The present study demonstrated that T. cati larvae persist predominantly in rat muscles and nearly half of them retain infective for at least half a year. The results indicate that R. norvegicus may be a suitable paratenic host of T. cati under natural conditions.

  8. Fused embryos and pre-metamorphic conjoined larvae in a broadcast spawning reef coral

    PubMed Central

    Jiang, Lei; Lei, Xin-Ming; Liu, Sheng; Huang, Hui


    Fusion of embryos or larvae prior to metamorphosis is rarely known to date in colonial marine organisms. Here, we document for the first time that the embryos of the broadcast spawning coral Platygyra daedalea could fuse during blastulation and further develop into conjoined larvae, and the settlement of conjoined larvae immediately resulted in inborn juvenile colonies. Fusion of embryos might be an adaptive strategy to form pre-metamorphic chimeric larvae and larger recruits, thereby promoting early survival. However, future studies are needed to explore whether and to what extent fusion of coral embryos occurs in the field, and fully evaluate its implications. PMID:25901279

  9. Effects of size and light on respiration and activity of walleye pollock (Theragra chalcogramma) larvae.


    Porter, S M.


    The respiration rate and swimming activity of walleye pollock (Theragra chalcogramma) larvae were measured in the laboratory to determine how these were affected by body size (measured as dry weight), and amount of light. Size influenced respiration rates, but not activity. Activity increased with increased light, and as walleye pollock larvae developed, light had an increasingly important effect on respiration rate. For older larvae, light is an important factor affecting respiration rate and this may be due to an increased sensitivity to light. Thus, in addition to size, light plays an important role in the energetics of walleye pollock larvae.

  10. Length changes in white sturgeon larvae preserved in ethanol or formaldehyde

    USGS Publications Warehouse

    Bayer, J.M.; Counihan, T.D.


    We examined the effects of two preservatives on the notochord and total lengths of white sturgeon (Acipenser transmontanus) larvae. White sturgeon larvae that were one, seven, and 14 days old were measured live and then preserved in 95% ethanol or 10% formaldehyde. Length changes were then determined at 20 and 95 days after preservation. We found mean length changes ranging from 0.4% to 3.4% shrinkage. Length changes varied with preservative, age of larvae, and length of time preserved. Constant length correction factors are provided for 10% formaldehyde or 95% ethanol valid for larvae between 1 and 14 days old preserved for less than 100 days.

  11. House fly oviposition inhibition by larvae ofHermetia illucens, the black soldier fly.


    Bradley, S W; Sheppard, D C


    Wild populations of house flies were inhibited from ovipositing into poultry manure containing larvae of the black soldier fly,Hermetia illucens (L.). A laboratory strain of house fly responded differently, readily ovipositing into manure with lower densities of soldier fly larvae, but avoiding the higher densities tested. The amount of timeH. illucens larvae occupy the manure prior to an oviposition test influences ovipositional responses of house flies. Manure conditioned byH. illucens larvae for 4-5 days did not significantly inhibit house fly oviposition. We suggest that some type of interspecific chemical communication (allomone) is present.

  12. [Effects of fermented cattle dung on the growth and development of Tenebrio molitor larvae].


    Zeng, Xiang-Wei; Wang, Xia; Guo, Li-Yue; Zhan, Li-Jie; Bo, Wen-Jing; Li, Zhan; Wu, Guang-Lei; Jiang, Gao-Ming


    In order to make use of and industrialize the animal dung from large cattle farms, this paper explored the feasibility of using Tenebrio molitor to digest and utilize cattle dung. Cattle dung was mixed with the conventional feed (65% wheat bran, 30% corn flour, and 5% bean pulp) of T. molitor in definite proportions, and fermented with effective microorganisms (EM). The fermented products containing 60% and 80% of cattle dung (FD1 and FD2, respectively) were selected to feed T. molitor larvae, and the effects of the fermented products on the growth curve, death rate, pupation rate, and antioxidant system of the larvae were compared. Compared with CK (conventional deed), the FD1 made the developmental duration of the larvae prolonged by 10 days and the larvae's death rate upraised somewhat, but made the single larva's total food intake, average body mass, crude fat content, and ratio of unsaturated to saturated fat acids increased by 49%, 28%, 26%, and 32%, respectively (P < 0.05), and the activity of larvae's antioxidant system improved significantly, showing a remarkable adaptability of the larvae to FD1. Unlike FD1, FD2 displayed definite disadvantages in most test growth indicators, as compared with CK, indicating that T. molitor larvae had weak adaptability to FD2. Our findings suggested that using FD1 to feed the 3rd instar of T. molitor larvae would have good practical prospects in industrializing cattle dung.

  13. Biological Control of the Nematode Infective larvae of Trichostrongylidae Family With Filamentous Fungi

    PubMed Central

    Zarrin, Majid; Rahdar, Mahmoud; Gholamian, Abbas


    Background: Biological control of parasitic nematodes by microorganisms is a promising approach to control such parasites. Microorganisms such as fungi, viruses and bacteria are recognized as biocontrol agents of nematodes. Objectives: The current study mainly aimed to evaluate the in vitro Potential of various saprophyte soil-fungi in reducing the infective larvae stage of parasitic nematode Trichostrongylidae family. Materials and Methods: Sheep feces were employed to provide the required third stage larvae source for the experiments. The nematode infective larvae of Trichostrongylidae family including three species of Ostertagia circumcincta, Marshalgia marshali and Heamonchos contortus were collected by Berman apparatus. Fifteen isolates of filamentous fungi were tested in the current study. One milliliter suspension containing 200 third stage larvae of Trichostrongylidae family was separately added to the fungal cultures in 2% water-agar medium Petri-dishes. Every day the live larvae were counted with light microscope (10X) and the number of captured larvae was recorded on different days. Results: Significant differences were observed in the results of co-culture of nematodes larva and fungi after seven days. The most effective fungi against the nematodes larvae were Cladosporium sp., Trichoderma sp., Fusarium equisetti, after seven days of incubation. Conclusions: The studies on fungi could be applied as suitable tools in biocontrol of nematode infections. However, additional surveys are required to select efficient with the ability to reduce the nematode larvae in the environment. PMID:25893084

  14. Biotransformation of alpha-terpineol by the larvae of common cutworm (Spodoptera litura).


    Miyazawa, Mitsuo; Ohsawa, Masashi


    Biotransformation of alpha-terpineol by the common cutworm (Spodoptera litura) larvae was investigated. alpha-Terpineol was mixed in an artificial diet, and the diet was fed to the larvae (fourth-fifth instar) of S. litura. Metabolites were isolated from the frass and analyzed spectroscopically. Main metabolites were 7-hydroxy-alpha-terpineol (p-menth-1-ene-7,8-diol) and oleuropeic acid (8-hydroxy-p-menth-1-en-7-oic acid). Intestinal bacteria from the frass of larvae did not participate in the metabolism of alpha-terpineol. alpha-Terpineol was preferentially oxidized at the C-7 position (allylic methyl group) by S. litura larvae.

  15. Cutaneous larva migrans in northern climates. A souvenir of your dream vacation.


    Edelglass, J W; Douglass, M C; Stiefler, R; Tessler, M


    Three young women recently returned to the metropolitan Detroit area with cutaneous larva migrans. All three had vacationed at a popular club resort on the Caribbean island of Martinique. Cutaneous larva migrans is frequently seen in the southern United States, Central and South America, and other subtropical areas but rarely in northern climates. Several organisms can cause cutaneous larva migrans, or creeping eruption. The larvae of the nematode Ancylostoma braziliense are most often the causative organisms. Travel habits of Americans make it necessary for practitioners in northern climates to be familiar with diseases contracted primarily in warmer locations. The life cycle of causative organisms and current therapy are reviewed.

  16. Description of the Terrestrial Larva of Parosca latipalpis (Macquart) (Diptera: Tabanidae) from Southern Chile.


    González, C R; Llanos, L; Saldarriaga-Córdoba, M


    The terrestrial larva of the austral horsefly, Parosca latipalpis (Macquart), identified by molecular techniques, is described. The larva of P. latipalpis resembles Scaptia auriflua (Donovan), Copidapha vicina (Taylor), Myioscaptia muscula (English), and Osca lata (Guérin-Meneville) in many morphological characters, as well as in their terrestrial habitats. Some characters that are shared between these species are unique among Tabanidae and provide evidence of their monophyletic origin, suggesting a typical Gondwanaland group. Larvae of P. latipalpis were found 2-3 cm below of the soil surface and associated with larvae of Coleoptera, Lepidoptera, and Diptera in southern Chile.

  17. Description of the final stadium larva of Heliocypha perforata perforata (Percheron), with discussion of the taxonomic characters of the larvae of the genus Heliocypha Fraser (Odonata: Zygoptera: Chlorocyphidae).


    Xu, Qi-Han


    The final stadium larva of Heliocypha perforata perforata is described and illustrated for the first time. It is characterized by having a row of filiform setae present laterally on distal half of prementum, 6-7 setae on the outer side of palpal lobe, very long lateral gills and distinct abdominal color pattern. The taxonomic characters of the larvae of the genus Heliocypha Fraser are discussed and summarized. Heliocypha larvae share a high similarity with Rhinocypha in general appearance and cannot be clearly distinguished from the latter in structure.

  18. Cranial features of dendrobatid larvae (Amphibia: Anura: Dendrobatidae).


    Haas, A


    The larval neurocranium and visceral arches of seven dendrobatid species representing four genera are described, based on cleared-and-stained and serially sectioned specimens. A variety of characters is shared by all seven species. Larval features do not substantiate the assumption of close ranoid affinities of the Dendrobatidae. Instead dendrobatid larvae share features such as the special quadripartite cartilago suprarostralis, the lack of the larval processus oticus, the presence of three foramina acustica, and the lack of a foramen perilymphaticum accessorius with many bufonoid larvae. The first of these characters is unique to bufonids, hylids, dendrobatids, and some New World leptodactylids; the other characters also occur in pelobatids and are presumably plesiomorphic for the Neobatrachia. The free proximal ends of Ceratobranchialia II and III are an autapomorphy of the Dendrobatidae supporting the monophyly of the family. Some features of the cranium are paedomorphic: low cartilago orbitalis, lack of connection between cartilage orbitalis and otic capsule (most species), and vestigal taeniae tecti. New anatomical terms are introduced.

  19. Dengue virus detection in Aedes aegypti larvae from southeastern Brazil.


    Cecílio, Samyra Giarola; Júnior, Willer Ferreira Silva; Tótola, Antônio Helvécio; de Brito Magalhães, Cíntia Lopes; Ferreira, Jaqueline Maria Siqueira; de Magalhães, José Carlos


    The transmission of dengue, the most important arthropod-borne viral disease in Brazil, has been intensified over the past decades, along with the accompanying expansion and adaptation of its Aedes vectors. In the present study, we mapped dengue vectors in Ouro Preto and Ouro Branco, Minas Gerais, by installing ovitraps in 32 public schools. The traps were examined monthly between September, 2011 through July, 2012 and November, 2012 to April, 2013. The larvae were reared until the fourth stadium and identified according to species. The presence of dengue virus was detected by real time PCR and agarose gel electrophoresis. A total of 1,945 eggs was collected during the 17 months of the study. The Ovitrap Positivity Index (OPI) ranged from 0 to 28.13% and the Eggs Density Index (EDI) ranged from 0 to 59.9. The predominant species was Aedes aegypti, with 84.9% of the hatched larvae. Although the collection was low when compared to other ovitraps studies, vertical transmission could be detected. Of the 54 pools, dengue virus was detected in four Ae. aegypti pools.

  20. Effects of Cyclin Dependent Kinase 9 inhibition on zebrafish larvae

    PubMed Central

    Matrone, Gianfranco; Tucker, Carl S.; Denvir, Martin A.


    ABSTRACT CDK9 is a known regulator of cellular transcription, growth and proliferation. Small molecule inhibitors are currently being developed and assessed in clinical trials as anti-cancer drugs. The zebrafish embryo provides an ideal model to explore the effects of CDK9 inhibition in-vivo. This has not been adequately explored previously at the level of a whole organism. We have compared and contrasted the effects of pharmacological and molecular inhibition of CDK9 on somatic growth, apoptosis and cellular proliferation in zebrafish larvae between 0 to 120 hours post fertilisation (hpf) using flavopiridol, a selective CDK9 antagonist, and CDK9-targeting morpholino. We demonstrate that the inhibition of CDK9 diminishes cellular proliferation and increases apoptosis. Subsequently, it affects somatic growth and development of a number of key embryonic structures including the brain, heart, eye and blood vessels. For the first time, we have localized CDK9 at a subcellular level in whole-mounted larvae. This works shows, at a high-throughput level, that CDK9 clearly plays a fundamental role in early cellular growth and proliferation. PMID:27715402

  1. Molecular characterisation of Anisakidae larvae from fish in Adriatic Sea.


    Vardić Smrzlić, I; Valić, D; Kapetanović, D; Kurtović, B; Teskeredžić, E


    In the present study, anisakids from: tuna (Thunnus thynnus) fattened in the Croatian farm in middle Adriatic Sea, three different feral fish species caught near tuna farm (Trachurus trachurus, Scomber japonicus and Oblada melanura) and fish marketed in Croatia (T. trachurus) were analysed by morphology and molecular methods. Larvae were identified to the species level by PCR restriction fragment length polymorphism and characterised by sequencing of nuclear (internal transcribed spacer) and mitochondrial (cytochrome c oxidase subunit 2) markers. The results revealed diverse Anisakidae community consisting of: Anisakis pegreffi, Anisakis simplex (s.s.), Anisakis typica and Hysterothylacium aduncum. This is the first report of A. typica in Adriatic Sea, and also the first record of this species in T. thynnus as host in Mediterranean Sea. Molecular identification of H. aduncum found in co-infection with Anisakis larvae type I expands our knowledge of the occurrence of these taxa in the Adriatic Sea. Zoonotic Anisakidae worms found in fish from the Adriatic Sea could represent a risk to acquire parasitic infection/allergies in Croatia.

  2. Extreme adaptations for aquatic ectoparasitism in a Jurassic fly larva

    PubMed Central

    Chen, Jun; Wang, Bo; Engel, Michael S; Wappler, Torsten; Jarzembowski, Edmund A; Zhang, Haichun; Wang, Xiaoli; Zheng, Xiaoting; Rust, Jes


    The reconstruction of ancient insect ectoparasitism is challenging, mostly because of the extreme scarcity of fossils with obvious ectoparasitic features such as sucking-piercing mouthparts and specialized attachment organs. Here we describe a bizarre fly larva (Diptera), Qiyia jurassica gen. et sp. nov., from the Jurassic of China, that represents a stem group of the tabanomorph family Athericidae. Q. jurassica exhibits adaptations to an aquatic habitat. More importantly, it preserves an unusual combination of features including a thoracic sucker with six radial ridges, unique in insects, piercing-sucking mouthparts for fluid feeding, and crocheted ventral prolegs with upward directed bristles for anchoring and movement while submerged. We demonstrate that Q. jurassica was an aquatic ectoparasitic insect, probably feeding on the blood of salamanders. The finding reveals an extreme morphological specialization of fly larvae, and broadens our understanding of the diversity of ectoparasitism in Mesozoic insects. DOI: PMID:24963142

  3. Histomorphogenesis of cranial nerves in Huso huso larvae

    PubMed Central

    Tavighi, Sherma; Saadatfar, Zohreh; Shojaei, Bahador; Behnam Rassouli, Morteza


    In this study the cranial nerves development of H. huso are explained from 1 to 54-days-old (1, 3, 6, 15, 21 and 54 days). Despite all the researches on fish brain, there are no study on nerves evolution on H. huso during their larvae life. For this research 40 samples of larvae H. huso were obtained (from each age, about six samples were selected). The specimens were maintained in fiberglass tank, then histological samples were taken from tissues and stained with hematoxylin and eosin for general histological studies using light microscope. According to the results, on 1 and 3-days-old, no nerve was observed. The terminal nerve and their dendrites were observed around the nasal cavity and the axons projected to different areas in forebrain especially around olfactory bulb diffusely, on 6-day-old fish. Also, olfactory, optic, oculomotor, trochlear, trigeminal, lateral line and vagus nerves were detected on 6-day-old fish, however two parts of lateral line nerve were separated on 54-day-old. Three nerves, profundus, facial and octaval were observed on 54-day-old, however, up to this age, epiphysial nerve was not observed. PMID:27482355

  4. Phototoxicity of petroleum products to marine invertebrate larvae and niles

    SciTech Connect

    Pelletier, M.C.; Burgess, R.; Ho, K.; Kuhn, A; McKinney, R.; Ryba, S.


    Ultraviolet light can activate certain polycyclic aromatic hydrocarbons (PAHs), inducing the production of free radicals. In biological organisms these free radicals destroy tissues, causing up to a 4,000 fold increase in toxicity. This dramatic response is a potential marker for PAH contamination in environmental samples. Ultraviolet enhancement of toxicity has ecological relevance as well. An oil spill can release large amounts of PAHs into the marine environment. Oil spill assessments to date have not included observations of any phototoxic effect on pelagic larvae or juveniles of benthic or epibenthic invertebrates. In this study, larvae and juveniles of the bivalve, Mulinia lateralis and juveniles of the mysid shrimp, Mysidopsis bahia were exposed to individual PAHs, as well as the water accommodated fractions of several petroleum products to verify the ability of this method to detect PAHs in environmental samples, and to determine if phototoxicity is a concern during and after an oil spill. Significant phototoxicity was seen in both single chemical and petroleum product exposures. Swartz`s EPAH model was not applicable to the authors` results. They hoped to show causality but were not fully successful due to the need to further develop the model with their species and expand the number of PAH analyzed.

  5. Improved tolerance of metals in contaminated oyster larvae.


    Weng, Nanyan; Wang, Wen-Xiong


    Environmental stress experienced by parents may make a significant difference in the response of their offspring. However, relevant studies on marine bivalves are very limited especially for the field populations. In the present study, we examined the relative metal tolerance of offspring produced by four natural populations of oyster Crassostrea sikamea that were contaminated by metals to different degrees. We demonstrated that the resistance of oyster offspring to copper and zinc was correlated with the level of metal pollution experienced by the parent oysters. Specifically, the oyster embryo and larvae produced by adult oysters from contaminated sites had a much higher tolerance to metal stress than those from the reference sites. Furthermore, tissue concentration-dependent maternal transfer of Cu and Zn was found in this study, and the metallothionein concentrations in eggs were positively related to the total concentrations of maternally transferred Cu and Zn. Thus, the maternally transferred metals inducing high level of MT synthesis in eggs was one of the possible mechanisms responsible for the enhanced metal tolerance of oyster embryos and larvae from heavily contaminated sites. We concluded that environmental exposure history of adult oysters significantly influenced the ability of their offspring to cope with metal stress. Our findings offered the field evidence of the possible transfer of metal tolerance from adults to offspring in marine bivalves.

  6. Histomorphogenesis of cranial nerves in Huso huso larvae.


    Tavighi, Sherma; Saadatfar, Zohreh; Shojaei, Bahador; Behnam Rassouli, Morteza


    In this study the cranial nerves development of H. huso are explained from 1 to 54-days-old (1, 3, 6, 15, 21 and 54 days). Despite all the researches on fish brain, there are no study on nerves evolution on H. huso during their larvae life. For this research 40 samples of larvae H. huso were obtained (from each age, about six samples were selected). The specimens were maintained in fiberglass tank, then histological samples were taken from tissues and stained with hematoxylin and eosin for general histological studies using light microscope. According to the results, on 1 and 3-days-old, no nerve was observed. The terminal nerve and their dendrites were observed around the nasal cavity and the axons projected to different areas in forebrain especially around olfactory bulb diffusely, on 6-day-old fish. Also, olfactory, optic, oculomotor, trochlear, trigeminal, lateral line and vagus nerves were detected on 6-day-old fish, however two parts of lateral line nerve were separated on 54-day-old. Three nerves, profundus, facial and octaval were observed on 54-day-old, however, up to this age, epiphysial nerve was not observed.

  7. Deep brain photoreceptors control light seeking behavior in zebrafish larvae

    PubMed Central

    Fernandes, António M.; Fero, Kandice; Arrenberg, Aristides B.; Bergeron, Sadie A.; Driever, Wolfgang; Burgess, Harold A.


    Summary Most vertebrates process visual information using elaborately structured photosensory tissues including the eyes and pineal. However there is strong evidence that other tissues can detect and respond to photic stimuli [1, 2, 3]. Many reports suggest that photosensitive elements exist within the brain itself and influence physiology and behavior, however a long standing puzzle has been the identity of the neurons and photoreceptor molecules involved [4, 5]. We tested whether light cues influence behavior in zebrafish larvae through deep brain photosensors. We found that larvae lacking eyes and pineal perform a simple light-seeking behavior triggered by loss of illumination (`dark photokinesis'). Neuroanatomical considerations prompted us to test orthopedia (otpa) deficient fish which showed a profound reduction in dark photokinesis. Using targeted genetic ablations, we narrowed the photosensitive region to neurons in the preoptic area. Neurons in this region express several photoreceptive molecules, but expression of the melanopsin opn4a is selectively lost in otpa mutants, suggesting that opn4a mediates dark photokinesis. Our findings shed light on the identity and function of deep brain photoreceptors and suggest that otpa specifies an ancient population of sensory neurons that mediate behavioral responses to light. PMID:23000151

  8. Iodine accumulation in sea urchin larvae is dependent on peroxide.


    Miller, Ashley E M; Heyland, Andreas


    Iodine has many important biological functions and its concentrations vary with the environment. Recent research has provided novel insights into iodine uptake mechanisms in marine bacteria and kelp through hydrogen peroxide-dependent diffusion (PDD). This mechanism is distinct from sodium-dependent mechanisms known from vertebrates. In vertebrates, iodine accumulates in the thyroid gland by the action of the apical iodide transporter (AIT) and the sodium/iodide symporter (NIS). Neither of these proteins has, thus far, been identified outside of the chordates, and PDD (as an iodine uptake mechanism) has never been studied in animals. Using (125)I as a marker for total iodine influx, we tested iodine uptake via sodium-dependent transport versus PDD in embryos and larvae of the sea urchin Strongylocentrotus purpuratus. We found that iodine uptake in S. purpuratus is largely independent of NIS/AIT. Instead, we found that uptake is dependent on the presence and production of hydrogen peroxide, indicating that sea urchin larvae use PDD as a mechanism for iodine acquisition. Our data, for the first time, provide conclusive evidence for this mechanism in an animal. Furthermore, our data provide preliminary evidence that sodium-dependent iodine uptake via active transporter proteins is a synapomorphy of vertebrates.

  9. Toxic activity of Bacillus sphaericus SSII-1 for mosquito larvae.


    Myers, P; Yousten, A A


    Using larvae of the mosquito Culex pipiens var. quinquefasciatus as a bioassay system, we have verified an earlier proposal that pathogenicity of Bacillus sphaericus SSII-1 is a toxin-mediated rather than an infectious process. Chloroform or ultraviolet-light treatments that decreased the viable count of SSII-1 cells by 4 or 5 logs did not significantly alter the ability of the bacterial cells to kill larvae. Three lines of evidence indicated that toxic activity was not related to sporulation: (i) cells grown in either a complex or a defined medium were toxic at all ages; (ii) when supplemental Mn2+ was excluded from a complex medium, the culture yielded few spores but was of equal toxicity to a culture containing many spores; and (iii) several early blocked oligosporogenous mutants were isolated that had toxic activities comparable to that of the parent. The toxin was shown to be relatively unstable because activity was destroyed by heat and decreased by refrigeration, a freeze-thaw cycle, or two methods of cell breakage. Thin sections of SSII-1 cells did not reveal the presence of any inclusion body that might be related to toxicity.

  10. Otolith geochemistry does not reflect dispersal history of clownfish larvae

    NASA Astrophysics Data System (ADS)

    Berumen, M. L.; Walsh, H. J.; Raventos, N.; Planes, S.; Jones, G. P.; Starczak, V.; Thorrold, S. R.


    Natural geochemical signatures in calcified structures are commonly employed to retrospectively estimate dispersal pathways of larval fish and invertebrates. However, the accuracy of the approach is generally untested due to the absence of individuals with known dispersal histories. We used genetic parentage analysis (genotyping) to divide 110 new recruits of the orange clownfish, Amphiprion percula, from Kimbe Island, Papua New Guinea, into two groups: “self-recruiters” spawned by parents on Kimbe Island and “immigrants” that had dispersed from distant reefs (>10 km away). Analysis of daily increments in sagittal otoliths found no significant difference in PLDs or otolith growth rates between self-recruiting and immigrant larvae. We also quantified otolith Sr/Ca and Ba/Ca ratios during the larval phase using laser ablation inductively coupled plasma mass spectrometry. Again, we found no significant differences in larval profiles of either element between self-recruits and immigrants. Our results highlight the need for caution when interpreting otolith dispersal histories based on natural geochemical tags in the absence of water chemistry data or known-origin larvae with which to test the discriminatory ability of natural tags.

  11. New province record of Rhinagrion for Thailand and description of the larva of R. mima (Odonata: Zygoptera: Philosinidae).


    Novelo-Gutiérrez, Rodolfo; Sites, Robert W; Vitheepradit, Akekawat


    The Oriental damselfly genus Rhinagrion includes 10 known species, but the larva of only R. philippinum has been described in any detail, while the larva of R. viridatum has been well-illustrated and features summarized. The larvae of the other eight species were unknown. Here, the larva of Rhinagrion mima is described and illustrated by supposition, based upon an F0 larva collected in Phetchabun Province in Thailand. It is compared with the larvae of R. philippinum and R. viridatum. This represents the first record of the genus for Phetchabun Province. 

  12. Pineapple juice for digestion of swamp eel viscera for harvesting infective-stage larva of Gnathostoma spp.


    Soogarun, Suphan; Suwansaksri, Jamsai; Wiwanitkit, Viroj


    Third-stage larvae were used as antigen in the diagnosis of gnathostomiasis in Western blot analysis. Normally, the larvae were obtained from digestion of eel's liver (Fluta alba) by the enzyme pepsin. We used pineapple juice (Ananus comosus) instead of enzyme pepsin in harvesting Gnathostoma spinigerum third-stage larvae. The difference in recovered larvae numbers, between pineapple juice and pepsin, were not statistically significantly different (p>0.05). The larvae from pepsin and pineapple juice digestion were cultivated on BME for 7 days; the survival rates were not significantly different (p>0.05). Thus, pineapple juice is another enzyme of choice for recovering Gnathostoma spinigerum third-stage larvae.

  13. Effects of salinity on striped bass eggs and larvae from the Savannah River, Georgia

    USGS Publications Warehouse

    Winger, P.V.; Lasier, P.J.


    Operation of a tide gate installed in the Savannah River by the U.S. Army Corps of Engineers to reduce dredging activities increased salinities upstream in important spawning habitat for striped bass Morone saxatilis. To assess the effects of salinity on survival and growth of striped bass at early life stages, newly fertilized eggs and 48-h-posthatch were exposed to serial dilutions of seawater, with salinities ranging from 0 to 33 permill (g/L) in increments of 3 permill in addition, older larvae (5-d posthatch) were exposed to salinities of 0, 6, 12, 18, and 24 permill. Eggs were exposed until 24 h posthatch, 48-h-posthatch larvae were exposed for 10 d, and 5-d-posthatch larvae were exposed for 6 d. Eggs died within 24 h in salinities greater than 18 permill. Both survival and total length of larvae hatched from eggs exposed to salinities of 15 permill or higher were reduced. Percent mortality and mean total lengths of newly hatched larvae followed the same pattern for each of three sets of salinity regimes (i.e., changes in salinities over time) that striped bass eggs might encounter during passage downstream in the Savannah River. Hardening eggs in freshwater did not increase survival or length of hatched larvae over that shown by eggs hardened in saline water. The 5-d-posthatch larvae were less sensitive to salinity than the 48-h-posthatch larvae. Survival of larvae was negatively con-elated with both salinity and exposure time. For 48-h-posthatch larvae, the 10-d LC50 (the salinity lethal to 50% of the test fish within 10 d) was 10 permill. Probabilities of survival for larval striped bass exposed to different salinities for different amounts of time can be estimated from curves generated from models of survival analysis. Salinities judged to be critical to Savannah River striped bass eggs and larvae are those greater than 9 permill.

  14. An Unprecedented Role Reversal: Ground Beetle Larvae (Coleoptera: Carabidae) Lure Amphibians and Prey upon Them

    PubMed Central

    Wizen, Gil; Gasith, Avital


    Amphibians often feed on beetle larvae, including those of ground beetles (Carabidae). Preliminary reports have detailed an unusual trophic interaction in which, in contrast, larvae of the ground beetle Epomis prey upon juvenile and adult amphibians. While it is known that these larvae feed exclusively on amphibians, how the predator-prey encounter occurs to the advantage of the beetle larvae had been unknown to date. Using laboratory observations and controlled experiments, we recorded the feeding behavior of Epomis larvae, as well as the behavior of their amphibian prey. Here we reveal that larvae of two species of Epomis (E. circumscriptus and E. dejeani) lure their potential predator, taking advantage of the amphibian's predation behavior. The Epomis larva combines a sit-and-wait strategy with unique movements of its antennae and mandibles to draw the attention of the amphibian to the presence of a potential prey. The intensity of this enticement increases with decreasing distance between the larva and the amphibian. When the amphibian attacks, the larva almost always manages to avoid the predator's protracted tongue, exploiting the opportunity to attach itself to the amphibian's body and initiate feeding. Our findings suggest that the trophic interaction between Epomis larvae and amphibians is one of the only natural cases of obligatory predator-prey role reversal. Moreover, this interaction involves a small insect larva that successfully lures and preys on a larger vertebrate. Such role reversal is exceptional in the animal world, extending our perspective of co-evolution in the arms race between predator and prey, and suggesting that counterattack defense behavior has evolved into predator-prey role reversal. PMID:21957480

  15. Host gut microorganisms' cues mediate orientation behaviour in the larva of the parasitoid Mallophora ruficauda.


    Groba, H F; Castelo, M K


    The robber fly Mallophora ruficauda is one of the most important apicultural pests in the Pampas region of Argentina. This species is a parasitoid of scarab beetle larvae. Females lay eggs away from the host, and the larvae perform active search behaviour toward Cyclocephala signaticollis third instar larvae, parasitoid's preferred host. This behaviour is mediated by host-related chemical cues produced in hosts' fermentation chamber. Also, C. signaticollis larvae are attracted to fermentation chamber extracts. As scarab larvae have microbe-rich fermentation chamber, it has been suggested that microorganisms could be involved in the production of these semiochemicals. The aims of this work were first to ascertain the presence of microorganisms in the fermentation chamber of C. signaticollis larvae and second to determine the role of microorganisms in the orientation response of parasitoid and host larvae. We found that microorganisms-free C. signaticollis larvae showed deterioration in their development and did not produce the attractive semiochemicals. Therefore, we isolated fermentation chamber microorganisms of host larvae by means of different cultures media, and then, assayed different microorganisms' stimuli by binary choice tests. We were able to isolate microorganisms and determine that M. ruficauda larvae are attracted to semiochemicals from protein degradation in the fermentation chamber. However, C. signaticollis larvae were not attracted to any semiochemicals associated with microorganisms' activity in the fermentation chamber. Although we were unable to elucidate the exact role of gut microorganisms in host behaviour, we discuss their relevance in parasitoid host-seeking behaviour and host conspecific interaction in M. ruficauda-C. signaticollis system.

  16. Schinus terebinthifolius Leaf Extract Causes Midgut Damage, Interfering with Survival and Development of Aedes aegypti Larvae

    PubMed Central

    Procópio, Thamara Figueiredo; Fernandes, Kenner Morais; Pontual, Emmanuel Viana; Ximenes, Rafael Matos; de Oliveira, Aline Rafaella Cardoso; Souza, Carolina de Santana; Melo, Ana Maria Mendonça de Albuquerque; Navarro, Daniela Maria do Amaral Ferraz; Paiva, Patrícia Maria Guedes; Martins, Gustavo Ferreira; Napoleão, Thiago Henrique


    In this study, a leaf extract from Schinus terebinthifolius was evaluated for effects on survival, development, and midgut of A. aegypti fourth instar larvae (L4), as well as for toxic effect on Artemia salina. Leaf extract was obtained using 0.15 M NaCl and evaluated for phytochemical composition and lectin activity. Early L4 larvae were incubated with the extract (0.3–1.35%, w/v) for 8 days, in presence or absence of food. Polymeric proanthocyanidins, hydrolysable tannins, heterosid and aglycone flavonoids, cinnamic acid derivatives, traces of steroids, and lectin activity were detected in the extract, which killed the larvae at an LC50 of 0.62% (unfed larvae) and 1.03% (fed larvae). Further, the larvae incubated with the extract reacted by eliminating the gut content. No larvae reached the pupal stage in treatments at concentrations between 0.5% and 1.35%, while in the control (fed larvae), 61.7% of individuals emerged as adults. The extract (1.0%) promoted intense disorganization of larval midgut epithelium, including deformation and hypertrophy of cells, disruption of microvilli, and vacuolization of cytoplasms, affecting digestive, enteroendocrine, regenerative, and proliferating cells. In addition, cells with fragmented DNA were observed. Separation of extract components by solid phase extraction revealed that cinnamic acid derivatives and flavonoids are involved in larvicidal effect of the extract, being the first most efficient in a short time after larvae treatment. The lectin present in the extract was isolated, but did not show deleterious effects on larvae. The extract and cinnamic acid derivatives were toxic to A. salina nauplii, while the flavonoids showed low toxicity. S. terebinthifolius leaf extract caused damage to the midgut of A. aegypti larvae, interfering with survival and development. The larvicidal effect of the extract can be attributed to cinnamic acid derivatives and flavonoids. The data obtained using A. salina indicates that caution

  17. Strain- and Genotype-Specific Differences in Virulence of Paenibacillus larvae subsp. larvae, a Bacterial Pathogen Causing American Foulbrood Disease in Honeybees

    PubMed Central

    Genersch, Elke; Ashiralieva, Ainura; Fries, Ingemar


    Virulence variations of Paenibacillus larvae subsp. larvae, the causative agent of American foulbrood disease of honeybees, were investigated by analysis of 16 field isolates of this pathogen, belonging to three previously characterized genotypes, as well as the type strain (ATCC 9545) of P. larvae subsp. larvae, with exposure bioassays. We demonstrated that the strain-specific 50% lethal concentrations varied within an order of magnitude and that differences in amount of time for the pathogen to kill 100% of the infected hosts (LT100) correlated with genotype. One genotype killed rather quickly, with a mean LT100 of 7.8 ± 1.7 days postinfection, while the other genotypes acted more slowly, with mean LT100s of 11.2 ± 0.8 and 11.6 ± 0.6 days postinfection. PMID:16269801

  18. Identification of a New cry1I-Type Gene as a Candidate for Gene Pyramiding in Corn To Control Ostrinia Species Larvae

    PubMed Central

    Zhao, Can; Abdelgaffar, Heba M.; Pan, Hongyu; Song, Fuping


    Pyramiding of diverse cry toxin genes from Bacillus thuringiensis with different modes of action is a desirable strategy to delay the evolution of resistance in the European corn borer (Ostrinia nubilalis). Considering the dependency of susceptibility to Cry toxins on toxin binding to receptors in the midgut of target pests, a diverse mode of action is commonly defined as recognition of unique binding sites in the target insect. In this study, we present a novel cry1Ie toxin gene (cry1Ie2) as a candidate for pyramiding with Cry1Ab or Cry1Fa in corn to control Ostrinia species larvae. The new toxin gene encodes an 81-kDa protein that is processed to a protease-resistant core form of approximately 55 kDa by trypsin digestion. The purified protoxin displayed high toxicity to Ostrinia furnacalis and O. nubilalis larvae but low to no activity against Spodoptera or heliothine species or the coleopteran Tenebrio molitor. Results of binding assays with 125I-labeled Cry1Ab toxin and brush border membrane vesicles from O. nubilalis larvae demonstrated that Cry1Ie2 does not recognize the Cry1Ab binding sites in that insect. Reciprocal competition binding assays with biotin-labeled Cry1Ie2 confirmed the lack of shared sites with Cry1Ab or Cry1Fa in O. nubilalis brush border membrane vesicles. These data support Cry1Ie2 as a good candidate for pyramiding with Cry1Ab or Cry1Fa in corn to increase the control of O. nubilalis and reduce the risk of resistance evolution. PMID:25795679

  19. In vitro development of cyathostomin larvae from the third stage larvae to the fourth stage: morphologic characterization, effects of refrigeration, and species-specific patterns.


    Brianti, Emanuele; Giannetto, Salvatore; Traversa, Donato; Chirgwin, Sharon R; Shakya, Krishna; Klei, Thomas R


    A mixed population of equine cyathostomin (Nematoda, Strongyloidea) infective third stage larvae (L3) was cultured in vitro using a cell-free medium. Some L3 were cultured immediately after Baermann collection from fecal cultures, while others were kept in water at 4 degrees C for 7 days before initiating the in vitro cultures. Cultures were examined daily for viability. At days 2, 7, 14 and 21 larvae were collected for identification of developmental stage and morphological changes, using both light and scanning electron microscopy. Larvae were classified as early L3 (EL3), developing L3 (DL3), late L3 (LL3) and fourth stage larvae (L4) on the basis of morphological features. Viability remained high throughout the entire study period in cultures of both non-refrigerated (84.7%) and refrigerated (77.4%) larvae. However, viability of the non-refrigerated was significantly greater from 7 through 21 days of culture. Significant differences were also observed in the percentage of DL3 between the non-refrigerated and refrigerated larval cultures by day 7. The highest percentage of DL3 larvae (22.5%) was reached at the end of study in those larvae that were not previously refrigerated. The data suggests that prior refrigeration decreases viability and slows L3 development. At day 21 LL3 larvae were only a small percentage of the DL3: 6.9 and 5% in non-refrigerated and refrigerated cultures, respectively. Few of these larvae freed themselves from the L3 cuticle and moulted to L4 stage. Characteristics of individual species in vitro developmental patterns were determined by the molecular identification of individual larvae in pools of larvae randomly collected at days 0 and 21. Seven species (Coronocyclus coronatus, Cylicostephanus goldi, Cylicostephanus longibursatus, Cyathostomum catinatum, Cylicocyclus nassatus, Cylicocyclus ashworthi, Petrovinema poculatum) were identified in the day 0 pool. The greatest tendency to develop in vitro was shown by the genus

  20. Secreted and immunogenic proteins produced by the honey bee bacterial pathogen, Paenibacillus larvae

    Technology Transfer Automated Retrieval System (TEKTRAN)

    American Foulbrood is a severe disease affecting larvae of honeybee Apis mellifera, causing significant decrease in the honeybee population, beekeeping industries and agricultural production. In spite of its importance, little is known about the virulence factors secreted by Paenibacillus larvae dur...

  1. Blood feeding of Ornithodoros turicata larvae using an artificial membrane system

    Technology Transfer Automated Retrieval System (TEKTRAN)

    An artificial membrane system was adapted to feed Ornithodoros turicata larvae from a laboratory colony using defibrinated swine blood. Aspects related to larval feeding and molting to the 1st nymphal instar were evaluated. Fifty-five percent of all larvae exposed to the artificial membrane in two e...

  2. Magnification of tributyl tin toxicity to oyster larvae by bioconcentration in biofilms of Shewanella colwelliana.

    PubMed Central

    Labare, M L; Coon, S L; Matthias, C; Weiner, R M


    The toxic effects of dissolved versus bioconcentrated tributyl tin (TBT) on oyster larvae were compared. Water column TBT levels, which had no effect in solution, inhibited natural attachment and metamorphosis of oyster larvae on bottom surfaces due to bioconcentration by biofilms. This mechanism should be considered when evaluating heavy metal toxicity in the environment. PMID:9327578

  3. Salmonella recovery from broilers and litter following gavage with Salmonella colonized darkling beetles and larvae.

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Transmission of Salmonella to broiler chicks with Salmonella colonized darkling beetles or larvae was evaluated by sampling litter and ceca during growout. In two trials, 1 or 2 day-of-hatch broiler chicks (in a pen of 40) were gavaged with either 4 darkling beetles, 4 beetle larvae, or 0.1 mL pept...

  4. Estimating reproductive success of Aethina tumida (Coleoptera: Nitidulidae) in honey bee colonies by trapping emigrating larvae.


    Arbogast, Richard T; Torto, Baldwyn; Willms, Steve; Fombong, Ayuka T; Duehl, Adrian; Teal, Peter E A


    The small hive beetle (Aethina tumida Murray) is a scavenger and facultative predator in honey bee colonies, where it feeds on pollen, honey, and bee brood. Although a minor problem in its native Africa, it is an invasive pest of honey bees in the United States and Australia. Adult beetles enter bee hives to oviposit and feed. Larval development occurs within the hive, but mature larvae leave the hive to pupate in soil. The numbers leaving, which can be estimated by trapping, measure the reproductive success of adult beetles in the hive over any given period of time. We describe a trap designed to intercept mature larvae as they reach the end of the bottom board on their way to the ground. Trap efficiency was estimated by releasing groups of 100 larvae into empty brood boxes and counting the numbers trapped. Some larvae escaped, but mean efficiency ranged from 87.2 to 94.2%. We envision the trap as a research tool for study of beetle population dynamics, and we used it to track numbers of larvae leaving active hives for pupation in the soil. The traps detected large increases and then decreases in numbers of larvae leaving colonies that weakened and died. They also detected small numbers of larvae leaving strong European and African colonies, even when no larvae were observed in the hives.

  5. Multi-year survival of sugarbeet root maggot (Tetanops myopaeformis) larvae in cold storage

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sugarbeet root maggots (Tetanops myopaeformis), as third-instar larvae have been successfully maintained in cold (6 ± 1ºC) storage for up to six years. To test the hypothesis that this long term survival in storage is facilitated by larvae undergoing prolonged diapause, comparative studies on respir...

  6. Chemical Composition and Food Potential of Pachymerus nucleorum Larvae Parasitizing Acrocomia aculeata Kernels

    PubMed Central

    Alves, Ariana Vieira; Sanjinez Argandoña, Eliana Janet; Linzmeier, Adelita Maria; Cardoso, Claudia Andrea Lima; Macedo, Maria Lígia Rodrigues


    Insect consumption as food is culturally practiced in various regions of the world. In Brazil, there are more than 130 species of edible insects registered, from nine orders, among which stands out the Coleoptera. The larva of the beetle Pachymerus nucleorum Fabricius, 1792, grows into the bocaiuva fruit (Acrocomia aculeata (Jacq.) Lodd. Ex Mart., 1845), which has proven nutritional quality. The aim of this work was to evaluate the nutritional potential of P. nucleorum larvae compared to bocaiuva kernels for human consumption. Proteins were the second largest portion of the larvae nutritional composition (33.13%), with percentage higher than the bocaiuva kernels (14.21%). The larval lipid content (37.87%) was also high, very close to the kernels (44.96%). The fraction corresponding to fatty acids in the oil extracted from the larvae was 40.17% for the saturated and 46.52% for the unsaturated. The antioxidant activity value was 24.3 uM trolox/g of oil extracted from larvae. The larvae tryptic activity was 0.032±0.006 nmol BAPNA/min. Both the larvae and the bocaiuva kernel presented absence of anti-nutritional factors. These results favor the use of P. nucleorum larvae as food, which are a great protein and lipid sources with considerable concentrations of unsaturated fatty acids compared to the bocaiuva kernel. PMID:27031500

  7. Ontogenetic dietary shift in the larvae of Cybister japonicus (Coleoptera: Dytiscidae) in Japanese rice fields.


    Ohba, Shin-Ya


    A number of fragmentary reports suggest that the endangered diving beetle Cybister japonicus larvae feed on tadpoles, fish, and aquatic insects. However, no quantitative study on the feeding habits of C. japonicus larvae has been reported. In this study, field observations and rearing experiments were carried out to show the feeding ecology of C. japonicus larvae. Unlike previous commentaries, the first- and second-instar larvae of C. japonicus preyed on insects, mainly Odonata nymphs and Notonecta triguttata, irrespective of prey availability, but did not eat vertebrates such as tadpoles and fish in the field. On the contrary, the third-instar larvae fed on both insects and vertebrates. Rearing experiments showed that the number of Odonata nymphs consumed was significantly more than the number of tadpoles consumed by the first and second instars but third-instar larvae ate both the Odonata nymphs and tadpoles in the tadpole-Odonata nymph mixture experiment. The total body lengths of C. japonicus new adults in the Odonata nymph and tadpole-Odonata nymph mixture treatments were statistically equal. These results suggested that the first- and second-instar larvae of C. japonicus prey mainly on insects and do not eat vertebrate animals (insectivore), whereas the third-instar larvae fed on both insects and vertebrates (generalist).

  8. Description of the last stadium larva and female of Microgomphus thailandica Asahina, 1981 (Odonata: Gomphidae).


    Boonsoong, Boonsatien; Chainthong, Damrong


    The last stadium larva of Microgomphus thailandica is described, illustrated and compared with the larvae of congeneric species based on reared specimens collected from the Phachi headwater stream, Ratchaburi province, Thailand. The female adult of this species is described for the first time from a reared specimen from the same locality.

  9. Gene expression in honey bee (Apis mellifera) larvae exposed to pesticides and Varroa mites (Varroa destructor).


    Gregorc, Aleš; Evans, Jay D; Scharf, Mike; Ellis, James D


    Honey bee (Apis mellifera) larvae reared in vitro were exposed to one of nine pesticides and/or were challenged with the parasitic mite, Varroa destructor. Total RNA was extracted from individual larvae and first strand cDNAs were generated. Gene-expression changes in larvae were measured using quantitative PCR (qPCR) targeting transcripts for pathogens and genes involved in physiological processes, bee health, immunity, and/or xenobiotic detoxification. Transcript levels for Peptidoglycan Recognition Protein (PGRPSC), a pathogen recognition gene, increased in larvae exposed to Varroa mites (P<0.001) and were not changed in pesticide treated larvae. As expected, Varroa-parasitized brood had higher transcripts of Deformed Wing Virus than did control larvae (P<0.001). Varroa parasitism, arguably coupled with virus infection, resulted in significantly higher transcript abundances for the antimicrobial peptides abaecin, hymenoptaecin, and defensin1. Transcript levels for Prophenoloxidase-activating enzyme (PPOact), an immune end product, were elevated in larvae treated with myclobutanil and chlorothalonil (both are fungicides) (P<0.001). Transcript levels for Hexameric storage protein (Hsp70) were significantly upregulated in imidacloprid, fluvalinate, coumaphos, myclobutanil, and amitraz treated larvae. Definitive impacts of pesticides and Varroa parasitism on honey bee larval gene expression were demonstrated. Interactions between larval treatments and gene expression for the targeted genes are discussed.

  10. The larva of Rhyacophila balcanica Radovanovic 1953 (Trichoptera: Rhyacophilidae) with notes on ecology.


    Karaouzas, Ioannis; Graf, Wolfram; Kučinić, Mladen; Vučković, Ivan; Waringer, Johann


    The previously unknown larva of Rhyacophila balcanica Radovanovic 1953 is described. The diagnostic features of the species are listed and illustrated and some information on its ecology and distribution is included. In addition, diagnostic characters for larvae of the known Greek Rhyacophila species are provided.

  11. The larva of Tricholeon relictus Hölzel & Monserrat, 2002 a synanthropic antlion (Neuroptera, Myrmeleontidae).


    Acevedo, Fernando; Badano, Davide; Monserrat, Víctor J


    The larva of Tricholeon relictus, a Spanish endemic antlion of Afrotropical affinities, is described and illustrated for the first time also providing a comparison with the only other European member of the tribe Dendroleontini, Dendroleon pantherinus. The larva of this species is synanthropic but probably originally lived in cave-like habitats.

  12. A new species of Luchoelmis Spangler & Staines (Coleoptera: Elmidae) from Argentina and its probable larva.


    Archangelsky, Miguel; Brand, Cecilia


    A new species of riffle beetle from southwestern Argentina, Luchoelmis kapenkemkensis, is described. Its diagnostic characters are illustrated and the key for the identification the species of the genus is updated. A larva, very likely belonging to this species, is also described and compared to other related larvae.

  13. Effect of kaolin on fitness and behavior of Choristoneura rosaceana (Lepidoptera: Tortricidae) larvae.


    Sackett, T E; Buddle, C M; Vincent, C


    The mechanisms by which kaolin, a clay particle film formulation, affects the fitness and behavior of larvae of obliquebanded leafroller, Choristoneura rosaceana (Harris), were investigated. Feeding experiments tested kaolin as a physical barrier versus a physiological toxin for larvae that consumed kaolin applied either to apple (Malus spp.) leaves or mixed in artificial diet. Behavioral experiments tested the effects of kaolin applied to apple leaves on neonate dispersal and leaf rolling by third and fourth instars. When larvae fed on apple leaves sprayed with kaolin, mortality and time to pupation of larvae increased significantly, whereas pupal mass significantly decreased. When larvae consumed kaolin mixed into an artificial diet, however, the effects on mortality, pupation time, and pupal mass were negligible. There may be minor physiological effects from consumption because male time to pupation was delayed for larvae fed diets containing the highest concentration of kaolin. In behavioral experiments, neonate larvae dispersed more quickly off plants covered with kaolin than control plants, and kaolin delayed the construction of leaf shelters by third and fourth instars. We showed that the effects of kaolin on C. rosaceana larvae are primarily physical, causing changes in dispersal and rolling behaviors and as a physical barrier to feeding.


    EPA Science Inventory

    As part of EPA’s effort to develop a rapid, in vivo, vertebrate screen for toxic chemicals, we have begun research to characterize the locomotor activity of 6-day post-fertilization (dpf) zebrafish (Danio rerio) larvae. Larvae were individually housed and tested in 96-well micro...

  15. Contest-Behavior of Maize Weevil Larvae when Competing within Seeds

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Food limitation induces severe competition for obligate seed-feeding insect larvae that are unable to leave the seed selected by their mother. The number of eggs laid per seed and the number of larvae hatched from the eggs determine whether larval behavior within the seed will be of the scramble or ...

  16. Notes on the first instar larvae of Ctenophora and Nephrotoma (Diptera, Tipulidae).


    Podeniene, Virginija; Naseviciene, Nijole; Podenas, Sigitas


    1830 egg-larvae of 7 species belonging to long palped crane flies (Tipulidae): Ctenophora guttata Meigen, Nephrotoma pratensis Linnaeus, N. dorsalis Fabricius, N. scurra Meigen, N. flavescens Linnaeus, N. submaculosa Edwards and N. crocata Linnaeus were obtained from 22 females captured in Lithuania in 2011-2012. It took from five days to more than three weeks for eggs to hatch. Crane flies have four instars of larvae. Second, third and the last instar larvae are very similar, when the first instar or egg-larvae differs radically. Descriptions and illustrations of external morphology, chaetotaxy of abdominal segments, characters of head capsules and last abdominal segments are given for the previously unknown first instar larvae of Ct. guttata, N. crocata, N. dorsalis, N. flavescens, N. pratensis, N. scurra and poorly known N. submaculosa. It was found out that difference of head capsule and last abdominal segment among the first instar larvae of above mentioned species of genus Nephrotoma are more obvious than in last instar. During this study it was found, that such characters as shape of apical teeth of mandible, shape of basal segment of antenna and number of sensillae, shape of hypostomium and arrangement of sensory structures on labrum, differ among egg-larvae of Nephrotoma. It was found, that pads on frontal part of prothorax and shape of lateral plates of egg-larvae labrum of Nephrotoma differ significantly from that of Ctenophora and could be used as genus separating characters. 

  17. Radiolabeling and autoradiographic tracing of Toxocara canis larvae in male mice

    SciTech Connect

    Wade, S.E.; Georgi, J.R.


    Artificially hatched infective larvae of Toxocara canis were labeled with /sup 75/Se in Medium 199 (Gibco) containing /sup 75/Se-methionine. Male CD-1 mice were infected with radiolabeled larvae by intragastric intubation or by intraperitoneal injection. At intervals of 3-56 days mice were killed and the organs prepared for compressed organ autoradiography. Radioactivity of parasitic larvae showed an exponential decrease with time, reflecting catabolism of label with a biological half life of 26 days (effective half life of 21 days) making possible experiments lasting several months. Total body larva counts, estimated by total body autoradiography, displayed an overall downward trend, but the rate of reduction was probably not constant because no significant positive or negative trends were noted from day 14 onward in the numbers of larvae. The carcass accumulated the greatest number of larvae followed by the central nervous system, liver, and lung in that order. When the numbers of larvae were considered in relationship to the mass of tissue, there were 4 groupings: central nervous system, liver, lung, carcass, and kidney, and genito-urinary organ, pelt, and intestine. No significant difference between intragastric and intraperitoneal administration was observed in the larval distribution after the larvae had left the initial site of deposition.

  18. Chemically mediated group formation in soil-dwelling larvae and pupae of the beetle Trypoxylus dichotomus

    NASA Astrophysics Data System (ADS)

    Kojima, Wataru; Ishikawa, Yukio; Takanashi, Takuma


    Many insects form groups through interactions among individuals, and these are often mediated by chemical, acoustic, or visual cues and signals. In spite of the diversity of soil-dwelling insects, their aggregation behaviour has not been examined as extensively as that of aboveground species. We investigated the aggregation mechanisms of larvae of the Japanese rhinoceros beetle Trypoxylus dichotomus, which live in groups in humus soil. In two-choice laboratory tests, 2nd- and 3rd-instar larvae gathered at conspecific larvae irrespective of the kinship. The ablation of maxillae, which bear chemosensilla, abolished aggregation behaviour. Intact larvae also exhibited aggregation behaviour towards a larval homogenate. These results suggest that larval aggregation is mediated by chemical cues. We also demonstrated that the mature larvae of T. dichotomus built their pupal cells close to a mesh bag containing a conspecific pupal cell, which indicated that larvae utilize chemical cues emanating from these cells to select the pupation site. Thus, the larvae of T. dichotomus may use chemical cues from the conspecifics in two different contexts, i.e. larval aggregation and pupation site selection. Using conspecific cues, larvae may be able to choose suitable locations for foraging or building pupal cells. The results of the present study highlight the importance of chemical information in belowground ecology.

  19. Young and old honey bee (Apis mellifera) larvae differentially prime the developmental maturation of their caregivers

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In eusocial insects daughters rear the offspring of the queen to adulthood. In the honey bee, Apis mellifera, nurses differentially regulate larval nutrition. Among worker-destined larvae, younger instars receive an unrestricted diet paralleling that of queen larvae in protein composition but with r...

  20. The intestinal bacterial community in the food waste-reducing larvae of Hermetia illucens.


    Jeon, Hyunbum; Park, Soyoung; Choi, Jiyoung; Jeong, Gilsang; Lee, Sang-Beom; Choi, Youngcheol; Lee, Sung-Jae


    As it is known that food waste can be reduced by the larvae of Hermetia illucens (Black soldier fly, BSF), the scientific and commercial value of BSF larvae has increased recently. We hypothesised that the ability of catabolic degradation by BSF larvae might be due to intestinal microorganisms. Herein, we analysed the bacterial communities in the gut of BSF larvae by pyrosequencing of extracting intestinal metagenomic DNA from larvae that had been fed three different diets. The 16S rRNA sequencing results produced 9737, 9723 and 5985 PCR products from larval samples fed food waste, cooked rice and calf forage, respectively. A BLAST search using the EzTaxon program showed that the bacterial community in the gut of larvae fed three different diets was mainly composed of the four phyla with dissimilar proportions. Although the composition of the bacterial communities depended on the different nutrient sources, the identified bacterial strains in the gut of BSF larvae represented unique bacterial species that were unlike the intestinal microflora of other insects. Thus, our study analysed the structure of the bacterial communities in the gut of BSF larvae after three different feedings and assessed the application of particular bacteria for the efficient degradation of organic compounds.

  1. Black soldier fly (Diptera: Stratiomyidae) larvae reduce Escherichia coli in dairy manure.


    Liu, Qiaolin; Tomberlin, Jeffery K; Brady, Jeff A; Sanford, Michelle R; Yu, Ziniu


    Escherichia coli labeled with a green fluorescent protein was inoculated into sterile dairy manure at 7.0 log cfu/g. Approximately 125 black soldier fly larvae were placed in manure inoculated and homogenized with E. coli. Manure inoculated with E. coli but without black soldier fly larvae served as the control. For the first experiment, larvae were introduced into 50, 75, 100, or 125 g sterilized dairy manure inoculated and homogenized with E. coli and stored 72 h at 27 degrees C. Black soldier fly larvae significantly reduced E. coli counts in all treatments. However, varying the amount of manure provided the black soldier fly larvae significantly affected their weight gain and their ability to reduce E. coli populations present. For the second experiment, larvae were introduced into 50 g manure inoculated with E. coli and stored for 72 h at 23, 27, 31, or 35 degrees C. Minimal bacterial growth was recorded in the control held at 35 degrees C and was excluded from the analysis. Black soldier fly larvae significantly reduced E. coli counts in manure held at remaining temperatures. Accordingly, temperature significantly influenced the ability of black soldier fly larvae to develop and reduce E. coli counts with greatest suppression occurring at 27 degrees C.


    EPA Science Inventory

    Rana pipiens larvae (96-118 hr old) were exposed to in a flow-through diluter system to five concentrations of fluoranthene for 48 hr. Following the uptake period the exposed larvae were divided into three groups: one for tissue residue analysis, a second for residue analysis fo...

  3. Cold hardiness and supercooling capacity in the overwintering larvae of the codling moth, Cydia pomonella.


    Khani, Abbas; Moharramipour, Saeid


    The codling moth, Cydia pomonella L. (Lepidoptera: Tortricidae), a worldwide apple pest, is classified as a freeze-intolerant organism and one of the most cold-tolerant pests. The objectives of this study were to examine the supercooling point of overwintering and non-diapausing larvae of C. pomonella as an index of its cold hardiness, and to assess larval mortality following 24 h exposure to extreme low temperatures ranging from -5 to -25 degrees C. The mean (+/-SE) supercooling point for feeding larvae (third through fifth instars) was -12.4 +/- 1.1 degrees C. The mean supercooling point for cocooned, non-diapausing larvae (i.e., non-feeding stages) decreased as the days that the arvae were cocooned increased and changed between -15.1 +/- 1.2 degrees C for one to two day cocooned arvae and -19.2 +/- 1.8 degrees C for less than five day cocooned larvae. The mean (+/-SE) supercooling point for other non-feeding stages containing pupae and overwintering larvae were -19.9 +/- 1.0 degrees C and -20.2 +/- 0.2 degrees C, respectively. Mean supercooling points of C. pomonella larvae were significantly lower during the winter months than the summer months, and sex had no effect on the supercooling point of C. pomonella larvae. The mortality of larvae increased significantly after individuals were exposed to temperatures below the mean supercooling point of the population. The supercooling point was a good predictor of cold hardiness.

  4. [Preliminary study of the survival in anaerobiosis of nematode larva Heterodera oryzae (Tylenchida; Heteroderidae)].


    Reversat, G


    Some effects of anaerobiosis in second stage larvae of the nematode Heterodera oryzae have been investigated by means of measurements of survival, oxygen consumption and dry weight. Anaerobiosis induces an oxygen debt in larvae, reduces the consumption of their food reserves and increases their longevity.

  5. Comparison of in vitro methods for the production of Paenibacillus larvae endospores.


    Alvarado, Israel; Elekonich, Michelle M; Abel-Santos, Ernesto; Wing, Helen J


    Paenibacillus larvae endospores are the infectious particles of the honey bee brood disease, American Foulbrood. We demonstrate that our previously published protocol (Alvarado et al., 2013) consistently yields higher numbers and purer preparations of P. larvae endospores, than previously described protocols, regardless of the strain tested (B-3650, B-3554 or B-3685).

  6. Characterization of a monoclonal antibody against infective larvae of Brugia malayi.

    PubMed Central

    Parab, P B; Rajasekariah, G R; Chandrashekar, R; Alkan, S S; Braun, D G; Subrahmanyam, D


    Monoclonal antibodies were produced following immunization of mice with live infective larvae of Brugia malayi. One of these, 46.08.76, is an antibody that promotes adherence of mouse peritoneal macrophages and human peripheral blood leucocytes to the infective larvae of B. malayi and Wuchereria bancrofti, respectively, and kills them. Fresh normal serum, as a source of complement, augments this effect. The same monoclonal antibody conferred 89% protection to jirds (Meriones unguiculatus) against challenge infection of B. malayi stage-three larvae. This monoclonal antibody recognizes antigens of 80,000, 67,000, 52,000 and 36,000 MW proteins present among the antigens of larvae, as detected by an immunoblotting technique. The antibody also reacts with antigens of infective larvae of Litomosoides carinii, Dipetalonema viteae and B. pahangi, but to a smaller extent. Images Figure 1 Figure 2 PMID:3384450

  7. Effects of ocean acidification on the embryos and larvae of red king crab, Paralithodes camtschaticus.


    Christopher Long, W; Swiney, Katherine M; Foy, Robert J


    The effects of the decline in ocean pH, known as ocean acidification, on marine species are not well understood. To test the effects on embryos and larvae of red king crab, Paralithodes camtschaticus, ovigerous crab and their larvae were held in CO2-acidified (pH 7.7) and control (ambient; pH 8.0) seawater during development. Morphometrics, hatch duration, fecundity, survival, mineral content, and condition were measured. Acidified embryos had 4% larger eyes and 5% smaller yolks, while mean hatch duration was 33% longer and female fecundity was unaffected. Acidified embryos also resulted in 4% longer larvae while acidified larvae had lower survival. Calcium content of both larvae and female carapaces after molting increased by 5% and 19%, respectively. Although ocean acidification may increase larval size and calcium content, the implications of this are unclear and decreased survival is likely to harm red king crab populations.

  8. Starvation-Induced Dietary Behaviour in Drosophila melanogaster Larvae and Adults

    PubMed Central

    Ahmad, Muhammad; Chaudhary, Safee Ullah; Afzal, Ahmed Jawaad; Tariq, Muhammad


    Drosophila melanogaster larvae are classified as herbivores and known to feed on non-carnivorous diet under normal conditions. However, when nutritionally challenged these larvae exhibit cannibalistic behaviour by consuming a diet composed of larger conspecifics. Herein, we report that cannibalism in Drosophila larvae is confined not only to scavenging on conspecifics that are larger in size, but also on their eggs. Moreover, such cannibalistic larvae develop as normally as those grown on standard cornmeal medium. When stressed, Drosophila melanogaster larvae can also consume a carnivorous diet derived from carcasses of organisms belonging to diverse taxonomic groups, including Musca domestica, Apis mellifera, and Lycosidae sp. While adults are ill-equipped to devour conspecific carcasses, they selectively oviposit on them and also consume damaged cadavers of conspecifics. Thus, our results suggest that nutritionally stressed Drosophila show distinct as well as unusual feeding behaviours that can be classified as detritivorous, cannibalistic and/or carnivorous. PMID:26399327

  9. [Geostatistical analysis on distribution pattern of the tobacco budworm larva in Enshi, Hubei, China].


    Xia, Peng-Liang; Wang, Rui; Tan, Jun


    Tobacco budworm (Helicoverpa assulta) larvae feed on tobacco leaves (Nicotiana sp.), resulting in significant loss in tobacco production. Geostatistical method was used to analyze H. assulta spatial patterns and dynamics in this paper. The results showed that, H. assulta larvae appeared 40 days after the tobacco plants transplanting, and reached its peak at the early-mature period. The nested spherical and exponential model was the major model for tobacco budworm larva in the field, suggesting its aggregated distribution. The spatial variability C/(C0 + C) was larger than 0.75, which indicated H. assulta larva had wider structural variation and narrower random variation. There was a massive migration of tobacco budworm larva in the fast-growing stage of tobacco. Its quantity became stable after that, especially at the mature stage of tobacco.

  10. Redescription of late-instar larva of Scydmoraphes sparshalli (Denny) Coleoptera: Staphylinidae, Scydmaeninae).


    Jałoszyński, Paweł


    The larva of Scydmoraphes sparshalli is redescribed. This is the first complete description of an immature Scydmoraphes with special focus on the chaetotaxic characters. The larva is unique among Cyrtoscydmini in having three pairs of stemmata, a very long sensory appendage of the antennomere II, mandibles with mesal row of microserrations interrupted by smooth portion of mandibular margin; maxillary mala with asetose apex and a row of very long, modified setae on mesal margin, and extremely elongate maxillary palpomere III and labium. A comparative study of previous descriptions resulted in recognizing a misidentification of a Scydmoraphes larva (the "Typ 2-Larve" of Schmid) as a putative Neuraphes (Pararaphes). The serial homology of chaetotaxic structures in the larva of Scydmoraphes sparshalli is discussed, and comparative notes on the larvae of Scydmoraphes, Neuraphes and Stenichnus are given, with an identification key.

  11. Uncommon Human Urinary Tract Myiasis Due to Psychoda Sp. Larvae, Kashan, Iran: A Case Report

    PubMed Central

    RASTI, Sima; DEHGHANI, Rouhullah; KHALEDI, Hassan NAEIMI; TAKHTFIROOZEH, Sayed Mahdi; CHIMEHI, Elahe


    Contamination of human and animal body tissues with flies’ larvae and diptera cause myiasis. A 26 yr old female patient refers to Kashan Shahid Beheshti Hospital, central Iran because of urogenital infection, pain in the right part of stomach, smelly and reddish vaginal discharge and frequent urination. In the first checking, urine sample was taken. In the sample, active and alive larvae were seen. The live samples were taken to the Environmental Health Department Lab of Kashan University of Medical Sciences in clean glass jars. In the morphological survey, Psychoda sp larvae were identified. In Iran, this study is the first report of this species of larva that causes urinary myiasis. This fly larva is not carnivore or bloodsucker and feeds on bacterial agents. Observance of personal hygiene especially during defecation and urination is essential to prevent contamination of this type of myiasis. PMID:28127350

  12. Ultrastructural characteristics of nurse cell-larva complex of four species of Trichinella in several hosts.


    Sacchi, L; Corona, S; Gajadhar, A A; Pozio, E


    The nurse cell-larva complex of nematodes of the genus Trichinella plays an important role in the survival of the larva in decaying muscles, frequently favouring the transmission of the parasite in extreme environmental conditions. The ultrastructure of the nurse cell-larva complex in muscles from different hosts infected with T. nativa (a walrus and a polar bear), T. spiralis (horses and humans), T. pseudospiralis (a laboratory mouse) and T. papuae (a laboratory mouse) were examined. Analysis with transmission electron microscope showed that the typical nurse cell structure was present in all examined samples, irrespective of the species of larva, of the presence of a collagen capsule, of the age of infection and of the host species, suggesting that there exists a molecular mechanism that in the first stage of larva invasion is similar for encapsulated and non-encapsulated species.

  13. Effects of pesticides on DNA and protein of shrimp larvae Litopenaeus stylirostris of the California Gulf.


    Galindo Reyes, J Guillermo; Leyva, Nancy R; Millan, Olivia A; Lazcano, Guadalupe A


    Recently, diverse pathologies and massive mortalities have been presented in shrimp hatcheries located along the California Gulf; therefore, toxic responses of shrimp larvae were used as biomarkers of pesticide pollution, because in this region intensive agriculture is practiced. Shrimp larvae were exposed to DDT, azinphosmethyl, permethrine, parathion, chlorpyrifos, malathion, endosulfan, and carbaryl, in order to determine LC50, DNA adducts and/or breaks, and total protein in larvae. The results indicate reductions in protein and DNA in larvae exposed to these pesticides, and in those exposed to DDT, breaks and/or adducts were registered. It is possible that pesticide pollution is a cause of these problems, because reduction in protein indicates a decrease in larvae growth rate and DNA breaks or adducts have been related to pathologies and carcinogenesis in many aquatic organisms.

  14. Scanning electron microscope observations of brine shrimp larvae from space shuttle experiments

    NASA Technical Reports Server (NTRS)

    DeBell, L.; Paulsen, A.; Spooner, B.


    Brine shrimp are encysted as gastrula stage embryos, and may remain dehydrated and encysted for years without compromising their viability. This aspect of brine shrimp biology is desirable for studying development of animals during space shuttle flight, as cysts placed aboard a spacecraft may be rehydrated at the convenience of an astronaut, guaranteeing that subsequent brine shrimp development occurs only on orbit and not on the pad during launch delays. Brine shrimp cysts placed in 5 ml syringes were rehydrated with salt water and hatched during a 9 day space shuttle mission. Subsequent larvae developed to the 8th larval stage in the sealed syringes. We studied the morphogenesis of the brine shrimp larvae and found the larvae from the space shuttle experiments similar in rate of growth and extent of development, to larvae grown in sealed syringes on the ground. Extensive differentiation and development of embryos and larvae can occur in a microgravity environment.

  15. Influence of Low Temperature on Rate of Development of Meloidogyne incognita and M. hapla Larvae

    PubMed Central

    Vrain, T. C.; Barker, K. R.; Holtzman, G. I.


    Development of Meloidogyne incognita and M. hapla larvae in clover roots was studied at 20, 16, 12, and 8 C in growth chambers and in the field from fall through spring, in North Carolina. Larvae of both species invaded roots and developed at 20, 16, and 12 C, but not at 8 C. The time necessary to complete the larval stages at each temperature was determined. The minimal temperature for development of M. incognita larvae was 10.08 C and 8.8 C for M. hapla larvae. In the field, soil temperature at 10 cm deep was favorable for development of larvae until the end of November, and again from February on. All stages of the nematodes survived freezing temperatures in the roots. Reproduction of both species was evident in March or Apri1 after inoculation and accumulation of 8,500 to 11,250 degree-hours. PMID:19305832

  16. Sex-specific developmental profiles of juvenile hormone synthesis in honey bee larvae.


    Hartfelder, Klaus; de Oliveira Tozetto, Sibele; Rachinsky, Anna


    Juvenile hormone synthesis in drone larvae of the honey bee was measured by an in vitro radiochemical assay. The developmental profile of corpora allata activity in male larvae showed considerable differences from queen larvae, the presumptive reproductive females, and was comparable to workers, the sterile female morph. Drone and worker larvae, however, differed drastically in the regulation of juvenile hormone biosynthesis, as revealed by the addition of farnesoic acid to the culture medium. This precursor stimulated juvenile hormone synthesis of drone glands nearly eightfold, whereas in worker larvae it is known to lead to an accumulation of methyl farnesoate. The sex-specific differences in endocrine activity indicate a role for juvenile hormone in the expression of genetically determined sexually dimorphic characters during metamorphosis, a role not currently accounted for in models describing endocrine regulation of insect development.

  17. Tracking zebrafish larvae in group – Status and perspectives☆

    PubMed Central

    Martineau, Pierre R.; Mourrain, Philippe


    Video processing is increasingly becoming a standard procedure in zebrafish behavior investigations as it enables higher research throughput and new or better measures. This trend, fostered by the ever increasing performance-to-price ratio of the required recording and processing equipment, should be expected to continue in the foreseeable future, with video-processing based methods permeating more and more experiments and, as a result, expanding the very role of behavioral studies in zebrafish research. To assess whether the routine video tracking of zebrafish larvae directly in the Petri dish is a capability that can be expected in the near future, the key processing concepts are discussed and illustrated on published zebrafish studies when available or other animals when not. PMID:23707495

  18. Pathogenesis of Helicosporidium sp. (Chlorophyta: Trebouxiophyceae) in susceptible noctuid larvae.


    Bläske-Lietze, Verena-Ulrike; Boucias, Drion G


    Helicosporidium sp. is a unique, achlorophyllous green alga that has been reported to infect various insect orders, including Lepidoptera, Diptera, and Coleoptera. The infectious cyst stage is ingested by the host, ruptures in the midgut lumen, and releases a filamentous cell. Histopathological examinations using larvae of a susceptible noctuid host, Spodoptera exigua, showed both cysts and filamentous cells affiliated with the microvillar lining of the midgut epithelium. A considerable proportion of the ingested cysts (22-39%) were recovered in feces collected 24 h after ingestion. A small number of filamentous cells passed the midgut epithelium and entered the hemocoel within 4-24 h after cyst ingestion. After 48 h, vegetative cell stages were detected in the hemolymph, followed by a 4- to 5-day period of increasing multiplication. Cyst differentiation in the colonized hemolymph began 6-7 days after the treatment.

  19. Evaluation of Lethal Giant Larvae as a Schistosomiasis Vaccine Candidate

    PubMed Central

    Cao, Yufan; Qiao, Hongbin; Shi, Yanli; Han, Yu; Liu, Jinming; Li, Hao; Lu, Ke; Lin, Jiaojiao


    Schistosomiasis is a neglected tropical disease of humans, and it is considered to be the second most devastating parasitic disease after malaria. Eggs produced by normally developed female worms are important in the transmission of the parasite, and they responsible for the pathogenesis of schistosomiasis. The tumor suppressor gene lethal giant larvae (lgl) has an essential function in establishing apical-basal cell polarity, cell proliferation, differentiation, and tissue organization. In our earlier study, downregulation of the lgl gene induced a significant reduction in the egg hatching rate of Schistosoma japonicum (Sj) eggs. In this study, the Sjlgl gene was used as a vaccine candidate against schistosomiasis, and vaccination achieved and maintained a stable reduction of the egg hatching rate, which is consistent with previous studies, in addition to reducing the worm burden and liver egg burden in some trials. PMID:27957496

  20. Integrative neuromechanics of crawling in D. melanogaster larvae

    PubMed Central

    Pehlevan, Cengiz; Paoletti, Paolo; Mahadevan, L


    Locomotion in an organism is a consequence of the coupled interaction between brain, body and environment. Motivated by qualitative observations and quantitative perturbations of crawling in Drosophila melanogaster larvae, we construct a minimal integrative mathematical model for its locomotion. Our model couples the excitation-inhibition circuits in the nervous system to force production in the muscles and body movement in a frictional environment, thence linking neural dynamics to body mechanics via sensory feedback in a heterogeneous environment. Our results explain the basic observed phenomenology of crawling with and without proprioception, and elucidate the stabilizing role that proprioception plays in producing a robust crawling phenotype in the presence of biological perturbations. More generally, our approach allows us to make testable predictions on the effect of changing body-environment interactions on crawling, and serves as a step in the development of hierarchical models linking cellular processes to behavior. DOI:

  1. Behavioral analysis of zebrafish larvae swimming in three dimensions

    NASA Astrophysics Data System (ADS)

    Feng, Ruopei; Girdhar, Kiran; Chemla, Yann; Gruebele, Martin


    Behavioral biologists have a strong interest in studying the behavior of larval zebrafish because the limited number of locomotor neurons in larval zebrafish couples with the rich repertoire of movements as a vertebrate animal. Current research uses a priori-selected parameters to describe their movements. Most research also only considers the 2D movements of zebrafish, leaving out the vertical component of their locomotion. Our lab has developed a method to reduce the dimensionality of the locomotion of zebrafish and determine the behavioral space of 2D swimming. We are extending this work to capture 3D locomotion of zebrafish larvae. Here we present our preliminary analysis of the 3D locomotion of zebrafish.

  2. Effective de novo assembly of fish genome using haploid larvae.


    Iwasaki, Yuki; Nishiki, Issei; Nakamura, Yoji; Yasuike, Motoshige; Kai, Wataru; Nomura, Kazuharu; Yoshida, Kazunori; Nomura, Yousuke; Fujiwara, Atushi; Kobayashi, Takanori; Ototake, Mitsuru


    Recent improvements in next-generation sequencing technology have made it possible to do whole genome sequencing, on even non-model eukaryote species with no available reference genomes. However, de novo assembly of diploid genomes is still a big challenge because of allelic variation. The aim of this study was to determine the feasibility of utilizing the genome of haploid fish larvae for de novo assembly of whole-genome sequences. We compared the efficiency of assembly using the haploid genome of yellowtail (Seriola quinqueradiata) with that using the diploid genome obtained from the dam. De novo assembly from the haploid and the diploid sequence reads (100 million reads per each datasets) generated by the Ion Proton sequencer (200 bp) was done under two different assembly algorithms, namely overlap-layout-consensus (OLC) and de Bruijn graph (DBG). This revealed that the assembly of the haploid genome significantly reduced (approximately 22% for OLC, 9% for DBG) the total number of contigs (with longer average and N50 contig lengths) when compared to the diploid genome assembly. The haploid assembly also improved the quality of the scaffolds by reducing the number of regions with unassigned nucleotides (Ns) (total length of Ns; 45,331,916 bp for haploids and 67,724,360 bp for diploids) in OLC-based assemblies. It appears clear that the haploid genome assembly is better because the allelic variation in the diploid genome disrupts the extension of contigs during the assembly process. Our results indicate that utilizing the genome of haploid larvae leads to a significant improvement in the de novo assembly process, thus providing a novel strategy for the construction of reference genomes from non-model diploid organisms such as fish.

  3. Feeding behavior and growth of broiler chicks fed larvae of the darkling beetle, Alphitobius diaperinus.


    Despins, J L; Axtell, R C


    Experiments were conducted to determine the effects of feeding larvae of the darkling beetle (lesser mealworm), Alphitobius diaperinus (Panzer) (Coleoptera: Tenebrionidae) to broiler chicks on chick growth. Chicks readily fed on the larvae and exhibited reduced growth in the absence of other feed. Chicks 3 to 8 d old restricted to a diet of only larvae consumed 1,552 +/- 172 (mean +/- SD) larvae per chick per day and their body weights were significantly less (mean = 84 g) at the end of the 6 d than for chicks on starter feed during the same time. After return to starter feed for 8 d after feeding on larvae for 6 d, the chicks did not compensate for the reduced weight and their body weights were significantly less (mean = 170 g) than for chicks on starter feed for the 14 d. Chicks from age 2 through 9 d were given a choice between broiler starter feed and darkling beetle larvae. The numbers (mean +/- SD) of larvae consumed per chick per day were: 389 +/- 18, 631 +/- 14, 496 +/- 20, and 287 +/- 33, for Days 2 to 3, 4 to 5, 6 to 7, and 8 to 9, respectively. The body weight of chicks feeding on starter feed and larvae was significantly greater than the weight of chicks consuming feed only. In the presence of larvae, the mean feed consumption per chick was less than for chicks provided with only starter feed. The beetle larvae were 68% crude protein and 21% fat (DM basis) and had higher amounts of 18 amino acids than the starter feed.

  4. Can small rare prey be chemically defended? The case for marine larvae

    SciTech Connect

    Lindquist, N.; Hay, M.E.


    Marine larvae are consumed by a wide variety of generalist fishes and particle-feeding invertebrates, but larvae of any particular species probably constitute a small and variable portion of the diet for these consumers. Because virtually all consumers can ingest small quantities of noxious compounds with minimal detrimental effects, it is uncertain that toxic chemicals in larvae could be consumed in quantities sufficient to select for predator recognition and avoidance. Despite this, chemically defended larvae do occur. We show that, at low doses, secondary metabolites (the didemnins) from adults and larvae of the Caribbean tunicate Trididenmum solidum induced vomiting in fish, resulting in rapid learned aversion to the dedemnin-defended food. The particle-feeding anemone Aiptasia pallida did not learn to avoid the chemically defended food. When anemones ingested the chemical equivalent of 15 larvae/d, representing <2% of the mass of their total daily diet, the didemnins in the {open_quotes}larvae{close_quotes} significantly reduced: (1) growth of adults by 82%, (2) combined growth of adults and daughter clones by 76%, (3) production of daughter clones by 44%, and (4) average mass of individual daughter clones by 41%. At higher water temperatures, anemones cloned more rapidly. Significant differences in the number of daughter clones produced between treatment and control anemones occurred after only 4 d at seawater temperatures of 27{degrees}-29{degrees}C vs. 32 d at seawater temperatures of 18{degrees}-21{degrees}C. Consumption of even very small quantities of secondary metabolites can decrease consumer fitness substantially and select for predators that recognize and avoid chemically defended larvae, as do many consumers that co-occur with Trididemnum solidum larvae. This is the first rigorous demonstration that consumption of marine secondary metabolites can decrease consumer fitness when ingested at ecologically realistic doses. 59 refs., 5 figs., 3 tabs.

  5. Impact of ultraviolet-B radiation on planktonic fish larvae: alteration of the osmoregulatory function.


    Sucré, Elliott; Vidussi, Francesca; Mostajir, Behzad; Charmantier, Guy; Lorin-Nebel, Catherine


    Coastal marine ecosystems are submitted to variations of several abiotic and biotic parameters, some of them related to global change. Among them the ultraviolet-B (UV-B) radiation (UVBR: 280-320 nm) may strongly impact planktonic fish larvae. The consequences of an increase of UVBR on the osmoregulatory function of Dicentrarchus labrax larvae have been investigated in this study. In young larvae of D. labrax, as in other teleosts, osmoregulation depends on tegumentary ion transporting cells, or ionocytes, mainly located on the skin of the trunk and of the yolk sac. As early D. labrax larvae passively drift in the top water column, ionocytes are exposed to solar radiation. The effect of UVBR on larval osmoregulation in seawater was evaluated through nanoosmometric measurements of the blood osmolality after exposure to different UV-B treatments. A loss of osmoregulatory capability occured in larvae after 2 days of low (50 μWcm(-2): 4 h L/20 h D) and medium (80 μWcm(-2): 4 h L/20 h D) UVBR exposure. Compared to control larvae kept in the darkness, a significant increase in blood osmolality, abnormal behavior and high mortalities were detected in larvae exposed to UVBR from 2 days on. At the cellular level, an important decrease in abundance of tegumentary ionocytes and mucous cells was observed after 2 days of exposure to UVBR. In the ionocytes, two major osmoeffectors were immunolocalized, the Na+/K(+)-ATPase and the Na+/K+/2Cl- cotransporter. Compared to controls, the fluorescent immunostaining was lower in UVBR-exposed larvae. We hypothesize that the impaired osmoregulation in UVBR-exposed larvae originates from the lower number of tegumentary ionocytes and mucous cells. This alteration of the osmoregulatory function could negatively impact the survival of young larvae at the surface water exposed to UVBR.

  6. Fixed metabolic costs for highly variable rates of protein synthesis in sea urchin embryos and larvae.


    Pace, Douglas A; Manahan, Donal T


    Defining the physiological mechanisms that set metabolic rates and the 'cost of living' is important for understanding the energy costs of development. Embryos and larvae of the sea urchin Lytechinus pictus (Verrill) were used to test hypotheses regarding differential costs of protein synthesis in animals differing in size, rates of protein synthesis, and physiological feeding states. For embryos, the rate of protein synthesis was 0.22+/-0.014 ng protein embryo(-1) h(-1) (mean +/- s.e.m.) and decreased in unfed larvae to an average rate of 0.05+/-0.001 ng protein larva(-1) h(-1). Fed larvae had rates of synthesis that were up to 194 times faster than unfed larvae (9.7+/-0.81 ng protein larva(-1) h(-1)). There was no significant difference, however, in the cost of protein synthesis between these larvae with very different physiological states. Furthermore, the cost of synthesis in the larval stages was also similar to costs measured for blastula and gastrula embryos of 8.4+/-0.99 J mg(-1) protein synthesized. The cost of protein synthesis was obtained using both direct ('inhibitor') and indirect ('correlative') measurements; both methods gave essentially identical results. Protein synthesis accounted for up to 54+/-8% of metabolic rate in embryos. Percent of metabolism accounted for by protein synthesis in larvae was dependent on their physiological feeding state, with protein synthesis accounting for 16+/-4% in unfed larvae and 75+/-11% in fed larvae. This regulation of metabolic rate was due to differential rates of synthesis for a fixed energy cost per unit mass of protein synthesized. The cost of synthesizing a unit of protein did not change with increasing rates of protein synthesis. We conclude that the cost of protein synthesis is independent of the rate of synthesis, developmental stage, size and physiological feeding state during sea urchin development.

  7. Description of the final instar larva of Orthetrum borneense Kimmins, 1936 (Odonata, Libellulidae), using rearing and molecular methods.


    Steinhoff, Philip O M; Butler, Stephen G; Dow, Rory A


    The final instar larva of Orthetrum borneense Kimmins, 1936, is described and figured for the first time based on exuviae from three male and six female larvae collected in Sarawak, Borneo (East Malaysia). It is compared with an early instar larva, which was matched to the adult O. borneense by DNA barcoding, and the known larvae of other species of this genus that occur in the region.

  8. Comments on the biology of Sciodrepoides watsoni watsoni (Spence, 1813) with descriptions of larvae and pupa (Coleoptera: Leiodidae: Cholevinae).


    Kilian, Aleksandra; Mądra, Anna


    The late-instar larva of Sciodrepoides watsoni watsoni is redescribed and the egg, first and second instar and pupa are described for the first time. Immature stages habitus, chaetotaxy, detailed illustrations and details of life cycle are provided. Previous descriptions of larva of S. watsoni are discussed. The structures of larvae of S. watsoni are compared with those of other known larvae of Cholevinae.

  9. Description of the mature larva of Pseudopyrochroa depressa (Pic) (Coleoptera: Pyrochroidae: Pyrochroinae), with comparison to other Taiwanese Pseudopyrochroa.


    Young, Daniel K; Hsiao, Yun


    Field collections and rearing has established an association between the larva and adult of the Taiwanese Pseudopyrochroa depressa. Larvae were collected from beneath bark of the exposed portions of a dead, decaying log in a mesic montane forest and successfully reared to the adult stage. The mature larva is described and salient features are illustrated and compared to other known pyrochroid larvae from Taiwan. Notes on larval habitats and natural history are also provided.

  10. A chymotrypsin-like proteinase from the midgut of Tenebrio molitor larvae.


    Elpidina, E N; Tsybina, T A; Dunaevsky, Y E; Belozersky, M A; Zhuzhikov, D P; Oppert, B


    A chymotrypsin-like proteinase was isolated from the posterior midgut of larvae of the yellow mealworm, Tenebrio molitor, by ion-exchange and gel filtration chromatography. The enzyme, TmC1, was purified to homogeneity as determined by SDS-PAGE and postelectrophoretic activity detection. TmC1 had a molecular mass of 23.0 kDa, pI of 8.4, a pH optimum of 9.5, and the optimal temperature for activity was 51 degrees C. The proteinase displayed high stability at temperatures below 43 degrees C and in the pH range 6.5-11.2, which is inclusive of the pH of the posterior and middle midgut. The enzyme hydrolyzed long chymotrypsin peptide substrates SucAAPFpNA, SucAAPLpNA and GlpAALpNA and did not hydrolyze short chymotrypsin substrates. Kinetic parameters of the enzymatic reaction demonstrated that the best substrate was SucAAPFpNA, with k(cat app) 36.5 s(-1) and K(m) 1.59 mM. However, the enzyme had a lower K(m) for SucAAPLpNA, 0.5 mM. Phenylmethylsulfonyl fluoride (PMSF) was an effective inhibitor of TmC1, and the proteinase was not inhibited by either tosyl-l-phenylalanine chloromethyl ketone (TPCK) or N(alpha)-tosyl-l-lysine chloromethyl ketone (TLCK). However, the activity of TmC1 was reduced with sulfhydryl reagents. Several plant and insect proteinaceous proteinase inhibitors were active against the purified enzyme, the most effective being Kunitz soybean trypsin inhibitor (STI). The N-terminal sequence of the enzyme was IISGSAASKGQFPWQ, which was up to 67% similar to other insect chymotrypsin-like proteinases and 47% similar to mammalian chymotrypsin A. The amino acid composition of TmC1 differed significantly from previously isolated T. molitor enzymes.

  11. The larva of Aphylla protracta (Hagen, 1859), and a redescription of the larva of A. angustifolia Garrison, 1986 (Odonata: Gomphidae).


    Novelo-Gutiérrez, Rodolfo


    The larva of Aphylla protracta is described and figured. It is characterized by 3rd antennomere subcylindrical, flattened on ventral surface, 4.2 times longer than its widest part. Abdomen with dorsal protuberances well developed on S2-4, reduced on S5, vestigial or absent on S6-9; lateral spines lacking entirely, tergites 5-8 with minute reddish setae, tergite 9 with abundant, small, reddish setae on most of its surface and the whole posterior margin; S10 cylindrical, very long, five times longer than its base, much longer than S6+7+8+9. Also, a redescription and figures of A. angustifolia are provided, and a comparison of both species is made. Mainly differences between both species were found in abdominal dorsal protuberances and the presence/absence of small setae on abdominal tergites.

  12. Biological Role of Paenilarvins, Iturin-Like Lipopeptide Secondary Metabolites Produced by the Honey Bee Pathogen Paenibacillus larvae.


    Hertlein, Gillian; Seiffert, Marlene; Gensel, Sebastian; Garcia-Gonzalez, Eva; Ebeling, Julia; Skobalj, Ranko; Kuthning, Anja; Süssmuth, Roderich D; Genersch, Elke


    The Gram-positive bacterium Paenibacillus larvae (P. larvae) is the causative agent of a deadly honey bee brood disease called American Foulbrood (AFB). AFB is a notifiable epizootic in most countries and, hence, P. larvae is of considerable relevance for veterinarians and apiculturists alike. Over the last decade, much progress has been made in the understanding of the (patho)biology of P. larvae. Recently, several non-ribosomally produced peptides (NRP) and peptide/polyketide (NRP/PK) hybrids produced by P. larvae were identified. Among these NRPs were iturin-like lipopeptides, the paenilarvins A-C. Iturins are known to exhibit strong anti-fungal activity; for some iturins, cytotoxic activity towards mammalian erythrocytes and human cancer cell lines are described. We here present our results on the analysis of the natural function of the paenilarvins during pathogenesis of P. larvae infections. We demonstrated production of paenilarvins in infected larvae. However, we could neither demonstrate cytotoxicity of paenilarvins towards cultured insect cells nor towards larvae in feeding assays. Accordingly, exposure bioassays performed with larvae infected by wild-type P. larvae and a knockout mutant of P. larvae lacking production of paenilarvins did not substantiate a role for the paenilarvins as virulence factor. Further experiments are necessary to analyze the relevance of the paenilarvins' anti-fungal activity for P. larvae infections in the presence of fungal competitors in the larval midgut or cadaver.

  13. Biological Role of Paenilarvins, Iturin-Like Lipopeptide Secondary Metabolites Produced by the Honey Bee Pathogen Paenibacillus larvae

    PubMed Central

    Gensel, Sebastian; Garcia-Gonzalez, Eva; Ebeling, Julia; Skobalj, Ranko; Kuthning, Anja; Süssmuth, Roderich D.


    The Gram-positive bacterium Paenibacillus larvae (P. larvae) is the causative agent of a deadly honey bee brood disease called American Foulbrood (AFB). AFB is a notifiable epizootic in most countries and, hence, P. larvae is of considerable relevance for veterinarians and apiculturists alike. Over the last decade, much progress has been made in the understanding of the (patho)biology of P. larvae. Recently, several non-ribosomally produced peptides (NRP) and peptide/polyketide (NRP/PK) hybrids produced by P. larvae were identified. Among these NRPs were iturin-like lipopeptides, the paenilarvins A-C. Iturins are known to exhibit strong anti-fungal activity; for some iturins, cytotoxic activity towards mammalian erythrocytes and human cancer cell lines are described. We here present our results on the analysis of the natural function of the paenilarvins during pathogenesis of P. larvae infections. We demonstrated production of paenilarvins in infected larvae. However, we could neither demonstrate cytotoxicity of paenilarvins towards cultured insect cells nor towards larvae in feeding assays. Accordingly, exposure bioassays performed with larvae infected by wild-type P. larvae and a knockout mutant of P. larvae lacking production of paenilarvins did not substantiate a role for the paenilarvins as virulence factor. Further experiments are necessary to analyze the relevance of the paenilarvins’ anti-fungal activity for P. larvae infections in the presence of fungal competitors in the larval midgut or cadaver. PMID:27760211

  14. A case of human enteric myiasis due to larvae of Hermetia illucens (Family: Stratiomyiadae): first report in Malaysia.


    Lee, H L; Chandrawathani, P; Wong, W Y; Tharam, S; Lim, W Y


    A case of true enteric myiasis in a 7-year-old girl is reported. Two larvae were obtained from the vomitus of the patient. After processing and identification, the larvae were found to be those of Hermetia illucens (Soldier Fly). This is the first case of true enteric myiasis due to these larvae in Malaysia.

  15. Setting tools for the early assessment of the quality of thawed Pacific oyster (Crassostrea gigas) D-larvae.


    Suquet, M; Le Mercier, A; Rimond, F; Mingant, C; Haffray, P; Labbe, C


    Parameters used to assess the survival of larvae after cryopreservation generally misestimate the damages that prevent larval development. The objectives of the present study were to 1) define the reliability of the survival rate, assessed at 2 and 7 days post fertilization, to estimate Pacific oyster larval quality after thawing, and 2) select complementary tools allowing an early and reliable estimation of their quality. Oyster larvae were reared for 25 h after fertilization at 19 °C and cryopreserved at early D-stage. Then, thawed larvae were incubated in 2-L beakers. At 2 days post fertilization, the survival rate of thawed Pacific oyster larvae was lower than that of fresh larvae for only one experiment (Experiment 3) among the four identical experiments carried out in this work (Experiments 1-4). By contrast, the survival of thawed larvae, as assessed 7 days after fertilization, was lower than that of fresh larvae for the four experiments. These results confirm that the quality of thawed larvae is lower than that of fresh larvae and that the survival rate, estimated 2 days post fertilization, is not adapted to a reliable estimation of the subsequent development ability of thawed larvae. Then, complementary parameters were tested at 2 days: the movement characteristics (Experiments 1 and 2) and the morphologic features (Experiments 3 and 4) of thawed larvae. Compared to values observed on fresh larvae, the percentage of thawed motile larvae was different for only one experiment (Experiment 2) of the two. Compared to control, a reduced Average Path Velocity (VAP) of larvae (determined at the D-larval stage using a CASA-Computer Assisted Sperm Analysis-system) was observed after thawing for both experiments (Experiments 1 and 2), suggesting the ability of larval movement velocity to assess the decrease of the quality of thawed oyster larvae. Using an ASMA (Automated Sperm Morphology Analysis) device, a lower area of thawed larvae was observed, compared to

  16. Plant resistance and its effect on the peritrophic membrane of southwestern corn borer (Lepidoptera: Crambidae) larvae.


    Daves, C A; Williams, W P; Davis, F M; Baker, G T; Ma, P W K; Monroe, W A; Mohan, S


    The southwestern corn borer, Diatraea grandiosella Dyar (Lepidoptera: Crambidae), is a serious pest of corn, Zea mays L., in the southern United States. Corn germplasm lines with conventional genetic leaf-feeding resistance to this pest, the fall armyworm, Spodoptera frugiperda (J.E. Smith), and other lepidopterans have been released to the public by USDA-ARS scientists located in Mississippi. Recent studies suggest the insect resistant lines disrupt the integrity of the peritrophic membrane of the fall armyworm. The objectives of this study were to investigate any morphological differences in the structure of the peritrophic membrane of southwestern corn borer larvae feeding on resistant and susceptible corn hybrids and to quantify the damage. Larvae were reared under field and laboratory conditions on three corn hybrids (two resistant and one susceptible). Scanning electron microscopy was used to examine the peritrophic membrane for abnormalities such as holes or tears and to count the holes or tears in the membrane. Differences in the degree of damage to peritrophic membrane of larvae fed on resistant and susceptible plants were not detected. Up to five distinct layers of the membrane were observed in each larva. Variation in the amounts of damage to the peritrophic membrane observed from larvae feeding on all plant material was high. Plant resistance adversely affects growth and development of southwestern corn borer larvae, and further investigations are needed to explain the role of plant resistance and its relation to peritrophic membrane in southwestern corn borer larvae.

  17. Direct Effects of Microalgae and Protists on Herring (Clupea harengus) Yolk Sac Larvae

    PubMed Central

    Illing, Björn; Moyano, Marta; Niemax, Jan; Peck, Myron A.


    This study investigated effects of microalgae (Rhodomonas baltica) and heterotrophic protists (Oxyrrhis marina) on the daily growth, activity, condition and feeding success of Atlantic herring (Clupea harengus) larvae from hatch, through the end of the endogenous (yolk sac) period. Yolk sac larvae were reared in the presence and absence of microplankton and, each day, groups of larvae were provided access to copepods. Larvae reared with microalgae and protists exhibited precocious (2 days earlier) and ≥ 60% increased feeding incidence on copepods compared to larvae reared in only seawater (SW). In the absence and presence of microalgae and protists, life span and growth trajectories of yolk sac larvae were similar and digestive enzyme activity (trypsin) and nutritional condition (RNA-DNA ratio) markedly declined in all larvae directly after yolk sac depletion. Thus, microplankton promoted early feeding but was not sufficient to alter life span and growth during the yolk sac phase. Given the importance of early feeding, field programs should place greater emphasis on the protozooplankton-ichthyoplankton link to better understand match-mismatch dynamics and bottom-up drivers of year class success in marine fish. PMID:26035592

  18. Spatial and temporal distribution of anopheline larvae in two malarious areas in Sucre State, Venezuela.


    Berti, J; Zimmerman, R; Amarista, J


    The spatial and temporal distribution of anopheline larvae was studied in two coastal malarious areas of Sucre, State, Venezuela. Seven habitat types were sampled in the village of Guayana and eight species of Anopheles were collected. Anopheles aquasalis was the predominant species collected and was most abundant in the brackish marsh habitat (71 larvae per 100 samples). It was most abundant during the rainy season. At the second location, Santa Fé, six habitat types were sampled and four anopheline species were collected. Habitats where An. aquasalis was most abundant were temporary freshwater ponds (34 larvae per 100 samples) and mangroves (10.5 larvae per 100 samples). At this location it was also most abundant in the rainy season. During the dry season it was collected in small numbers in river pools (1.3 larvae per 100 samples) along with large numbers of An. pseudopunctipennis (479 larvae per 100 samples). Larval control could be an important component of the malaria control program because major habitats could be defined and presence and abundance of larvae was limited to specific times of year.

  19. Diet affects the redox system in developing Atlantic cod (Gadus morhua) larvae

    PubMed Central

    Penglase, Samuel; Edvardsen, Rolf B.; Furmanek, Tomasz; Rønnestad, Ivar; Karlsen, Ørjan; van der Meeren, Terje; Hamre, Kristin


    The growth and development of marine fish larvae fed copepods is superior to those fed rotifers, but the underlying molecular reasons for this are unclear. In the following study we compared the effects of such diets on redox regulation pathways during development of Atlantic cod (Gadus morhua) larvae. Cod larvae were fed a control diet of copepods or the typical rotifer/Artemia diet commonly used in commercial marine fish hatcheries, from first feeding until after metamorphosis. The oxidised and reduced glutathione levels, the redox potential, and the mRNA expression of 100 genes in redox system pathways were then compared between treatments during larval development. We found that rotifer/Artemia-fed cod larvae had lower levels of oxidised glutathione, a more reduced redox potential, and altered expression of approximately half of the redox system genes when compared to copepod-fed larvae. This rotifer/Artemia diet-induced differential regulation of the redox system was greatest during periods of suboptimal growth. Upregulation of the oxidative stress response transcription factor, nrf2, and NRF2 target genes in rotifer/Artemia fed larvae suggest this diet induced an NRF2-mediated oxidative stress response. Overall, the data demonstrate that nutritional intake plays a role in regulating the redox system in developing fish larvae. This may be a factor in dietary-induced differences observed in larval growth. PMID:26099546

  20. Differential toxicity to Cd, Pb, and Cu in dragonfly larvae (Insecta: Odonata).


    Tollett, V D; Benvenutti, E L; Deer, L A; Rice, T M


    Odonate larvae are important organisms in aquatic ecosystems but have been rarely studied in laboratory toxicity tests. Only a few previous studies have been conducted on odonates and their responses to heavy metals. We exposed two species of libellulid larvae (Anisoptera: Libellulidae) to equimolar concentrations of cadmium, lead, or copper in 7-day survival tests. Larvae were tolerant of high concentrations of cadmium and lead, as no significant decrease in survival was observed at exposures as high as 0.893 and 2.232 mM, respectively. In contrast, larvae were more sensitive to copper exposure, demonstrating significantly decreased survival to exposures as low as 2.360 microM. In whole animal samples, larvae accumulated very high concentrations (>1000 microg/g dry weight) of all three metals in an exposure-related manner. Much of this accumulation could probably be attributed to adsorption or accumulation of metal within the exoskeleton, because odonate larvae are known to sequester metals into this material. Our results were generally consistent with previous observations indicating that odonates are tolerant to metal exposures, even in comparison with other aquatic invertebrates. However, there are few studies that have used odonates in toxicity tests and compared these organisms to other aquatic life. Based on their abundance and their simple requirements in the laboratory, we believe that odonate larvae can be useful toxicological model organisms.

  1. Initial characterization of receptors for molecules that induce the settlement and metamorphosis of Haliotis rufescens larvae

    SciTech Connect

    Trapido-Rosenthal, H.G.


    Larvae of the marine gastropod mollusc Haliotis refescens are induced to undergo metamorphosis by ..gamma..-aminobutyric acid (GABA) and stereochemically related compounds. The most potent of these inducers is (-)-..beta..-(parachlorophenyl)-GABA (baclofen). The inductive response exhibits positive cooperatively, and is subject to both facilitation (up-regulation) and habituation (down-regulation). Facilitation is brought about by diamino acids such as L-diaminopropionic acid (L-DAPA), and is characterized by decreased Hill coefficients (n/sub H/) and concentration requirements (EC/sub 50/) for inducers. Facilitation does not require the simultaneous presence of facilitating and inducing compounds, and the facilitated state is persistent. Larvae are capable of being up-regulated 2 days before they are capable of undergoing settlement and metamorphosis. Habituation can be brought about by exposure of pre-competent larvae to GABA 4 days prior to the attainment of competence; it is then slowly reversible. Larvae specifically bind tritiated (-)-baclofen in a manner that is saturable with both increasing time of exposure of larvae to, and with increasing concentration of, this compound. Specific binding can be competed for by unlabeled GABA-mimetic inducing molecules; the order of effectiveness of these molecules as competitors for specific binding correlates well with their effectiveness as inducers of metamorphosis. Facilitation of larvae by exposure to diamino acids does not alter their specific binding of tritiated (-)-baclofen. It is concluded from these findings that Haliotis larvae possess receptors for GABA-mimetic compounds.

  2. Colour preference and light sensitivity in trilobite larvae of mangrove horseshoe crab, Carcinoscopius rotundicauda (Latreille, 1802).


    Srijayat, T C; Pradeep, P J; Hassan, A; Chatterji, A; Shaharom, F; Jeffs, Andrew


    The trilobite larvae of C. rotundicauda were tested to determine their colour preference and light sensitivity until their first moulting (25 days post hatching) under laboratory conditions. Maximum congregation size of the trilobite larvae was found in the white zone respectively where (n = 12) followed by yellow (n = 8) and orange (n = 8), which showed the larval preference for lighter zones. Morisita's index calculation showed a clumped/aggregated distribution (yellow, blue, orange and white) and uniform/hyper dispersed distribution (green, red and black) for various colours tested. Trilobite larvae showed least preference for brighter regions while tested in the experiment [black; (n = 4) and red; (n = 5)]. Experiments done to determine the light sensitivity of trilobite larvae showed that the larvae had more preference towards ultraviolet lights. The maximum congregation size of 38.8 and 40.7% of the larvae was encountered under ultraviolet light, when the light sources were kept horizontal and vertical, respectively. Overall, results suggested that the trilobite larvae of C. rotundicauda, preferred light source of shorter wavelengths (UV light) and colours of lighter zone (white, yellow, orange), which might be due to their adaptation to their natural habitat for predator avoidance, prey selection and water quality.

  3. Antigenicity and viability of Anisakis larvae infesting hake heated at different time-temperature conditions.


    Vidacek, Sanja; de las Heras, Cristina; Solas, Maria Teresa; Mendizábal, Angel; Rodriguez-Mahillo, Ana I; Tejada, Margarita


    Heat treatments (40 to 94 degrees Celsius, 30 s to 60 min) were applied to different batches of Anisakis simplex L3 larvae isolated from hake ovaries and viscera to study the effect of heat on the viability of the larvae measured as mobility, emission of fluorescence under UV light, and changes in color after staining with specific dyes, and on A. simplex antigenic proteins. The aim was to determine the lowest time-temperature conditions needed to kill the larvae to avoid anisakiasis in consumers, and to evaluate whether high temperature modifies the antigenicity of A. simplex extracts. Heating at 60 degrees Celsius for 10 min (recommended by some authors) was considered unsafe, as differences in viability between batches were found, with some larvae presenting spontaneous movements in one batch. At higher temperatures (> or = 70 degrees Celsius for > or = 1 min), no movement of the larvae was observed. Antigenic protein Ani s 4 and A. simplex crude antigens were detected in the larvae heated at 94 + or - 1 degrees Celsius for 3 min. This indicates that allergic symptoms could be provoked in previously sensitized consumers, even if the larvae were killed by heat treatment.

  4. Effects of predator hunger and food abundance on prey selection by Chaoborus larvae

    SciTech Connect

    Pastorok, R.A.


    Laboratory experiments on prey selection by Chaoborus larvae show that predator choice as well as differential encounter rates with prey determine the composition of the diet. As the larvae crop and midgut become filled with food during a feeding bout, the predator avoids eating some available Daphnia and specializes on Diaptomus. After 3 days of starvation at 15/sup 0/C, the gut system is empty and Chaoborus attacks prey indiscriminately. Then, daphnids are overrepresented in the diet because the predator encounters them more frequently than copepods of equal size. Daphnia swims about twice as fast as Diaptomus and encounters a stationary electric eye at twice the rate measured for copepods. The strike efficiency of larvae for encountered prey is the same for both species. Since feeding selectivity is inversely proportional to larval hunger state, prey selection varies with the abundance of prey and season. In general, larvae collected during autumn have lower feeding rates and are more selective than larvae collected during summer. When food increases, previously opportunistic larvae may become selective within a few hours; but satiated larvae take several days to relax their preferences under a lowered food regime.

  5. Effects of irradiation on the biology of the infective larvae of Toxocara canis in the mouse

    SciTech Connect

    Barriga, O.O.; Myser, W.C.


    Mice were infected with either 2000 normal or irradiated embryonated eggs of Toxocara canis and the number of larvae in their livers, lungs, brains, and carcasses investigated at 5, 20, and 33 days of infection. Mortality of mice infected with normal eggs was 33% between day 4 and 8 postinfection but there was no mortality among mice infected with irradiated eggs. Irradiation with 60, 90, or 150 kr of X-rays inhibited the migration of larvae from the livers and lungs and their accumulation in brain and carcass in proportion to the irradiation dose. By day 33 of infection, the ratio of larvae in liver and lungs to larvae in brain and carcass was 0.16 in normal mice, 0.42 in 60-kr mice, 0.98 in 90-kr mice, and 23.3 in 150-kr mice. Irradiated larvae, particularly those migrating through the peritoneal cavity, died faster than normal larvae until day 20. Irradiation favored survival after day 20. By days 20 and 33 postinfection the total parasite load was 29% and 8%, respectively, of the administered dose in control mice, 18% and 12% in 60-kr mice, 8% and 4% in 90-kr mice, and 0.9% and 0.3% in 150-kr mice. Irradiation of infective T. canis larvae, then, reduces their pathogenicity, inhibits their migration from liver and lungs, kills some of the parasites during the first 3 weeks of infection, but favors their late survival in the host.

  6. Effects of Toxocara larvae on brain cell survival by in vitro model assessment.


    Heuer, Lea; Haendel, Sabine; Beineke, Andreas; Strube, Christina


    Neuroinvasive larvae of the common dog and cat roundworms, Toxocara canis and Toxocara cati, may cause severe neurological and neuropsychological disturbances in humans. Despite their pathogenic potential and high prevalence worldwide, little is known about their cell-specific influences and cerebral host-pathogen interactions in neurotoxocarosis. To address this discrepancy, a co-culture system of viable larvae with murine neuronal (CAD), oligodendrocytal (BO-1) and microglial (BV-2) cell lines has been established. Additionally, murine adult brain slices have been co-cultured with Toxocara larvae to consider complex organotypic cell-cell interplay. Cytotoxicity of larval presence was measured enzymatically and microscopically. Microscopic evaluation using trypan blue exclusion assay revealed to be less reliable and sensitive than the lactate dehydrogenase activity assay. Ultimately, even low numbers of both T. canis and T. cati larvae have impaired survival of differentiated CAD cells, which morphologically resemble primary neurons. In contrast, viability of oligodendrocytal and microglial cells as well as brain slices was not impaired by larval presence. Therefore, immune-mediated mechanisms or trauma by migrating larvae presumably induce the in vivo pathology rather than acute cytotoxic effects. Conclusively, the helminthic larvae co-culture system presented here is a valuable in vitro tool to study cell-specific effects of parasitic larvae and their products.

  7. Visual attraction in Drosophila larvae develops during a critical period and is modulated by crowding conditions.


    Slepian, Zoe; Sundby, Kelsey; Glier, Sarah; McDaniels, Jennifer; Nystrom, Taylor; Mukherjee, Suvadip; Acton, Scott T; Condron, Barry


    The development of social behavior is poorly understood. Many animals adjust their behavior to environmental conditions based on a social context. Despite having relatively simple visual systems, Drosophila larvae are capable of identifying and are attracted to the movements of other larvae. Here, we show that Drosophila larval visual recognition is encoded by the movements of nearby larvae, experienced during a specific developmental critical period. Exposure to moving larvae, only during a specific period, is sufficient for later visual recognition of movement. Larvae exposed to wild-type body movements, during the critical period, are not attracted to the movements of tubby mutants, which have altered morphology. However, exposure to tubby, during the critical period, results in tubby recognition at the expense of wild-type recognition indicating that this is true learning. Visual recognition is not learned in excessively crowded conditions, and this is emulated by exposure, during the critical period, to food previously used by crowded larvae. We propose that Drosophila larvae have a distinct critical period, during which they assess both social and resource conditions, and that this irreversibly determines later visually guided social behavior. This model provides a platform towards understanding the regulation and development of social behavior.

  8. Effects of Cry1Ab-expressing corn anthers on the movement of monarch butterfly larvae.


    Prasifka, Patricia L; Hellmich, Richard L; Prasifka, Jarrad R; Lewis, Leslie C


    Decreased larval feeding and weight of the monarch butterfly, Danaus plexippus L., have been detected after 4 d of exposure in the laboratory to a high density of Bacillus thuringiensis (Bt)-expressing anthers. One hypothesis is that larvae exposed to Bt anthers exhibit increased wandering, resulting in less feeding and lower weight gain. To test this hypothesis, 2-d-old monarch butterfly larvae exposed to milkweed leaf disks with no anthers, anthers that express Bt (Cry1Ab, event MON810), or other non-Bt anthers were observed using a video-tracking system. As had been shown in previous studies, larvae exposed to Bt anthers fed less and gained less weight than larvae exposed to non-Bt or no anthers, yet there was no evidence of feeding on anthers. Total distance moved, maximum displacement from release point, percentage of time spent moving or near anthers, or mean turn angle did not differ across treatments. However, larvae exposed to Bt anthers spent more time off milkweed leaf disks than those exposed to no anthers and were more likely to move off the leaf than larvae exposed to non-Bt anthers. Results suggest that larvae exposed to Bt anthers behave differently and that ingestion may not be the only way Bt can affect nontarget insects like the monarch butterfly.

  9. Tracking living decapod larvae: mass staining of eggs with neutral red prior to hatching.


    Øresland, V; Horobin, R W


    Mass staining of decapod females carrying eggs, with subsequent identification of hatched larvae in the environment, is a research tool with great potential for field ecologists wishing to track the movements of larvae. For this to be achieved, however, numerous requirements must be met. These include adequate dye solubility, short staining time, dye penetration through different tissues, dye retention within the organism, absence of toxic and behavioral effects, low visibility to predators of stained larvae, no loss of staining owing to preservatives and low cost. The dye, neutral red, appears to meet most of these requirements. This dye was used in aliquots of 0.7 g/770 ml seawater applied to the females of Norway lobster (Nephrops norvegicus) and European lobster (Homarus gammarus) for 10 min. This procedure stained lobster eggs and embryos so that hatched larvae could be distinguished easily by fluorescence microscopy from larvae that hatched from unstained eggs. Stained larvae that were preserved in 4% formaldehyde in seawater were still stained after 1 year. Larvae should not come in contact with ethanol, because it extracts the dye rapidly.

  10. Morphological differentiation of Ixodes persulcatus and I. ricinus hybrid larvae in experiment and under natural conditions.


    Bugmyrin, Sergey V; Belova, Oxana A; Ieshko, Eugeniy P; Bespyatova, Liubov A; Karganova, Galina G


    The objective of the study was detection of hybrid larvae in Ixodes persulcatus and Ixodes ricinus cohabitation sites. To this end, the following three tasks were solved: interspecies crossing of ticks, evaluation of typical morphological signs of the hybrid larvae, and analysis of collected specimens from sites of sympatry. Under experimental conditions, hybrid larvae of I. persulcatus (female) and I. ricinus (male) were obtained that differed from the parental species by the size of setae on the scutum and alloscutum. Discriminant analysis yielded 87.5% classification accuracy for the priory set groups of I. persulcatus, I. ricinus, and hybrids. Of 88 hybrid larvae, 13 (15%) were classified as I. persulcatus and 4 (5%) as I. ricinus. We measured larvae of Ixodes ticks (n=141) collected from small mammals in 1950-1970 in Karelia in cohabitation sites of these species that were previously classified as I. persulcatus or I. ricinus. According to the results of discriminant analysis, 31 larvae (22%) were classified as hybrids with probability p≥0.52; for 10 larvae (7%), the probability of placement to the hybrid group was >0.95.

  11. Reduced cannibalistic behavior of African catfish, Clarias gariepinus, larvae under dark and dim conditions.


    Mukai, Yukinori; Sanudin, Noorsyarinah; Firdaus, Rian Freddie; Saad, Shahbudin


    In general, African catfish shows higher survival rates in the dark conditions than in the light conditions. In this study, larval behavior of African catfish was observed under 0, 0.01, 0.1, 1, 10, and 100 lx using a CCD camera to investigate the reason why African catfish larvae show higher survival rates in dark conditions. The larvae showed significantly higher swimming activity under 0, 0.01, and 0.1 lx than that under 10 and 100 lx. The larvae also showed significantly increased aggressive behavior under 10 and 100 lx; the swimming larvae attacked resting individuals more frequently under 10 and 100 lx than under 0, 0.01, and 0.1 lx. The aggressive behavior and sharp teeth of the attacking larvae appeared to induce skin surface lesions on injured larvae. Chemical substances were then generated from the injured skin surface, and these chemical stimuli triggered cannibalistic behavior in other fish near the injured fish. The results of this study demonstrate that the higher survival rates of African catfish larvae under dark conditions are a result of inactivity and subsequent increase in chemical releasing stimuli concentrations around inactive individuals that triggers feeding behavior in nearby active catfish. Therefore, we recommend larval rearing of African catfish in dark or dim conditions, as it improves catfish survival rates.

  12. Antioxidative responses and bioaccumulation in Japanese flounder larvae and juveniles under chronic mercury exposure.


    Huang, Wei; Cao, Liang; Ye, Zhenjiang; Yin, Xuebo; Dou, Shuozeng


    This study investigated the sub-lethal effects of waterborne mercury on growth, bioaccumulation and antioxidative responses of larvae and juveniles of Japanese flounder (Paralichthys olivaceus). Fish were exposed to 0-10 microg Hg(2)(+)L(-1) solutions from embryonic to the juvenile stages for 80 days. Antioxidative responses to mercury exposure were studied in metamorphosing larvae (18 days post hatching, dph), settling larvae (33 dph) and juveniles (78 dph). Results showed that increasing mercury concentration led to increased mercury bioaccumulation and reduced flounder growth. Of the antioxidants investigated, superoxide dismutase (SOD) and catalase (CAT) activities at the three developmental stages were sensitive to mercury exposure and increased with increasing mercury concentration. Glutathione (GSH) content was elevated in metamorphosing larvae, but decreased in juveniles as mercury concentration increased. Glutathione-S-transferase (GST) activity did not significantly vary with mercury concentration in either larvae or juveniles. Mercury exposure did not affect malondialdehyde (MDA) content of larvae, but significantly increased MDA content of juveniles. Results suggest that flounder larvae and juveniles have the potential to manipulate the levels of antioxidants such as SOD, CAT and GSH, which protect flounder from oxidative stress induced by mercury exposure. These antioxidants could serve as biomarkers of mercury contamination in the aquatic environment.

  13. The evolution of plasticity of dauer larva developmental arrest in the nematode Caenorhabditis elegans

    PubMed Central

    Diaz, S Anaid; Viney, Mark


    Organisms can end up in unfavourable conditions and to survive this they have evolved various strategies. Some organisms, including nematodes, survive unfavourable conditions by undergoing developmental arrest. The model nematode Caenorhabditis elegans has a developmental choice between two larval forms, and it chooses to develop into the arrested dauer larva form in unfavourable conditions (specifically, a lack of food and high population density, indicated by the concentration of a pheromone). Wild C. elegans isolates vary extensively in their dauer larva arrest phenotypes, and this prompts the question of what selective pressures maintain such phenotypic diversity? To investigate this we grew C. elegans in four different environments, consisting of different combinations of cues that can induce dauer larva development: two combinations of food concentration (high and low) in the presence or absence of a dauer larva-inducing pheromone. Five generations of artificial selection of dauer larvae resulted in an overall increase in dauer larva formation in most selection regimes. The presence of pheromone in the environment selected for twice the number of dauer larvae, compared with environments not containing pheromone. Further, only a high food concentration environment containing pheromone increased the plasticity of dauer larva formation. These evolutionary responses also affected the timing of the worms’ reproduction. Overall, these results give an insight into the environments that can select for different plasticities of C. elegans dauer larva arrest phenotypes, suggesting that different combinations of environmental cues can select for the diversity of phenotypically plastic responses seen in C. elegans. PMID:25859338

  14. Gut fluorescence analysis of barnacle larvae: An approach to quantify the ingested food

    NASA Astrophysics Data System (ADS)

    Gaonkar, Chetan A.; Anil, Arga Chandrashekar


    Gut fluorescence analysis can provide a snapshot of ingested food and has been employed in feeding studies of various organisms. In this study we standardised the gut fluorescence method using laboratory-reared barnacle larvae (Balanus amphitrite) fed with mono-algal diet Chaetoceros calcitrans, a unicellular diatom at a cell concentration of 2 × 105 cells ml-1. The gut fluorescence of IV-VI instar nauplii was found to be 370(±12) ng chlorophyll a larva-1 and in faecal pellets it was 224(±63) ng chlorophyll a larva-1. A phaeopigment concentration in larval gut was found to be 311(±13) ng larva-1 and in faecal pellets it was 172(±61) ng larva-1. The study also analysed larval samples collected from the field during different seasons from a tropical environment influenced by monsoons (Dona Paula bay, Goa, west coast of India), with characteristic temporal variations in phytoplankton abundance and diversity. Gut fluorescence of larvae obtained during the post-monsoon season was consistently higher when compared to the pre-monsoon season, suggesting the predominance of autotrophic forms in the larval gut during the post-monsoon season. Whereas, the low gut fluorescence obtained during the pre-monsoon season indicated the ingestion of food sources other than autotrophs. Such differences observed in the feeding behaviour of larvae could be due to differential availability of food for the larvae during different seasons and indicate the capability of larvae to feed on wide range of food sources. This study shows the value of the fluorescence method in feeding studies of planktotrophic organisms and in the evaluation of ecosystem dynamics.

  15. Laboratory studies of cryopreservation of sperm and trochophore larvae of the eastern oyster.


    Paniagua-Chavez, C G; Tiersch, T R


    The eastern oyster, Crassostrea virginica, is the most important cultured oyster species of the Atlantic and Gulf coasts of the United States. Cryopreservation of gametes and larvae of aquatic organisms has increased in importance in recent years. However, studies on the cryopreservation of sperm and larvae of mollusks have focused on the Pacific oyster, Crassostrea gigas. The present study was conducted to improve cryopreservation of sperm and trochophore larvae and to assess fertilizing ability and male-to-male variation of thawed sperm of the eastern oyster. Sperm were diluted in 12 cryoprotectant solutions composed of Hanks' balanced salt solution without calcium and 0, 5, 10, 15, 20, and 25% (v/v) propylene glycol with or without 0.25 M sucrose. Trochophore larvae were suspended in artificial seawater and 10 or 15% propylene glycol (v/v). Sperm or trochophore larvae were placed in 5-mL macrotubes and allowed to equilibrate for 15 min. The macrotubes were cooled in a controlled-rate freezer at a rate of 2.5 degrees C per min until reaching a final temperature of -30 degrees C and were plunged into liquid nitrogen. After storage for 2 weeks, the samples were thawed in a water bath at 70 degrees C for 15 s. Overall, for cryopreservation of sperm and larvae, best results were obtained using 10 or 15% propylene glycol. Thawed sperm presented significant male-to-male variation in fertilizing ability. Survival of thawed larvae decreased as the concentration of larvae per macrotube increased. The procedures developed in this study for sperm and larvae are suitable for production of seedstock in commercial oyster hatcheries.

  16. Feasibility study of biodiesel production using lipids of Hermetia illucens larva fed with organic waste.


    Leong, Siew Yoong; Kutty, Shamsul Rahman Mohamed; Malakahmad, Amirhossein; Tan, Chew Khun


    Hermetia illucens larvae by nature are a decomposer which fed on organic wastes. This study explores the potential of producing biodiesel using lipids from H. illucens larvae. Three types of organic wastes (sewage sludge, fruit waste and palm decanter cake from oil palm mill) were selected based on considerable generation and disposal concern in the area of study as well as lack of investigations as feed for Hermetia illucens larvae in current literatures. Growth rate of the larvae was determined with studying the changes in the biomass per day. H. illucens larvae fed with fruit waste and palm decanter cake have shown growth rates of 0.52±0.02 and 0.23±0.09 g d(-1), respectively. No positive sign of growth were observed in the larvae fed with treated sewage sludge (-0.04±0.01 g d(-1)). Biodiesel as fatty acid methyl ester (FAME) was synthesized by transesterification of the larvae lipid using sulphuric acid as catalyst in methanol. FAME produced was ascertained using ATR-FTIR spectroscopy and GC-MS. The main compositions of fatty acid were found to be C12:0, C16:0 and C18:1n9c. Fatty acid composition of C12:0 fed with fruit waste, sewage sludge and palm decanter was found to be most abundant in the larvae lipid. The amount of C12:0 obtained was 76.13%, 58.31% and 48.06%, respectively. In addition, fatty acid of C16:0 was attained at 16.48% and 25.48% fed with sewage sludge and palm decanter, respectively. Based on the findings, FAME derived from larvae lipids is feasible to be used for biodiesel production.

  17. Variation in brain organization of coral reef fish larvae according to life history traits.


    Lecchini, David; Lecellier, Gael; Lanyon, Rynae Greta; Holles, Sophie; Poucet, Bruno; Duran, Emilio


    In coral reefs, one of the great mysteries of teleost fish ecology is how larvae locate the relatively rare patches of habitat to which they recruit. The recruitment of fish larvae to a reef, after a pelagic phase lasting between 10 and 120 days, depends strongly on larval ability to swim and detect predators, prey and suitable habitat via sensory cues. However, no information is available about the relationship between brain organization in fish larvae and their sensory and swimming abilities at recruitment. For the first time, we explore the structural diversity of brain organization (comparative sizes of brain subdivisions: telencephalon, mesencephalon, cerebellum, vagal lobe and inferior lobe) among larvae of 25 coral reef fish species. We then investigate links between variation in brain organization and life history traits (swimming ability, pelagic larval duration, social behavior, diel activity and cue use relying on sensory perception). After accounting for phylogeny with independent contrasts, we found that brain organization covaried with some life history traits: (1) fish larvae with good swimming ability (>20 cm/s), a long pelagic duration (>30 days), diurnal activity and strong use of cues relying on sensory perception for detection of recruitment habitat had a larger cerebellum than other species. (2) Fish larvae with a short pelagic duration (<30 days) and nocturnal activity had a larger mesencephalon and telencephalon. Lastly, (3) fish larvae exhibiting solitary behavior during their oceanic phase had larger inferior and vagal lobes. Overall, we hypothesize that a well-developed cerebellum may allow fish larvae to improve their chances of successful recruitment after a long pelagic phase in the ocean. Our study is the first one to bring together quantitative information on brain organization and the relative development of major brain subdivisions across coral reef fish larvae, and more specifically to address the way in which this variation

  18. Responses of the metabolism of the larvae of Pocillopora damicornis to ocean acidification and warming.


    Rivest, Emily B; Hofmann, Gretchen E


    Ocean acidification and warming are expected to threaten the persistence of tropical coral reef ecosystems. As coral reefs face multiple stressors, the distribution and abundance of corals will depend on the successful dispersal and settlement of coral larvae under changing environmental conditions. To explore this scenario, we used metabolic rate, at holobiont and molecular levels, as an index for assessing the physiological plasticity of Pocillopora damicornis larvae from this site to conditions of ocean acidity and warming. Larvae were incubated for 6 hours in seawater containing combinations of CO2 concentration (450 and 950 µatm) and temperature (28 and 30°C). Rates of larval oxygen consumption were higher at elevated temperatures. In contrast, high CO2 levels elicited depressed metabolic rates, especially for larvae released later in the spawning period. Rates of citrate synthase, a rate-limiting enzyme in aerobic metabolism, suggested a biochemical limit for increasing oxidative capacity in coral larvae in a warming, acidifying ocean. Biological responses were also compared between larvae released from adult colonies on the same day (cohorts). The metabolic physiology of Pocillopora damicornis larvae varied significantly by day of release. Additionally, we used environmental data collected on a reef in Moorea, French Polynesia to provide information about what adult corals and larvae may currently experience in the field. An autonomous pH sensor provided a continuous time series of pH on the natal fringing reef. In February/March, 2011, pH values averaged 8.075 ± 0.023. Our results suggest that without adaptation or acclimatization, only a portion of naïve Pocillopora damicornis larvae may have suitable metabolic phenotypes for maintaining function and fitness in an end-of-the century ocean.

  19. Responses of the Metabolism of the Larvae of Pocillopora damicornis to Ocean Acidification and Warming

    PubMed Central

    Rivest, Emily B.; Hofmann, Gretchen E.


    Ocean acidification and warming are expected to threaten the persistence of tropical coral reef ecosystems. As coral reefs face multiple stressors, the distribution and abundance of corals will depend on the successful dispersal and settlement of coral larvae under changing environmental conditions. To explore this scenario, we used metabolic rate, at holobiont and molecular levels, as an index for assessing the physiological plasticity of Pocillopora damicornis larvae from this site to conditions of ocean acidity and warming. Larvae were incubated for 6 hours in seawater containing combinations of CO2 concentration (450 and 950 µatm) and temperature (28 and 30°C). Rates of larval oxygen consumption were higher at elevated temperatures. In contrast, high CO2 levels elicited depressed metabolic rates, especially for larvae released later in the spawning period. Rates of citrate synthase, a rate-limiting enzyme in aerobic metabolism, suggested a biochemical limit for increasing oxidative capacity in coral larvae in a warming, acidifying ocean. Biological responses were also compared between larvae released from adult colonies on the same day (cohorts). The metabolic physiology of Pocillopora damicornis larvae varied significantly by day of release. Additionally, we used environmental data collected on a reef in Moorea, French Polynesia to provide information about what adult corals and larvae may currently experience in the field. An autonomous pH sensor provided a continuous time series of pH on the natal fringing reef. In February/March, 2011, pH values averaged 8.075±0.023. Our results suggest that without adaptation or acclimatization, only a portion of naïve Pocillopora damicornis larvae may have suitable metabolic phenotypes for maintaining function and fitness in an end-of-the century ocean. PMID:24769774

  20. In situ localization of heat-shock and histone proteins in honey-bee (Apis mellifera l.) larvae infected with Paenibacillus larvae.


    Gregorc, A; Bowen, I D


    The immunohistochemical localization of the heat shock proteins (Hsp70 and Hsp90) and histone protein in healthy and Paenibacillus larvae infected honeybee (Apis mellifera L.) larvae has been studied. Hsp70 was found in the nuclei and the cytoplasm of infected midgut, salivary gland cells and haemocytes, but not in uninfected larvae. Hsp90 was localized in both infected and uninfected cells. Exposed histone proteins were localized in the nuclei of dying uninfected cells undergoing programmed cell death. The distribution of histone protein in uninfected cells of midgut, salivary gland, and other tissues was nuclear and indicative of normal programmed cell death at levels between 1 and 5%. After applying histone protein antibodies to P. larvae infected honeybee larvae, the DAB based reaction product was located in the nuclei or immediate surroundings of all larval cells. The Hsp70, Hsp90 and histone protein distribution patterns are discussed in relation to the morphological, cytochemical and immunocytochemical characteristics of programmed cell death and pathological necrosis. Results produced by methyl green-pyronin staining confirm an elevation of RNA levels in normal programmed cell death and a reduced staining for RNA in necrotic infected cells.

  1. Visualization of proprioceptors in Drosophila larvae and pupae.


    Halachmi, Naomi; Nachman, Atalya; Salzberg, Adi


    Proprioception is the ability to sense the motion, or position, of body parts by responding to stimuli arising within the body. In fruitflies and other insects proprioception is provided by specialized sensory organs termed chordotonal organs (ChOs). Like many other organs in Drosophila, ChOs develop twice during the life cycle of the fly. First, the larval ChOs develop during embryogenesis. Then, the adult ChOs start to develop in the larval imaginal discs and continue to differentiate during metamorphosis. The development of larval ChOs during embryogenesis has been studied extensively. The centerpiece of each ChO is a sensory unit composed of a neuron and a scolopale cell. The sensory unit is stretched between two types of accessory cells that attach to the cuticle via specialized epidermal attachment cells. When a fly larva moves, the relative displacement of the epidermal attachment cells leads to stretching of the sensory unit and consequent opening of specific transient receptor potential vanilloid (TRPV) channels at the outer segment of the dendrite. The elicited signal is then transferred to the locomotor central pattern generator circuit in the central nervous system. Multiple ChOs have been described in the adult fly. These are located near the joints of the adult fly appendages (legs, wings and halters) and in the thorax and abdomen. In addition, several hundreds of ChOs collectively form the Johnston's organ in the adult antenna that transduce acoustic to mechanical energy. In contrast to the extensive knowledge about the development of ChOs in embryonic stages, very little is known about the morphology of these organs during larval stages. Moreover, with the exception of femoral ChOs and Johnston's organ, our knowledge about the development and structure of ChOs in the adult fly is very fragmentary. Here we describe a method for staining and visualizing ChOs in third instar larvae and pupae. This method can be applied together with genetic tools to

  2. [Assemblages of bloodsucking mosquito larvae (Diptera: Culicidae) in water bodies of the northern Kulunda steppe].


    Belevich, O É; Iurchenko, Iu A


    The population structure of bloodsucking mosquito larvae in temporary and constant water bodies of the northern Kulunda steppe was investigated. The seasonal dynamics of the population density, the number of species in different types of reservoirs, and average density of each species are given. The productivity of water reservoirs in relation to mosquitoes of the family Culicidae is analyzed. The basic factors affecting the distribution of larvae of dominant species between different water bodies were revealed. The degree of correlation between the structure of bloodsucking mosquito larva assemblages and the type of the reservoir was established.

  3. Growth and development of Aedes aegypti larvae at limiting food concentrations.


    Levi, Tal; Ben-Dov, Eitan; Shahi, Preeti; Borovsky, Dov; Zaritsky, Arieh


    Mosquitoes have a complex life-cycle with dramatic changes in shape, function, and habitat. Aedes aegypti was studied by growing individual larvae at different concentrations of a defined rich food source. At higher food concentrations, rate of larval growth was faster, but the time required for 4th instar larvae to molt into the pupal stage was unexpectedly extended. These opposite tendencies resulted in constant times from hatching to pupation and up to adult eclosion at permissive food concentrations. The results demonstrate that nutritional conditions of 4th instar larvae impact initiation of the first metamorphic molt.

  4. Effects of nitrate and ammonium on larvae of Rana temporaria from the Pyrenees.


    Oromí, Neus; Sanuy, Delfí; Vilches, Marcel


    In order to investigate the effects of nitrate and ammonium on the amphibians in a pasture zone of the Catalonian Pyrenees, larvae of Rana temporaria from several ponds were exposed to different concentrations of nitrate (0-500 mg/L) and ammonium (0-1.2 mg/L). High concentrations of nitrate in the water caused mortality and reduced larval size of R. temporaria, whereas no effects on larvae were observed in ammonium conditions. The results suggest that, if the levels of nitrate reach about 100 mg/L, the possibility of survival of R. temporaria larvae may be reduced.

  5. Mature larva of Stenichnus collaris (Müller & Kunze) (Coleoptera: Staphylinidae: Scydmaeninae).


    Jałoszyński, Paweł


    The mature larva of Stenichnus collaris is re-described on the basis of a shed larval skin. This is the first description of an immature Stenichnus identified by rearing to an adult beetle, and not only by collecting the larva in association with adults, as in previously published works. New data on the life history of St. collaris are provided, and possible serial homology of chaetotaxic structures across body segments is discussed. The structures of immature Nearctic St. turbatus, the only Stenichnus larva described with focus on the chaetotaxy, are compared with those of St. collaris and possible homologies are indicated.

  6. The larval habitat of Verrallina (Verrallina) lugubris and chaetotaxy of field-collected larvae.


    Rajavel, A R; Natarajan, R; Munirathinam, A; Vaidyanathan, K


    The larval habitat of Verrallina lugubris (Barraud) is defined based upon collection of 648 larvae from swamp pools from January to March 1998 in Pichavaram mangrove forest, and 125 larvae during September 1997 in Maravakadu mangrove forest in the eastern coast of South India. Salinity of the larval habitat ranged from 12,150 to 24,500 mg/liter in Pichavaram and from 11,600 to 13,000 mg/liter in Maravakadu. Associated mosquito species were Culex sitiens Wiedemann, Ochlerotatus portonovoensis (Tewari and Hiriyan), and Anopheles subpictus Grassi. The chaetotaxy of field-collected larvae of Ve. lugubris is presented.

  7. Effects of soil moisture and temperature on overwintering survival of Curculio larvae (Coleoptera : Curculionidae)

    USGS Publications Warehouse

    Ricca, M.A.; Weckerly, F.W.; Semlitsch, R.D.


    Few studies to date have investigated factors, other than mast crop size, that influence the dynamics of Curculio populations.W e examined the effects of varying levels of soil moisture (0.35, 0.4 and 0.5 g water/g soil) and temperature (8, 14 and 20 C) on over wintering survival of Curculio larvae collected from Quercus michauxii acorns. Survival of larvae, analyzed using log-linear analysis, was adversely affected by soil moisture but not by soil temperature. Larvae that overwinter in drier soil may have higher probabilities of successfully metamorphosing.

  8. Vertical distribution of first stage larvae of the blue crab, Callinectes sapidus, at the mouth of Chesapeake Bay

    NASA Astrophysics Data System (ADS)

    Provenzano, Anthony J.; McConaugha, John R.; Philips, Kathleen B.; Johnson, David F.; Clark, John


    The vertical distribution of stage I blue crab larvae, near the mouth of Chesapeake Bay, was examined over four diurnal cycles. Each of two stations was occupied for 30 hours twice during the summer of 1979. On each of the four cruises, peak larval abundance occurred after a night time high slack tide, suggesting a synchronized hatch of blue crab larvae. 90-99% of all larvae collected were taken in the neuston layer. The apparent timing of the hatches to coincide with the beginning of an ebb tide and the concentration of larvae in the neuston layer strongly suggests seaward transport of these early stage larvae and the probability of offshore development.

  9. Assessment of toxicity test endpoints for freshwater mussel larvae (glochidia).


    Fritts, Andrea K; Barnhart, M Christopher; Bradley, Megan; Liu, Na; Cope, W Gregory; Hammer, Edward; Bringolf, Robert B


    The objectives of the present study were to determine if the viability of freshwater mussel larvae (glochidia) is an ecologically relevant endpoint for toxicity tests and to define the appropriate duration of those tests. The authors assessed 1) how viability (the shell closure response to sodium chloride) compares with infectivity (ability to attach to a host fish and successfully metamorphose to the juvenile stage), and 2) the decline of viability and infectivity over time after glochidia were released from female mussels. Glochidia of 7 mussel species were isolated from females, placed in water, and subsampled daily for 2 d to 5 d. Viability, when ≥90%, was generally a good predictor of infectivity; however, when viability was <90%, infectivity was often disproportionately low, especially for glochidia collected near the end of the brooding period. Viability and infectivity declined more rapidly in natural water and sediment compared to reconstituted water. Following 24-h exposure to a toxicant (sodium chloride or copper), infectivity of the viable glochidia did not differ among concentrations of toxicants. The results indicate that viability is a valid proxy for infectivity and an ecologically relevant endpoint for standard toxicity tests with freshwater mussels for any test duration with control viability >90%.

  10. Phylogenetics of pond and lake lifestyles in Chaoborus midge larvae.


    Berendonk, Thomas U; Barraclough, Timothy G; Barraclough, Jonelle C


    Aquatic invertebrates experience strong trade-offs between habitats due to the selective effects of different predators. Diel vertical migration and small body size are thought to be effective strategies against fish predation in lakes. In the absence of fish in small ponds, migration is ineffective against invertebrate predators and large body size is an advantage. Although widely discussed, this phenomenon has never been tested in a phylogenetic context. We reconstructed a mitochondrial DNA (mtDNA) tree to investigate the phylogenetic distribution of pond and lake lifestyles among 10 species of northern temperate Chaoborus midge larvae. The mtDNA tree is similar to previous morphological trees for Chaoborus, the only difference being the disruption of the subgenus Chaoborus sensu stricto. At least three shifts have occurred between pond and lake lifestyles, each time associated with evolution of diel vertical migration in the lake taxon. The trend in larval body size with habitat type is sensitive to tree and character reconstruction methods, only weakly consistent with the effects of fish predation. Despite long time periods over which adaptation to each habitat type could have occurred, there remains significant phylogenetic heritability in larval body size. The tree provides a framework for comparative studies of the metapopulation genetic consequences of pond and lake lifestyles.

  11. Comparison of RNA isolation methods from insect larvae.


    Ridgeway, J A; Timm, A E


    Isolating RNA from insects is becoming increasingly important in molecular entomology. Four methods including three commercial kits RNeasy Mini Kit (Qiagen), SV Total RNA isolation system (Promega), TRIzol reagent (Invitrogen), and a cetyl trimethylammonium bromide (CTAB)-based method were compared regarding their ability to isolate RNA from whole-body larvae of Thaumatotibia leucotreta (Meyrick), Thanatophilus micans (F.), Plutella xylostella (L.), and Tenebrio molitor (L.). A difference was observed among the four methods regarding RNA quality but not quantity. However, RNA quality and quantity obtained was not dependent on the insect species. The CTAB-based method produced low-quality RNA and the Trizol reagent produced partially degraded RNA, whereas the RNeasy Mini Kit and SV Total RNA isolation system produced RNA of consistently high quality. However, after reverse transcription to cDNA, RNA produced using all four extraction methods could be used to successfully amplify a 708 bp fragment of the cytochrome oxidase I gene. Of the four methods, the SV Total RNA isolation system showed the least amount of DNA contamination with the highest RNA integrity number and is thus recommended for stringent applications where high-quality RNA is required. This is the first comparison of RNA isolation methods among different insect species and the first to compare RNA isolation methods in insects in the last 20 years.

  12. Toxic Effects of Silica Nanoparticles on Zebrafish Embryos and Larvae

    PubMed Central

    Shi, Huiqin; Tian, Linwei; Guo, Caixia; Huang, Peili; Zhou, Xianqing; Peng, Shuangqing; Sun, Zhiwei


    Silica nanoparticles (SiNPs) have been widely used in biomedical and biotechnological applications. Environmental exposure to nanomaterials is inevitable as they become part of our daily life. Therefore, it is necessary to investigate the possible toxic effects of SiNPs exposure. In this study, zebrafish embryos were treated with SiNPs (25, 50, 100, 200 µg/mL) during 4–96 hours post fertilization (hpf). Mortality, hatching rate, malformation and whole-embryo cellular death were detected. We also measured the larval behavior to analyze whether SiNPs had adverse effects on larvae locomotor activity. The results showed that as the exposure dosages increasing, the hatching rate of zebrafish embryos was decreased while the mortality and cell death were increased. Exposure to SiNPs caused embryonic malformations, including pericardial edema, yolk sac edema, tail and head malformation. The larval behavior testing showed that the total swimming distance was decreased in a dose-dependent manner. The lower dose (25 and 50 µg/mL SiNPs) produced substantial hyperactivity while the higher doses (100 and 200 µg/mL SiNPs) elicited remarkably hypoactivity in dark periods. In summary, our data indicated that SiNPs caused embryonic developmental toxicity, resulted in persistent effects on larval behavior. PMID:24058598

  13. Temporal and spatial overlap between monarch larvae and corn pollen.


    Oberhauser, K S; Prysby, M D; Mattila, H R; Stanley-Horn, D E; Sears, M K; Dively, G; Olson, E; Pleasants, J M; Lam, W K; Hellmich, R L


    To assess the likelihood that monarch larvae will be exposed to Bacillus thuringiensis (Bt) pollen, we studied milkweed and monarch densities in habitats which comprise much of the land available to breeding monarchs, e.g., cornfields, cornfield edges, other agricultural fields, and nonagricultural areas, in four regions of the monarch breeding range. We found that monarchs use milkweed in cornfields throughout their breeding season, and that per plant densities are as high or higher in agricultural habitats as in nonagricultural habitats. As a result of the prevalence of agricultural land, most of the monarchs produced in the upper Midwest are likely to originate in cornfields or other agricultural habitats. There was a greater temporal overlap between susceptible monarchs and corn anthesis in the northern than the southern part of the summer breeding range, because of earlier pollen shed in the south. The importance of agricultural habitats to monarch production suggests that, regardless of the impact of genetically modified crops, agricultural practices such as weed control and foliar insecticide use could have large impacts on monarch populations.

  14. Development of Connectivity in a Motoneuronal Network in Drosophila Larvae

    PubMed Central

    Couton, Louise; Mauss, Alex S.; Yunusov, Temur; Diegelmann, Soeren; Evers, Jan Felix; Landgraf, Matthias


    Summary Background Much of our understanding of how neural networks develop is based on studies of sensory systems, revealing often highly stereotyped patterns of connections, particularly as these diverge from the presynaptic terminals of sensory neurons. We know considerably less about the wiring strategies of motor networks, where connections converge onto the dendrites of motoneurons. Here, we investigated patterns of synaptic connections between identified motoneurons with sensory neurons and interneurons in the motor network of the Drosophila larva and how these change as it develops. Results We find that as animals grow, motoneurons increase the number of synapses with existing presynaptic partners. Different motoneurons form characteristic cell-type-specific patterns of connections. At the same time, there is considerable variability in the number of synapses formed on motoneuron dendrites, which contrasts with the stereotypy reported for presynaptic terminals of sensory neurons. Where two motoneurons of the same cell type contact a common interneuron partner, each postsynaptic cell can arrive at a different connectivity outcome. Experimentally changing the positioning of motoneuron dendrites shows that the geography of dendritic arbors in relation to presynaptic partner terminals is an important determinant in shaping patterns of connectivity. Conclusions In the Drosophila larval motor network, the sets of connections that form between identified neurons manifest an unexpected level of variability. Synapse number and the likelihood of forming connections appear to be regulated on a cell-by-cell basis, determined primarily by the postsynaptic dendrites of motoneuron terminals. PMID:25702582

  15. Synergistic activity of Bacillus thuringiensis toxins against Simulium spp. larvae.


    Monnerat, Rose; Pereira, Eleny; Teles, Beatriz; Martins, Erica; Praça, Lilian; Queiroz, Paulo; Soberon, Mario; Bravo, Alejandra; Ramos, Felipe; Soares, Carlos Marcelo


    Species of Simulium spread diseases in humans and animals such as onchocerciasis and mansonelosis, causing health problems and economic loses. One alternative for controlling these insects is the use of Bacillus thuringiensis serovar israelensis (Bti). This bacterium produces different dipteran-active Cry and Cyt toxins and has been widely used in blackfly biological control programs worldwide. Studies on other insect targets have revealed the role of individual Cry and Cyt proteins in toxicity and demonstrated a synergistic effect among them. However, the insecticidal activity and interactions of these proteins against Simulium larvae have not been reported. In this study we demonstrate that Cry4Ba is the most effective toxin followed by Cry4Aa and Cry11Aa. Cry10Aa and Cyt1Aa were not toxic when administered alone but both were able to synergise the activity of Cry4B and Cry11Aa toxins. Cyt1Aa is also able to synergise with Cry4Aa. The mixture of all toxin-producing strains showed the greatest level of synergism, but still lower than the Bti parental strain.

  16. Gag grouper larvae pathways on the West Florida Shelf

    NASA Astrophysics Data System (ADS)

    Weisberg, Robert H.; Zheng, Lianyuan; Peebles, Ernst


    A numerical circulation model, quantitatively assessed against in situ observations, is used to describe the circulation on the West Florida Continental Shelf during spring 2007 when pre-settlement gag (Mycteroperca microlepis) were present in the surf zone near Tampa Bay, Florida. The pre-settlement fish were found to be isotopically distinct from settled juveniles in the area, which is consistent with recent arrival at near shore nursery habitats from offshore spawning grounds. Simulated particle trajectories are employed to test hypotheses relating to either a surface or a near-bottom route of across-shelf transport. The surface-route hypothesis is rejected, whereas the bottom-route hypothesis is found to be consistent with the location of pre-settlement fish and their co-occurrence with macroalgae of offshore, hard-bottom origin. We conclude that gag larvae are transported to the near shore via the bottom Ekman layer and that such transport is facilitated by remote forcing associated with Gulf of Mexico Loop Current interactions with the shelf slope near the Dry Tortugas. Being that such remote forcing occurs inter-annually and not always in phase with the preferred spawning months (late winter through early spring), gag recruitment success should similarly vary with year and location.

  17. Digestive enzymes activity in larvae of Cameraria ohridella (Lepidoptera: Gracillariidae).


    Stygar, Dominika; Dolezych, Bogdan; Nakonieczny, Mirosław; Migula, Pawel; Michalczyk, Katarzyna; Zaak, Maria


    This article presents the activity of carbohydratases and proteases in the midgut of Cameraria ohridella larvae--an oligophagous pest whose preferred feeding is horse chestnuts leaves. Optimal media pH of the assayed enzymes were similar to those of other Lepidopterans. Relatively high amylase activity, as well as maltase and sucrase activities, indicates that starch and sucrose are the main digested saccharides. Trehalase activity was similar to that described in other Lepidopterans. Activities of glycosidases were significantly lower than those of disaccharidases what suggests that neither cellulose nor glycosides are important for C. ohridella. Trypsin is the main endoprotease of this pest. Like in other leaf-eaters carboxypeptidase activity was higher than that of aminopeptidase. The activity of the majority of examined enzymes increased in the following successive pest generations, which could be explained by the decreased nutritional value of older leaves. Probably this phenomenon in hydrolases activity in Cameraria is a nonspecific mechanism present at this stage of co-evolution of the horse chestnut and its pest.

  18. Architecture of the primary taste center of Drosophila melanogaster larvae.


    Colomb, Julien; Grillenzoni, Nicola; Ramaekers, Ariane; Stocker, Reinhard F


    A simple nervous system combined with stereotypic behavioral responses to tastants, together with powerful genetic and molecular tools, have turned Drosophila larvae into a very promising model for studying gustatory coding. Using the Gal4/UAS system and confocal microscopy for visualizing gustatory afferents, we provide a description of the primary taste center in the larval central nervous system. Essentially, gustatory receptor neurons target different areas of the subesophageal ganglion (SOG), depending on their segmental and sensory organ origin. We define two major and two smaller subregions in the SOG. One of the major areas is a target of pharyngeal sensilla, the other one receives inputs from both internal and external sensilla. In addition to such spatial organization of the taste center, circumstantial evidence suggests a subtle functional organization: aversive and attractive stimuli might be processed in the anterior and posterior part of the SOG, respectively. Our results also suggest less coexpression of gustatory receptors than proposed in prior studies. Finally, projections of putative second-order taste neurons seem to cover large areas of the SOG. These neurons may thus receive multiple gustatory inputs. This suggests broad sensitivity of secondary taste neurons, reminiscent of the situation in mammals.

  19. A transcriptomic survey of Migdolus fryanus (sugarcane rhizome borer) larvae.


    Nakayama, Darlan Gonçalves; Santos Júnior, Célio Dias; Kishi, Luciano Takeshi; Pedezzi, Rafael; Santiago, Adelita Carolina; Soares-Costa, Andrea; Henrique-Silva, Flavio


    Sugarcane, a major crop grown in the tropical and subtropical areas of the world, is produced mainly for sucrose, which is used as a sweetener or for the production of bioethanol. Among the numerous pests that significantly affect the yield of sugarcane, the sugarcane rhizome borer (Migdolus fryanus, a cerambycidae beetle) is known to cause severe damage to the crops in Brazil. The absence of molecular information about this insect reinforces the need for studies and an effective method to control this pest. In this study, RNA-Seq technology was employed to study different parts of M. fryanus larvae. The generated data will help in further investigations about the taxonomy, development, and adaptation of this insect. RNA was extracted from six different parts (head, fat body, integument, hindgut, midgut, and foregut) using Trizol methodology. Using Illumina paired-end sequencing technology and the Trinity platform, trimming and de novo assembly was performed, resulting in 44,567 contigs longer than 200 nt for a reunion of data from all transcriptomes, with a mean length of 1,095.27 nt. Transcripts were annotated using BLAST against different protein databanks (Uniprot/Swissprot, PFAM, KEEG, SignalP 4.1, Gene Ontology, and CAZY) and were compared for similarity using a Venn diagram. Differential expression patterns were studied for select genes through qPCR and FPKM comprising important protein families (digestive peptidases, glucosyl hydrolases, serine protease inhibitors and otopetrin), which allowed a better understanding of the insect's digestion, immunity and gravity sensorial mechanisms.

  20. The distribution of dragonfly larvae in a South Carolina stream: relationships with sediment type, body size, and the presence of other larvae.


    Worthen, Wade B; Horacek, Henry Joseph


    Dragonfly larvae were sampled in Little Creek, Greenville, SC. The distributions of five common species were described relative to sediment type, body size, and the presence of other larvae. In total, 337 quadrats (1 m by 0.5 m) were sampled by kick seine. For each quadrat, the substrate was classified as sand, sand-cobble mix, cobble, coarse, or rock, and water depth and distance from bank were measured. Larvae were identified to species, and the lengths of the body, head, and metafemur were measured. Species were distributed differently across sediment types: sanddragons, Progomphus obscurus (Rambur) (Odonata: Gomphidae), were common in sand; twin-spotted spiketails, Cordulegaster maculata Selys (Odonata: Cordulegastridae), preferred a sand-cobble mix; Maine snaketails, Ophiogomphus mainensis Packard (Odonata: Gomphidae), preferred cobble and coarse sediments; fawn darners, Boyeria vinosa (Say) (Odonata: Aeshnidae), preferred coarse sediments; and Eastern least clubtails, Stylogomphus albistylus (Hagen) (Odonata: Gomphidae), preferred coarse and rock sediments. P. obscurus and C. maculata co-occurred more frequently than expected by chance, as did O. mainensis, B. vinosa, and S. albistylus. Mean size varied among species, and species preferences contributed to differences in mean size across sediment types. There were significant negative associations among larval size classes: small larvae (<12 mm) occurred less frequently with large larvae (>15 mm) than expected by chance, and large larvae were alone in quadrats more frequently than other size classes. Species may select habitats at a large scale based on sediment type and their functional morphology, but small scale distributions are consistent with competitive displacement or intraguild predation.

  1. The Distribution of Dragonfly Larvae in a South Carolina Stream: Relationships With Sediment Type, Body Size, and the Presence of Other Larvae

    PubMed Central

    Worthen, Wade B.; Horacek, Henry Joseph


    Dragonfly larvae were sampled in Little Creek, Greenville, SC. The distributions of five common species were described relative to sediment type, body size, and the presence of other larvae. In total, 337 quadrats (1 m by 0.5 m) were sampled by kick seine. For each quadrat, the substrate was classified as sand, sand-cobble mix, cobble, coarse, or rock, and water depth and distance from bank were measured. Larvae were identified to species, and the lengths of the body, head, and metafemur were measured. Species were distributed differently across sediment types: sanddragons, Progomphus obscurus (Rambur) (Odonata: Gomphidae), were common in sand; twin-spotted spiketails, Cordulegaster maculata Selys (Odonata: Cordulegastridae), preferred a sand-cobble mix; Maine snaketails, Ophiogomphus mainensis Packard (Odonata: Gomphidae), preferred cobble and coarse sediments; fawn darners, Boyeria vinosa (Say) (Odonata: Aeshnidae), preferred coarse sediments; and Eastern least clubtails, Stylogomphus albistylus (Hagen) (Odonata: Gomphidae), preferred coarse and rock sediments. P. obscurus and C. maculata co-occurred more frequently than expected by chance, as did O. mainensis, B. vinosa, and S. albistylus. Mean size varied among species, and species preferences contributed to differences in mean size across sediment types. There were significant negative associations among larval size classes: small larvae (<12 mm) occurred less frequently with large larvae (>15 mm) than expected by chance, and large larvae were alone in quadrats more frequently than other size classes. Species may select habitats at a large scale based on sediment type and their functional morphology, but small scale distributions are consistent with competitive displacement or intraguild predation. PMID:25843584

  2. cGMP and NHR Signaling Co-regulate Expression of Insulin-Like Peptides and Developmental Activation of Infective Larvae in Strongyloides stercoralis

    PubMed Central

    Stoltzfus, Jonathan D.; Bart, Stephen M.; Lok, James B.


    The infectious form of the parasitic nematode Strongyloides stercoralis is a developmentally arrested third-stage larva (L3i), which is morphologically similar to the developmentally arrested dauer larva in the free-living nematode Caenorhabditis elegans. We hypothesize that the molecular pathways regulating C. elegans dauer development also control L3i arrest and activation in S. stercoralis. This study aimed to determine the factors that regulate L3i activation, with a focus on G protein-coupled receptor-mediated regulation of cyclic guanosine monophosphate (cGMP) pathway signaling, including its modulation of the insulin/IGF-1-like signaling (IIS) pathway. We found that application of the membrane-permeable cGMP analog 8-bromo-cGMP potently activated development of S. stercoralis L3i, as measured by resumption of feeding, with 85.1±2.2% of L3i feeding in 200 µM 8-bromo-cGMP in comparison to 0.6±0.3% in the buffer diluent. Utilizing RNAseq, we examined L3i stimulated with DMEM, 8-bromo-cGMP, or the DAF-12 nuclear hormone receptor (NHR) ligand Δ7-dafachronic acid (DA)—a signaling pathway downstream of IIS in C. elegans. L3i stimulated with 8-bromo-cGMP up-regulated transcripts of the putative agonistic insulin-like peptide (ILP) -encoding genes Ss-ilp-1 (20-fold) and Ss-ilp-6 (11-fold) in comparison to controls without stimulation. Surprisingly, we found that Δ7-DA similarly modulated transcript levels of ILP-encoding genes. Using the phosphatidylinositol-4,5-bisphosphate 3-kinase inhibitor LY294002, we demonstrated that 400 nM Δ7-DA-mediated activation (93.3±1.1% L3i feeding) can be blocked using this IIS inhibitor at 100 µM (7.6±1.6% L3i feeding). To determine the tissues where promoters of ILP-encoding genes are active, we expressed promoter::egfp reporter constructs in transgenic S. stercoralis post-free-living larvae. Ss-ilp-1 and Ss-ilp-6 promoters are active in the hypodermis and neurons and the Ss-ilp-7 promoter is active in the intestine and a

  3. Capture of white sturgeon larvae downstream of The Dalles Dam, Columbia River, Oregon and Washington, 2012

    USGS Publications Warehouse

    Parsley, Michael J.; Kofoot, Eric


    Wild-spawned white sturgeon (Acipenser transmontanus) larvae captured and reared in aquaculture facilities and subsequently released, are increasingly being used in sturgeon restoration programs in the Columbia River Basin. A reconnaissance study was conducted to determine where to deploy nets to capture white sturgeon larvae downstream of a known white sturgeon spawning area. As a result of the study, 103 white sturgeon larvae and 5 newly hatched free-swimming embryos were captured at 3 of 5 reconnaissance netting sites. The netting, conducted downstream of The Dalles Dam on the Columbia River during June 25–29, 2012, provided information for potentially implementing full-scale collection efforts of large numbers of larvae for rearing in aquaculture facilities and for subsequent release at a larger size in white sturgeon restoration programs.

  4. Early embryogenesis of planaria: a cryptic larva feeding on maternal resources.


    Cardona, Albert; Hartenstein, Volker; Romero, Rafael


    The early planarian embryo presents a complete ciliated epidermis and a pharynx and feeds on maternal yolk cells. In this paper, we report on all the elements involved in the formation of such an autonomous embryo, which we name cryptic larva. First, we provide a description of the spherical and fusiform yolk cells and their relationship with the blastomeres, from the laying of the egg capsule up to their final fate in mid embryonic stages. Then, we describe the early cleavage and the subsequent development of the tissues of the cryptic larva, namely, the primary epidermis, the embryonic pharynx, and a new cell type, the star cells. Finally, we discuss the possibility that the cryptic larva either constitutes a vestigial larva or, more likely, is the evolutionary result of the competition between multiple embryos for the limited and shared maternal resources in the egg capsule.

  5. Identification of Nanopillars on the Cuticle of the Aquatic Larvae of the Drone Fly (Diptera: Syrphidae).


    Hayes, Matthew J; Levine, Timothy P; Wilson, Roger H


    Here, we describe a nano-scale surface structure on the rat-tailed maggot, the aquatic larva of the Drone fly Eristalis tenax(L.). Larvae of this syrphid hover fly live in stagnant, anaerobic water-courses that are rich in organic matter. The larvae burrow into fetid slurry and feed on microorganisms which they filter out from the organic material. This environment is rich in bacteria, fungi and algae with the capacity to form biofilms that might develop on the larval surface and harm them. Using transmission and scanning electron microscopy we have identified an array of slender (typically < 100 nm in diameter) nanopillars that cover the surface of the larvae. The high density and dimensions of these spine-like projections appear to make it difficult for bacteria to colonize the surface of the animal. This may interfere with the formation of biofilms and potentially act as a defence against bacterial infection.

  6. Identification of Nanopillars on the Cuticle of the Aquatic Larvae of the Drone Fly (Diptera: Syrphidae)

    PubMed Central

    Hayes, Matthew J.; Levine, Timothy P.; Wilson, Roger H.


    Here, we describe a nano-scale surface structure on the rat-tailed maggot, the aquatic larva of the Drone fly Eristalis tenax (L.). Larvae of this syrphid hover fly live in stagnant, anaerobic water-courses that are rich in organic matter. The larvae burrow into fetid slurry and feed on microorganisms which they filter out from the organic material. This environment is rich in bacteria, fungi and algae with the capacity to form biofilms that might develop on the larval surface and harm them. Using transmission and scanning electron microscopy we have identified an array of slender (typically < 100 nm in diameter) nanopillars that cover the surface of the larvae. The high density and dimensions of these spine-like projections appear to make it difficult for bacteria to colonize the surface of the animal. This may interfere with the formation of biofilms and potentially act as a defence against bacterial infection. PMID:27030395

  7. Description of the larva of Argia chelata Calvert, 1902 (Odonata: Coenagrionidae).


    Novelo-Gutiérrez, Rodolfo


    The larva of Argia chelata is described and figured. It falls into the group of Argia larvae with a moderately prominent ligula and two palpal seta, but it differs from its closest relatives by having labial palp with 2 setae plus one basal setella; the length of the ligula is 30% of its maximum width; basal tergites (1-5) lacking long, fine setae, mainly on midline; S8-10 mostly dark brown; paraprocts with spiniform setae on basal 0.25 and 0.55 of dorsal and ventral borders, respectively. Larvae were found in 2nd to 4th order shallow streams in cloud forest, crawling among debris, fine sand and mud where the water flow is slow or still, close to the shoreline. The larva is compared with A. lacrimans (Hagen), A. pima Garrison, and A. tonto Calvert, species apparently closely related. 

  8. Description of the larva of Neuraeschna claviforcipata Martin, 1909 (Insecta: Odonata: Aeshnidae).


    De Marmels, Jürg; Neiss, Ulisses Gaspar


    The ultimate stadium larva of Neuraeschna claviforcipata is described and illustrated based on an F-0 exuvia of a reared female from northern Amazonas State, Brazil. This larva differs from the other two known larvae of the genus in lacking the spiny lateral prominence of the mandible, and in having only a short spine each side of the median cleft of the prementum; labium is shorter and cercus longer. Noteworthy is the presence of a hair brush on each occipital lobe behind mesal angle of compound eye. The larva was found in a small blackwater pool with abundant leaf litter in an open, "campina"-type habitat, with sandy soil and low, bushy vegetation.

  9. Effects and mechanisms of Bacillus thuringiensis crystal toxins for mosquito larvae.


    Zhang, Qi; Hua, Gang; Adang, Michael J


    Bacillus thuringiensis is a Gram-positive aerobic bacterium that produces insecticidal crystalline inclusions during sporulation phases of the mother cell. The virulence factor, known as parasporal crystals, is composed of Cry and Cyt toxins. Most Cry toxins display a common 3-domain topology. Cry toxins exert intoxication through toxin activation, receptor binding and pore formation in a suitable larval gut environment. The mosquitocidal toxins of Bt subsp. israelensis (Bti) were found to be highly active against mosquito larvae and are widely used for vector control. Bt subsp. jegathesan is another strain which possesses high potency against broad range of mosquito larvae. The present review summarizes characterized receptors for Cry toxins in mosquito larvae, and will also discuss the diversity and effects of 3-D mosquitocidal Cry toxin and the ongoing research for Cry toxin mechanisms generated from investigations of lepidopteran and dipteran larvae.

  10. Description of the final instar larva of Rhionaeschna vigintipunctata (Ris, 1918) (Odonata: Aeshnidae).


    Rodríguez, José Sebastián; Molineri, Carlos


    The final instar larva of Rhionaeschna vigintipunctata (Ris) (Odonata, Aeshnidae) is described for the first time. The description is based on a series of mature female larvae collected in Tucumán (NW Argentina) and reared to imago. It shares the U-shaped distal excision of epiproct with other larvae of the Marmaraeschna group (only R. pallipes and R. brevicercia known from this stage); but the minute tubercle at each side of the cleft of ligula is absent. Other characters unique to R. vigintipunctata include: open ligula (vs. closed in other "Marmaraeschna"), and mandibular formula. A table to distinguish the larvae of the three species of "Marmaraeschna" and biological and distributional data of R. vigintipunctata are included.

  11. Description of two final stadium Onychogomphus larvae from Thailand (Odonata: Gomphidae).


    Chainthong, Damrong; Boonsoong, Boonsatien


    The final stadium larvae of Onychogomphus castor Lieftinck and O. duaricus Fraser are described and illustrated for the first time based on reared specimens from Thailand. The taxonomic characteristics of the larvae of the genus Onychogomphus are discussed and summarized. The larva of O. castor differs from other Southeast Asian species in having distinct mid-dorsal spines on S2-9, divergent wing pads reaching S5, and lateral spines on S6-9. The larva of O. duaricus has a weakly swollen third antennal segment, with short blunt mid-dorsal spines on S2-9, divergent wing sheaths reaching the middle of S4, and lateral spines present on S7-9.

  12. Draft Genome Sequence of the New Pathogen for Bivalve Larvae Vibrio bivalvicida

    PubMed Central

    Dubert, Javier; Spinard, Edward J.; Gomez-Chiarri, Marta


    Vibrio bivalvicida is a novel pathogen of bivalve larvae responsible for recent vibriosis outbreaks affecting shellfish hatcheries. Here, we announce the draft genome sequence of V. bivalvicida 605T and describe potential virulence factors. PMID:27056224

  13. Evaluation of Metarhizium brunneum F52 (Hypocreales: Clavicipitaceae) for control of Japanese beetle larvae in turfgrass

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Experimental and commercial preparations of Metarhizium brunneum strain F52 were evaluated for control of Japanese beetle Popillia japonica Newman (Coleoptera: Scarbaeidae) larvae (white grubs) in the laboratory and under field conditions. Experimental preparations consisted of granule and liquid f...

  14. Ophthalmomyiasis caused by a Phormia sp. (Diptera: Calliphoridae) larva in an enucleated patient.


    Kim, Jae-Soo; Kim, Jong-Wan; Lee, Hye-Jung; Lee, In-Yong; Oh, Sang-Ah; Seo, Min


    Ophthalmomyiasis rarely occurs worldwide, and has not been reported in Korea. We present here a case of ophthalmomyiasis caused by Phormia sp. fly larva in an enucleated eye of a patient. In June 2010, a 50-year-old man was admitted to Dankook University Hospital for surgical excision of a malignant melanoma located in the right auricular area. He had a clinical history of enucleation of his right eye due to squamous cell carcinoma 5 years ago. During hospitalization, foreign body sensation developed in his right eye, and close examination revealed a fly larva inside the eye, which was evacuated. The larva was proved to be Phormia sp. based on the morphology of the posterior spiracle. Subsequently, no larva was found, and the postoperative course was uneventful without any complaints of further myiasis. This is the first case of ophthalmomyiasis among the literature in Korea, and also the first myiasis case caused by Phormia sp. in Korea.

  15. Toxicity of Thiophenes from Echinops transiliensis (Asteraceae) against Aedes aegypti (Diptera: Culicidae) Larvae

    DTIC Science & Technology


    and 9 (cf. Fig. 1), which exhibit toxicity against the Formosan subterranean termite (Coptotermes formosanus), have been isolated from E...Simulium vittatum) larvae, adult nematodes (Caenorhabditis elegans) [8], and adult termites (C. formosanus) [11], while bithiophenes or

  16. Experimental Susceptibility of Gilthead Sea Bream, Sparus aurata, via Challenge with Anisakis pegreffii Larvae

    PubMed Central

    Marino, Fabio; Lanteri, Giovanni; De Stefano, Carmelo; Costa, Antonella; Gaglio, Gabriella; Macrì, Francesco


    The endoscopic and histopathological findings detected in Sparus aurata experimentally infected with third-stage Anisakis larvae without intermediate host are evaluated and discussed. In six fish, live nematode larvae were introduced by gastroscopy into the stomach. The first observation by endoscope, 15 days after challenge, showed the presence of some larvae at the level of gastric mucosa. An explorative celioscopy, performed 60 days after challenge, showed haemorrhages and/or nodules on the gut of two fishes. Necropsy and histology demonstrated parasites in the context of the tissue changes. The finding of live nematode larvae as well as the evidence of tissue change confirm the experimental susceptibility of gilthead sea bream towards Anisakis. PMID:23957000

  17. [A duplicate staining method for permanent specimen of Trichinella spiralis encapsulated larvae].


    Li, Dan; Yang, Ding; Pi, Ben-Wei; Niu, Li-Na; Zhang, Ying; Wang, Guo-Ying


    With single staining method, Trichinella spiralis encapsulated larvae specimens were fixed with formaldehyde alcohol acetic acid fixative solution, and stained with alcohol borax-carmine staining solution (4% borax solution 100 ml, carmine 1 g, and 70% alcohol 100 ml). With duplicate staining, the encapsulated larvae specimens were fixed with formaldehyde alcohol acetic acid fixative solution, and double stained with alcohol borax carmine staining solution and fast green staining solution (fast green 0.1 g, 95% alcohol 100 ml). The results showed that with single staining, it was not clear-cut between the cyst and muscle cells although the larva was differentiable, while with duplicate staining, the larva, cyst and muscle cells were distinguished more clearly.

  18. A preliminary investigation on the infectivity of Trichinella larvae in traditional preparations of walrus meat.


    Leclair, Daniel; Forbes, Lorry B; Suppa, Sandy; Proulx, Jean-François; Gajadhar, Alvin A


    This study evaluated the infectivity of Trichinella nativa in freshly frozen walrus meat and traditionally aged walrus meat (igunaq) associated with two human outbreaks of trichinellosis in the Canadian Arctic. Trichinella larvae recovered from walrus meat stored at -20 degrees C for up to 20 months remained infective for guinea pigs inoculated with 135 or 716 larval doses. However, none of the 4-5 and 10-month-old igunaq preparations contained infective T. nativa larvae as measured by bioassays using mice and guinea pigs at inoculation doses ranging from 6 to 500 larvae. This indicates that the degradation process that occurred in the field can be sufficient to either kill Trichinella larvae or render them non-infective for mice and guinea pigs. Further research is needed to evaluate the food safety risk of traditional walrus igunaq aged under different field conditions and storage times.

  19. [Description of the last instar larva and pupa of Cryptophlebia cortesi Clarke (Lepidoptera: Tortricidae)].


    Vargas, Héctor A


    A description of the last instar larva and pupa of Cryptophlebia cortesi Clarke, based on specimens collected on yaro, Acacia macracantha Bonpl & Humb ex Willd. (Fabaceae), in the Chaca valley, Primera Región, Chile, is presented.

  20. Mortality through ontogeny of soft-bottom marine invertebrates with planktonic larvae

    NASA Astrophysics Data System (ADS)

    Pedersen, Troels Møller; Hansen, Jørgen L. S.; Josefson, Alf B.; Hansen, Benni W.


    The present survey covers one spawning season of marine benthic invertebrates in a large geographical area, the inner Danish waters, and includes a wide range of habitats with steep salinity and nutrient load gradients. The loss ratios of soft-bottom marine invertebrates from one development stage to the next is calculated based on average abundances of pelagic larvae, benthic post-larvae and adults of Bivalvia, Gastropoda, Polychaeta and Echinodermata, with planktonic development. This gives a rough estimate of the larval and post-larval mortality. Loss ratios between post-larvae stage and adult stage (post-larval mortality) varies from 3:1 to 7:1 (71.2-84.9%) and loss ratios between larvae and post-larvae (larval mortality) and between larvae and adult, ranging from 7:1 to 42:1 (85.2-97.6%) and from 45:1 to 210:1 (97.8-99.5%), respectively. The results show a remarkable unity in loss ratios (mortality) between the mollusc taxa (Bivalvia and Gastropoda) at the phylum/class level. This similarity in loss ratios among the mollusc taxa exhibiting the same developmental pathways suggests that the mortality is governed by the same biotic and abiotic factors. Larval mortality is estimated to range from 0.10 d - 1 to 0.32 d - 1 for Bivalvia and ranging from 0.09 d - 1 to 0.23 d - 1 for Polychaeta. The species loss ratios combined with specific knowledge of the reproduction cycles give estimated loss ratios (mortality) between the post-larvae and the adult stage of 25:1 and 14:1 for the bivalves Abra spp. and Mysella bidentata. For the polychaete Pygospio elegans the loss ratio (larval mortality) between the larvae and the post-larval stage is 154:1 and between the post-larvae and the adult stage 41:1. For Pholoe inornata the loss ratio between post-larvae and adults is 7:1. The present results confirm that the larval stage, metamorphosis and settlement are the critical phase in terms of mortality in the life cycle for Bivalvia. Assuming steady state based on actual

  1. Pupal vibratory signals of a group-living beetle that deter larvae

    PubMed Central

    Kojima, Wataru; Ishikawa, Yukio; Takanashi, Takuma


    Pupae of some insects produce sounds or vibrations, but the function of the sounds/vibrations has not been clarified in most cases. Recently, we found vibratory communication between pupae and larvae of a group-living beetle Trypoxylus dichotoma, which live in humus soil. The vibratory signals produced by pupae were shown to deter approaching larvae, thereby protecting themselves. In the present study, we tested our hypothesis that pupal signals are mimics of vibratory noises associated with foraging of moles, the most common predators of T. dichotoma. Mole vibrations played back in laboratory experiments deterred larval approaches in the same way as pupal signals. These findings suggest that to deter conspecific larvae, pupae of T. dichotoma may have exploited a preexisting response of larvae to predator vibrations by emitting deceptive signals. PMID:22896788

  2. The Larva, ecology and distribution of Tinodes braueri McLachlan, 1878 (Trichoptera: Psychomyiidae)

    PubMed Central



    The hitherto unknown larva of Tinodes braueri McLachlan, 1878, is described and discussed in the context of contemporary Psychomyiidae keys. In addition, zoogeographical and ecological notes are included. PMID:26973366

  3. Expanding the locomotion repertoire of the eigenfish: Study of wildtype zebrafish larva escape response

    NASA Astrophysics Data System (ADS)

    Benitez-Jones, Maria; Girdhar, Kiran; Chemla, Yann; Gruebele, Martin


    The zebrafish larva is a thoroughly studied and an extensively used model for behavioral and biomedical research. The Zebrafish Laboratory at the University of Illinois at Urbana-Champaign has applied a mathematical method to describe quantitatively the larva's swimming behavior. With this method, the 98% of the larva's free-swimming behavior is described by its simplifiedeigen-fish model, which is a linear combination of its three characteristic components, or three eigen-modes. This presentation focuses on the quantification of a different swimming behavior called escape response in wildtype (WT) zebrafish larvae. Although more data is required before assuming certainty in our results, the escape response of the WT was also described up to 98% by three eigen-modes. This REU program is supported by NSF Grant PHY-1062690.

  4. Viviparity of larvae, a new type of development in phoronids (Lophophorata: Phoronida).


    Temereva, E N; Malakhov, V V


    A new type of phoronid development, viviparity of larvae, has been discovered in a new phoronid species that lives as a commensal of digging sand shrimps in Vostok Bay, the Sea of Japan. The embryos develop in the mother's trunk coelom up to the young larva stage. During development, embryos increase in size twice and probably obtain nutriment from the mother's coelomic fluid. Spawning occurs by young larvae, which are released through nephridiopores. The new type of development is described in a phoronid that has a small body size but a high fertility, producing large amounts of extremely small eggs. The combination of viviparity and large number of eggs increases the number of competent larvae that can undergo metamorphosis in the burrows of shrimps.

  5. Host-seeking behavior in larvae of the robber fly Mallophora ruficauda (Diptera: Asilidae).


    Castelo, Marcela K; Lazzari, Claudio R


    The robber fly Mallophora ruficauda is the most important pest of apiculture in the Pampas region of Argentina. Adults prey on honeybees and other insects, while larvae parasitize larvae of scarab beetles, which live underground. Females of M. ruficauda do not search for hosts but instead lay eggs in tall pastures. Once hatched, larvae drop to the ground and burrow underground to search for their hosts. We tested in the laboratory whether larvae of M. ruficauda actively search for their hosts using host and/or host-related chemical cues. We report that M. ruficauda detects its host using chemical cues that originate in the posterior half of the host's body, most likely from an abdominal exocrine structure. This particular host-searching strategy is described for the first time in Asilidae.

  6. Analysis of somatic and salivary gland antigens of third stage larvae of Rhinoestrus spp. (Diptera, Oestridae).


    Milillo, Piermarino; Traversa, Donato; Elia, Gabriella; Otranto, Domenico


    Larvae of Rhinoestrus spp. (Diptera, Oestridae) infect nasal and sinus cavities of horses, causing a nasal myiasis characterized by severe respiratory distress. Presently, the diagnosis of horse nasal botfly relies on the observation of clinical signs, on the post mortem retrieval of larvae or on molecular assays performed using pharyngeal swabs. The present study was carried out to characterize larval somatic proteins and salivary glands of Rhinoestrus spp. in a preliminary assessment towards the immunodiagnosis of equine rhinoestrosis. Out of the 212 necropsied horses 13 were positive for the presence of Rhinoestrus spp. larvae. The analysis of the sera from the infected animals by Western blotting assay showed the presence of a specific host humoral immune response against Rhinoestrus spp. larvae and proved that the salivary glands are the major immunogens in horse nasal botflies.

  7. Morphological and molecular identification of nasopharyngeal bot fly larvae infesting red deer (Cervus elaphus) in Austria.


    Leitner, Natascha; Schwarzmann, Laurin; Zittra, Carina; Palmieri, Nicola; Eigner, Barbara; Otranto, Domenico; Glawischnig, Walter; Fuehrer, Hans-Peter


    Nasopharyngeal myiases are caused by larvae of bot flies (Diptera: Oestridae), which have evolved a high specificity for their hosts. Bot flies (n = 916) were collected from 137 (57.6 %) out of 238 red deer (Cervus elaphus) hunted in Vorarlberg and Tyrol (Western Austria). After being stored in 75 % ethanol, larvae were identified to species level and developmental stage using morphological and morphometric keys. Larvae were also molecularly characterized by polymerase chain reaction (PCR) amplification and partial sequencing of the mitochondrial cytochrome oxidase subunit I gene. Morphological and molecular analysis allowed identification of larvae as Cephenemyia auribarbis and Pharyngomyia picta. Genetic variations were also examined within the specimens collected in both geographical locations.

  8. Salvianolic acid B stimulates osteogenesis in dexamethasone-treated zebrafish larvae

    PubMed Central

    Luo, Shi-ying; Chen, Jing-feng; Zhong, Zhi-guo; Lv, Xiao-hua; Yang, Ya-jun; Zhang, Jing-jing; Cui, Liao


    Aim: Our previous studies show that salvianolic acid B (Sal B) promotes osteoblast differentiation and matrix mineralization. In this study, we evaluated the protective effects of Sal B on the osteogenesis in dexamethasone (Dex)-treated larval zebrafish, and elucidated the underlying mechanisms. Methods: At 3 d post fertilization, wild-type AB zebrafish larvae or bone transgenic tg (sp7:egfp) zebrafish larvae were exposed to Sal B, Dex, or a mixture of Dex+Sal B for 6 d. Bone mineralization in AB strain larval zebrafish was assessed with alizarin red staining, and osteoblast differentiation in tg (sp7:egfp) larval zebrafish was examined with fluorescence scanning. The expression of osteoblast-specific genes in the larvae was detected using qRT-PCR assay. The levels of oxidative stress markers (ROS and MDA) in the larvae were also measured. Results: Exposure to Dex (5–20 μmol/L) dose-dependently decreased the bone mineralization area and integral optical density (IOD) in wild-type AB zebrafish larvae and the osteoblast fluorescence area and IOD in tg (sp7:egfp) zebrafish larvae. Exposure to Dex (10 μmol/L) significantly reduced the expression of osteoblast-specific genes, including runx2a, osteocalcin (OC), alkaline phosphatase (ALP) and osterix (sp7), and increased the accumulation of ROS and MDA in the larvae. Co-exposure to Sal B (0.2–2 μmol/L) dose-dependently increased the bone mineralization area and IOD in AB zebafish larvae and osteoblast fluorescence in tg (sp7:egfp) zebrafish larvae. Co-exposure to Sal B (2 μmol/L) significantly attenuated deleterious alterations in bony tissue and oxidative stress in both Dex-treated AB zebafish larvae and tg (sp7:egfp) zebrafish larvae. Conclusion: Sal B stimulates bone formation and rescues GC-caused inhibition on osteogenesis in larval zebrafish by counteracting oxidative stress and increasing the expression of osteoblast-specific genes. Thus, Sal B may have protective effects on bone loss trigged by GC. PMID

  9. Feeding strategy of Downs herring larvae (Clupea harengus L.) in the English Channel and North Sea

    NASA Astrophysics Data System (ADS)

    Denis, Jeremy; Vallet, Carole; Courcot, Lucie; Lefebvre, Valérie; Caboche, Josselin; Antajan, Elvire; Marchal, Paul; Loots, Christophe


    This study aims to characterize the larval feeding strategy of the Downs sub-population of North Sea herring (Clupea harengus L.). Diet composition, vacuity rate and prey selectivity of larvae from 8 to 15 mm collected during the International Bottom Trawl Survey (IBTS) - MIK sampling from 2008 to 2013 were assessed by direct observation of their gut contents using Scanning Electron Microscopy (SEM). The high contribution of protists and small zooplanktonic prey observed in the gut contents proved the relevance of SEM to study the diet of first feeding larvae. The relatively low vacuity rate of 45% suggests that food may not be a limiting factor for Downs herring larvae in winter. These larvae appeared to be omnivorous and there was a clear shift in term of prey composition at a size of 13 mm. Smaller larvae (8-12 mm) fed on a higher diversity of small prey, mainly small copepods (Oncaea spp. and Euterpina acutifrons), invertebrate eggs, diatoms (Psammodicthyon panduriforme and Coscinodiscus spp.) and dinoflagellates (Dinophysis acuminate and Prorocentrum micans) whereas bigger larvae (13-15 mm) fed on a lower diversity of larger prey, mainly copepods (Temora longicornis and Paracalanus parvus) and dinoflagellates (Gonyaulax spp.). Downs herring larvae had clear prey preferences as some dinoflagellates (Pyrophacus spp., Gonyaulax spp., P. micans and Porocentrum lima), invertebrate eggs, copepods (Oncaea spp. and nauplii) and diatoms (Thalassiosira curviseriata) were positively selected and other diatoms (Nitzschia spp., Thalassiosira tenera, Thalassiosira spp. and Chaetoceros spp.) and copepods (Pseudocalanus elongatus, T. longicornis and Unidentified calanoid) were negatively selected. We argue that this shift in term of prey preferences occurring at a size of 13 mm constitutes the critical period for Downs herring larvae.

  10. Descriptions of Mature Larvae of the Bee Tribe Emphorini and Its Subtribes (Hymenoptera, Apidae, Apinae)

    PubMed Central

    Rozen, Jr., Jerome G.


    Abstract A description of the mature larvae of the bee tribe Emphorini based on representatives of six genera is presented herein. The two included subtribes, Ancyloscelidina and Emphorina, are also characterized and distinguished from one another primarily by their mandibular anatomy. The anatomy of abdominal segments 9 and 10 is investigated and appears to have distinctive features that distinguish the larvae of the tribe from those of related apine tribes. PMID:22287901

  11. Nosema ceranae Can Infect Honey Bee Larvae and Reduces Subsequent Adult Longevity

    PubMed Central

    Eiri, Daren M.; Suwannapong, Guntima; Endler, Matthew; Nieh, James C.


    Nosema ceranae causes a widespread disease that reduces honey bee health but is only thought to infect adult honey bees, not larvae, a critical life stage. We reared honey bee (Apis mellifera) larvae in vitro and provide the first demonstration that N. ceranae can infect larvae and decrease subsequent adult longevity. We exposed three-day-old larvae to a single dose of 40,000 (40K), 10,000 (10K), zero (control), or 40K autoclaved (control) N. ceranae spores in larval food. Spores developed intracellularly in midgut cells at the pre-pupal stage (8 days after egg hatching) of 41% of bees exposed as larvae. We counted the number of N. ceranae spores in dissected bee midguts of pre-pupae and, in a separate group, upon adult death. Pre-pupae exposed to the 10K or 40K spore treatments as larvae had significantly elevated spore counts as compared to controls. Adults exposed as larvae had significantly elevated spore counts as compared to controls. Larval spore exposure decreased longevity: a 40K treatment decreased the age by which 75% of adult bees died by 28%. Unexpectedly, the low dose (10K) led to significantly greater infection (1.3 fold more spores and 1.5 fold more infected bees) than the high dose (40K) upon adult death. Differential immune activation may be involved if the higher dose triggered a stronger larval immune response that resulted in fewer adult spores but imposed a cost, reducing lifespan. The impact of N. ceranae on honey bee larval development and the larvae of naturally infected colonies therefore deserve further study. PMID:26018139

  12. Nosema ceranae Can Infect Honey Bee Larvae and Reduces Subsequent Adult Longevity.


    Eiri, Daren M; Suwannapong, Guntima; Endler, Matthew; Nieh, James C


    Nosema ceranae causes a widespread disease that reduces honey bee health but is only thought to infect adult honey bees, not larvae, a critical life stage. We reared honey bee (Apis mellifera) larvae in vitro and provide the first demonstration that N. ceranae can infect larvae and decrease subsequent adult longevity. We exposed three-day-old larvae to a single dose of 40,000 (40K), 10,000 (10K), zero (control), or 40K autoclaved (control) N. ceranae spores in larval food. Spores developed intracellularly in midgut cells at the pre-pupal stage (8 days after egg hatching) of 41% of bees exposed as larvae. We counted the number of N. ceranae spores in dissected bee midguts of pre-pupae and, in a separate group, upon adult death. Pre-pupae exposed to the 10K or 40K spore treatments as larvae had significantly elevated spore counts as compared to controls. Adults exposed as larvae had significantly elevated spore counts as compared to controls. Larval spore exposure decreased longevity: a 40K treatment decreased the age by which 75% of adult bees died by 28%. Unexpectedly, the low dose (10K) led to significantly greater infection (1.3 fold more spores and 1.5 fold more infected bees) than the high dose (40K) upon adult death. Differential immune activation may be involved if the higher dose triggered a stronger larval immune response that resulted in fewer adult spores but imposed a cost, reducing lifespan. The impact of N. ceranae on honey bee larval development and the larvae of naturally infected colonies therefore deserve further study.

  13. Detection of Sindbis and Inkoo Virus RNA in Genetically Typed Mosquito Larvae Sampled in Northern Sweden

    PubMed Central

    Tingström, Olov; Wesula Lwande, Olivia; Näslund, Jonas; Spyckerelle, Iris; Engdahl, Cecilia; Von Schoenberg, Pontus; Ahlm, Clas; Evander, Magnus


    Abstract Introduction: Mosquito-borne viruses have a widespread distribution across the globe and are known to pose serious threats to human and animal health. The maintenance and dissemination of these viruses in nature are driven through horizontal and vertical transmission. In the temperate climate of northern Sweden, there is a dearth of knowledge on whether mosquito-borne viruses that occur are transmitted transovarially. To gain a better understanding of mosquito-borne virus circulation and maintenance, mosquito larvae were sampled in northern Sweden during the first and second year after a large outbreak of Ockelbo disease in 2013 caused by Sindbis virus (SINV). Materials and Methods: A total of 3123 larvae were sampled during the summers of 2014 and 2015 at multiple sites in northern Sweden. The larvae were homogenized and screened for viruses using RT-PCR and sequencing. Species identification of selected larvae was performed by genetic barcoding targeting the cytochrome C oxidase subunit I gene. Results and Discussion: SINV RNA was detected in mosquito larvae of three different species, Ochlerotatus (Oc.) communis, Oc. punctor, and Oc. diantaeus. Inkoo virus (INKV) RNA was detected in Oc. communis larvae. This finding suggested that these mosquitoes could support transovarial transmission of SINV and INKV. Detection of virus in mosquito larva may serve as an early warning for emerging arboviral diseases and add information to epidemiological investigations before, during, and after outbreaks. Furthermore, our results demonstrated the relevance of genetic barcoding as an attractive and effective method for mosquito larva typing. However, further mosquito transmission studies are needed to ascertain the possible role of different mosquito species and developmental stages in the transmission cycle of arboviruses. PMID:27159120

  14. Oceanographic and behavioural assumptions in models of the fate of coral and coral reef fish larvae

    PubMed Central

    Wolanski, Eric; Kingsford, Michael J.


    A predictive model of the fate of coral reef fish larvae in a reef system is proposed that combines the oceanographic processes of advection and turbulent diffusion with the biological process of horizontal swimming controlled by olfactory and auditory cues within the timescales of larval development. In the model, auditory cues resulted in swimming towards the reefs when within hearing distance of the reef, whereas olfactory cues resulted in the larvae swimming towards the natal reef in open waters by swimming against the concentration gradients in the smell plume emanating from the natal reef. The model suggested that the self-seeding rate may be quite large, at least 20% for the larvae of rapidly developing reef fish species, which contrasted with a self-seeding rate less than 2% for non-swimming coral larvae. The predicted self-recruitment rate of reefs was sensitive to a number of parameters, such as the time at which the fish larvae reach post-flexion, the pelagic larval duration of the larvae, the horizontal turbulent diffusion coefficient in reefal waters and the horizontal swimming behaviour of the fish larvae in response to auditory and olfactory cues, for which better field data are needed. Thus, the model suggested that high self-seeding rates for reef fish are possible, even in areas where the ‘sticky water’ effect is minimal and in the absence of long-term trapping in oceanic fronts and/or large-scale oceanic eddies or filaments that are often argued to facilitate the return of the larvae after long periods of drifting at sea. PMID:24966233

  15. Acaricidal activity of thymol against larvae of Rhipicephalus microplus (Acari: Ixodidae) under semi-natural conditions.


    Araújo, Laryssa Xavier; Novato, Tatiane Pinheiro Lopes; Zeringota, Viviane; Matos, Renata Silva; Senra, Tatiane Oliveira Souza; Maturano, Ralph; Prata, Márcia Cristina Azevedo; Daemon, Erik; Monteiro, Caio Márcio Oliveira


    This is the first study to investigate the activity of thymol on Rhipicephalus microplus larvae under semi-natural conditions. For this purpose, tests were conducted in pots with Brachiaria decumbens seedlings containing cattle tick larvae. Thymol, diluted in ethanol 50° GL, was tested at concentrations of 2.5, 5.0, 10.0, 15.0, and 20.0 mg/mL, along with the control group treated with the solvent alone. Each treatment was composed of five pots (1 pot = a repetition). The experiment was performed in three steps. On the first day, the larvae were applied at the base of the signalgrass. Twenty-four hours later, approximately 25 mL of the solution was applied with thymol on the top of the vegetation in each pot. The survival of the larvae was measured 24 h after application of the solutions. Each pot was analyzed individually, and the grass fillets contained larvae were cut with scissors, placed in Petri dishes, and taken to the laboratory to count the number of living larvae. At the highest concentrations (10, 15, and 20 mg /mL), the number of live larvae declined by more than 95 % in relation to the control group. The lethal concentration 50 % (LC50) and LC90 values were 3.45 and 9.25 mg/ml, respectively. The application of thymol in semi-natural conditions starting concentration of 10 mg/mL significantly reduced the number of living R. microplus larvae.

  16. Morphological description of the fourth instar larva: Culicoides cataneii and Culicoides sahariensis (Diptera: Ceratopogonidae).


    Slama, Darine; Khedher, Asma; Bdira, Sassi; Khayech, Fethi; Delecolle, Jean-claude; Mezhoud, Habib; Babba, Hamouda; Emna, Chaker


    This study was carried out of the region of Monastir in Central Tunisia, between July and August 2010. Larvae were collected using a floatation technique with magnesium sulfate in mud samples. The fourth instar larva of Culicoides cataneii Clastrier, 1957 and Culicoides sahariensis Callot, Kremer, Bailly-Choumara, 1970 are described, illustrated and drawn. Measurements of instars IV are also presented. This is the first record of Culicoides cataneii and Culicoides sahariensis (Diptera: Ceratopogonidae) to Tunisia.

  17. Validation studies of the latex agglutination test for the detection of Trichinella larvae in meat products.


    Gayda, Jennifer; Reckinger, Sabine; Thaben, Nora; Nöckler, Karsten; Mayer-Scholl, Anne


    Human trichinellosis is a foodborne disease caused by ingestion of meat infected with Trichinella muscle larvae. To control Trichinella spp. infection in the European Union, all slaughtered pigs from holdings that are not officially recognized as applying controlled housing conditions and other animals susceptible to Trichinella infection and intended for human consumption should be examined by one of the approved digestion methods described in Regulation (EU) No. 2015/1375. In the past, Trichinella outbreaks due to the consumption of cured wild boar or pork products have been described in several European countries, making the identification of the larvae from these products relevant for Trichinella control. Therefore, this study aimed to validate the newly approved latex agglutination test (Trichin-L) for routine testing of cured meat products. The test was validated based on the OIE Guidelines using pork products spiked with Trichinella larvae. The sensitivity of the method varied greatly depending on the investigated meat product and was usually lower than for the gold standard, the magnetic stirrer method. The detection rate reached 80% for three larvae and 60% for one larva in cured pork sausages. A detection rate of 100% for three larvae and 50% for one larva was found in bacon. For frozen samples (-20°C) the Trichin-L kit is similarly sensitive as for cured samples. Further, to determine the performance of the test under field conditions, pork products from regions with known high Trichinella prevalences confiscated by customs authorities at two German international airports were analyzed. Problems associated with the Trichin-L test were incomplete digestion due to fatty ingredients, spices and very dry meat products, resulting in data which could not be evaluated. Therefore, the test is currently not suitable for the detection of Trichinella larvae in cured meat products and needs further adaptation steps to increase both usability and sensitivity.

  18. Psorophora (Grabhamia) varinervis (Diptera: Culicidae) morphological description including pupa and fourth-stage larva previously unknown.


    Rossi, Gustavo C; Stein, Marina; Almirón, Walter R


    Psorophora (Grabhamia) varinervis Edwards (Diptera: Culicidae) is redescribed in the adult stage. Pupa and fourth-stage larva are described and illustrated for the first time. Information about distribution, bionomics, and taxonomy also is included. Adults of Ps. varinervis can be separated from the closely related species Ps. (Gra.) discolor (Coquillett) on the basis of the wing characters, and the larva by the siphon and antenna characters.

  19. Transport patterns of Pacific sardine Sardinops sagax eggs and larvae in the California Current System

    NASA Astrophysics Data System (ADS)

    Weber, Edward D.; Chao, Yi; Chai, Fei; McClatchie, Sam


    We simulated transport of Pacific sardine eggs captured offshore of California in spring of 2001-2012 using a regional ocean circulation model. Eggs were assumed to have developed into larvae within a few days and were modeled using five behavioral patterns: passive transport, diel vertical migration, diel vertical migration combined with swimming against the current, diel migration combined with migration toward shore, and diel migration combined with migration toward the best habitat. Simulated larvae with no swimming behavior were advected far offshore to poor habitat where they were unlikely to survive. Diel vertical migration resulted in less offshore transport because larvae were less affected by surface currents during the day. However, in half the years simulated nearly all juveniles were also located in poor habitat by late summer in this scenario. Swimming against the current combined with diel vertical migration resulted in similar transport patterns to the diel-vertical-migration scenario because currents dominated the transport of eggs and small larvae during the spring and early summer. Migration toward shore resulted in a large fraction of juveniles being located in appropriate habitat during late summer in all years. Migration toward the best habitat was the best strategy modeled. This strategy resulted in a slightly greater proportion of larvae being located in appropriate habitat at the end of summer than the swimming-toward-shore scenario, despite the fact that most larvae were located farther offshore. These results suggest that larval sardine might use directed horizontal swimming behavior to remain in suitable habitat conditions. A large fraction of larvae were transported south into Mexican waters by late summer in all five scenarios. Surveying juvenile sardines in fall near the border of the U.S. and Mexico may be an efficient means of estimating recruitment because the advection pattern of eggs and larvae to the south is opposite the adult

  20. Molecular identification of nematode larvae different from those of the Trichinella genus detected by muscle digestion.


    Marucci, Gianluca; Interisano, Maria; La Rosa, Giuseppe; Pozio, Edoardo


    Although larvae of the genus Trichinella are the most common parasite species detected in vertebrate muscles using artificial digestion, nematode larvae belonging to other genera are sometimes detected and incorrectly identified as Trichinella. However, it is often very difficult to identify these larvae at the species, genus or family level using microscopy because of the absence of specific morphological characters or cuticle damage, and the only means of identification is PCR and sequencing of specific molecular markers (12S mtDNA; COI; 18S rDNA; and ITS1). From 2008 to 2011, 18 nematode isolates not belonging to the genus Trichinella were collected from different host species. Eleven of these isolates were successfully identified at the species, genus or superfamily level: larvae from two common kestrels, three hooded crows, a hen harrier and a domestic pig were identified as Toxocara cati; larvae from a badger were identified as Toxocara canis; larvae from a domestic pig were identified as a free-living nematode of the genus Panagrolaimus; larvae from a wild boar were identified as belonging to the Metastrongylus genus; and larvae from a rough-legged buzzard were identified as belonging to the superfamily Filarioidea. The recovery of nematodes belonging to genera other than Trichinella during routine meat inspection suggests that the persons performing the analyses need to be informed of the possibility of false positives and that a molecular-based identification system that allows for a rapid and reliable response must be adopted (i.e., a DNA barcoding-like system).

  1. Oestrosis in Asiatic ibex (Capra sibirica): a case report and molecular characterization of larvae.


    Sánchez, Antonio; Caparrós, Noelia; Ostrowski, Stephane; Sarasa, Mathieu; Pérez, Jesús M


    Three third-instar Oestrus larvae were found in the frontal sinus of an adult female Asiatic ibex (Capra sibirica) in the Tian Shan mountain range, Kyrgyzstan. The larvae were identified as Oestrus ovis based on morphology and after sequencing and analyzing a fragment of the cytochrome oxidase I (COI) gene. In light of this identification and the fact that Asiatic ibex and livestock are sympatric in many areas in Central Asia, we discuss the risks of interspecific parasite spillover.

  2. Costs of Three Wolbachia Infections on the Survival of Aedes aegypti Larvae under Starvation Conditions.


    Ross, Perran A; Endersby, Nancy M; Hoffmann, Ary A


    The mosquito Aedes aegypti, the principal vector of dengue virus, has recently been infected experimentally with Wolbachia: intracellular bacteria that possess potential as dengue biological control agents. Wolbachia depend on their hosts for nutrients they are unable to synthesize themselves. Consequently, competition between Wolbachia and their host for resources could reduce host fitness under the competitive conditions commonly experienced by larvae of Ae. aegypti in the field, hampering the invasion of Wolbachia into natural mosquito populations. We assess the survival and development of Ae. aegypti larvae under starvation conditions when infected with each of three experimentally-generated Wolbachia strains: wMel, wMelPop and wAlbB, and compare their fitness to wild-type uninfected larvae. We find that all three Wolbachia infections reduce the survival of larvae relative to those that are uninfected, and the severity of the effect is concordant with previously characterized fitness costs to other life stages. We also investigate the ability of larvae to recover from extended food deprivation and find no effect of Wolbachia on this trait. Aedes aegypti larvae of all infection types were able to resume their development after one month of no food, pupate rapidly, emerge at a large size, and exhibit complete cytoplasmic incompatibility and maternal transmission. A lowered ability of Wolbachia-infected larvae to survive under starvation conditions will increase the threshold infection frequency required for Wolbachia to establish in highly competitive natural Ae. aegypti populations and will also reduce the speed of invasion. This study also provides insights into survival strategies of larvae when developing in stressful environments.

  3. Costs of Three Wolbachia Infections on the Survival of Aedes aegypti Larvae under Starvation Conditions

    PubMed Central

    Ross, Perran A.; Endersby, Nancy M.; Hoffmann, Ary A.


    The mosquito Aedes aegypti, the principal vector of dengue virus, has recently been infected experimentally with Wolbachia: intracellular bacteria that possess potential as dengue biological control agents. Wolbachia depend on their hosts for nutrients they are unable to synthesize themselves. Consequently, competition between Wolbachia and their host for resources could reduce host fitness under the competitive conditions commonly experienced by larvae of Ae. aegypti in the field, hampering the invasion of Wolbachia into natural mosquito populations. We assess the survival and development of Ae. aegypti larvae under starvation conditions when infected with each of three experimentally-generated Wolbachia strains: wMel, wMelPop and wAlbB, and compare their fitness to wild-type uninfected larvae. We find that all three Wolbachia infections reduce the survival of larvae relative to those that are uninfected, and the severity of the effect is concordant with previously characterized fitness costs to other life stages. We also investigate the ability of larvae to recover from extended food deprivation and find no effect of Wolbachia on this trait. Aedes aegypti larvae of all infection types were able to resume their development after one month of no food, pupate rapidly, emerge at a large size, and exhibit complete cytoplasmic incompatibility and maternal transmission. A lowered ability of Wolbachia-infected larvae to survive under starvation conditions will increase the threshold infection frequency required for Wolbachia to establish in highly competitive natural Ae. aegypti populations and will also reduce the speed of invasion. This study also provides insights into survival strategies of larvae when developing in stressful environments. PMID:26745630

  4. Effects of Pollutants on Eggs, Embryos and Larvae of Amphibian Species

    DTIC Science & Technology


    development of Xenopus Embryos 19 7. Effect of unsymmetrical dimethylhydrazine on development of Xenopus embryos 20 8. Anencephaly caused by exposure...control larva and a larva exposed to UDMH for 15 days commencing at gastrula. Fig. 8. ANENCEPHALY CAUSED BY EXPOSURE OF XENOPUS EMBRYOS TO UNSYM- METRICAL... Anencephaly - Absence of the cerebral and cerebellar hemispheres, with only a rudimentary brain stem. Embryo - The developing frog is an embryo ýrom

  5. Oceanographic and behavioural assumptions in models of the fate of coral and coral reef fish larvae.


    Wolanski, Eric; Kingsford, Michael J


    A predictive model of the fate of coral reef fish larvae in a reef system is proposed that combines the oceanographic processes of advection and turbulent diffusion with the biological process of horizontal swimming controlled by olfactory and auditory cues within the timescales of larval development. In the model, auditory cues resulted in swimming towards the reefs when within hearing distance of the reef, whereas olfactory cues resulted in the larvae swimming towards the natal reef in open waters by swimming against the concentration gradients in the smell plume emanating from the natal reef. The model suggested that the self-seeding rate may be quite large, at least 20% for the larvae of rapidly developing reef fish species, which contrasted with a self-seeding rate less than 2% for non-swimming coral larvae. The predicted self-recruitment rate of reefs was sensitive to a number of parameters, such as the time at which the fish larvae reach post-flexion, the pelagic larval duration of the larvae, the horizontal turbulent diffusion coefficient in reefal waters and the horizontal swimming behaviour of the fish larvae in response to auditory and olfactory cues, for which better field data are needed. Thus, the model suggested that high self-seeding rates for reef fish are possible, even in areas where the 'sticky water' effect is minimal and in the absence of long-term trapping in oceanic fronts and/or large-scale oceanic eddies or filaments that are often argued to facilitate the return of the larvae after long periods of drifting at sea.

  6. Phage therapy as an approach to prevent Vibrio anguillarum infections in fish larvae production.


    Silva, Yolanda J; Costa, Liliana; Pereira, Carla; Mateus, Cristiana; Cunha, Angela; Calado, Ricardo; Gomes, Newton C M; Pardo, Miguel A; Hernandez, Igor; Almeida, Adelaide


    Fish larvae in aquaculture have high mortality rates due to pathogenic bacteria, especially the Vibrio species, and ineffective prophylactic strategies. Vaccination is not feasible in larvae and antibiotics have reduced efficacy against multidrug resistant bacteria. A novel approach to controlling Vibrio infections in aquaculture is needed. The potential of phage therapy to combat vibriosis in fish larvae production has not yet been examined. We describe the isolation and characterization of two bacteriophages capable of infecting pathogenic Vibrio and their application to prevent bacterial infection in fish larvae. Two groups of zebrafish larvae were infected with V. anguillarum (∼106 CFU mL-1) and one was later treated with a phage lysate (∼108 PFU mL-1). A third group was only added with phages. A fourth group received neither bacteria nor phages (fish control). Larvae mortality, after 72 h, in the infected and treated group was similar to normal levels and significantly lower than that of the infected but not treated group, indicating that phage treatment was effective. Thus, directly supplying phages to the culture water could be an effective and inexpensive approach toward reducing the negative impact of vibriosis in larviculture.

  7. Genetic and Biochemical Diversity of Paenibacillus larvae Isolated from Tunisian Infected Honey Bee Broods

    PubMed Central

    Hamdi, Chadlia; Essanaa, Jihène; Sansonno, Luigi; Crotti, Elena; Abdi, Khaoula; Barbouche, Naima; Balloi, Annalisa; Gonella, Elena; Alma, Alberto; Daffonchio, Daniele; Boudabous, Abdellatif; Cherif, Ameur


    Paenibacillus larvae is the causative agent of American foulbrood (AFB), a virulent disease of honeybee (Apis mellifera) larvae. In Tunisia, AFB has been detected in many beekeeping areas, where it causes important economic losses, but nothing is known about the diversity of the causing agent. Seventy-five isolates of P. larvae, identified by biochemical tests and 16S rRNA gene sequencing, were obtained from fifteen contaminated broods showing typical AFB symptoms, collected in different locations in the northern part of the country. Using BOX-PCR, a distinct profile of P. larvae with respect to related Paenibacillus species was detected which may be useful for its identification. Some P. larvae-specific bands represented novel potential molecular markers for the species. BOX-PCR fingerprints indicated a relatively high intraspecific diversity among the isolates not described previously with several molecular polymorphisms identifying six genotypes on polyacrylamide gel. Polymorphisms were also detected in several biochemical characters (indol production, nitrate reduction, and methyl red and oxidase tests). Contrary to the relatively high intraspecies molecular and phenotypic diversity, the in vivo virulence of three selected P. larvae genotypes did not differ significantly, suggesting that the genotypic/phenotypic differences are neutral or related to ecological aspects other than virulence. PMID:24073406

  8. A new glimpse on Mesozoic zooplankton-150 million-year-old lobster larvae.


    Haug, Joachim T; Haug, Carolin


    Larvae of malacostracan crustaceans represent a large fraction of modern day zooplankton. Plankton is not only a major part of the modern marine ecosystem, but must have played an important role in the ecosystems of the past as well. Unfortunately, our knowledge about plankton composition of the past is still quite limited. As an important part of today's zooplankton, malacostracan larvae are still a rarity in the fossil record; many types of malacostracan larvae dominating the modern plankton have so far not been found as fossils. Here we report a new type of fossil malacostracan larva, found in the 150 million years old lithographic limestones of southern Germany (Solnhofen Lithographic Limestones). The three rather incomplete specimens mainly preserve the telson. A pronounced middle spine on the posterior edge of these specimens indicates that they are either larval forms of a clawed lobster or of an axiidean lobster, or of a closer relative to one of the two groups. The tergo-pleura are drawn out into distinct spines in one specimen, further supporting the interpretation as a larva of a clawed lobster or an early relative. The telson morphology also shows adaptations to a prolonged planktic life style, the latero-posterior edges are drawn out into distinct spines. Similar adaptations are known in larvae of the modern homarid lobster Nephrops norvegicus, not necessarily indicating a closer relationship, but convergent life styles. The new finds provide an important new insight into the composition of Mesozoic zooplankton and demonstrate the preservation potential of lithographic limestones.

  9. Variations in macromolecular antifreeze levels in larvae of the darkling beetle, Meracantha contracta.


    Duman, J G


    Overwintering larvae of the darkling beetle, Meracantha contracta, produce a macromolecular antifreeze that is similar in activity to the glycoproteinaceous and proteinaceous antifreezes found in some cold-water, marine teleost fishes. The antifreeze is not present in the hemolymph of the Meracantha larvae in summer, but its production begins by late September in the wild population. The antifreeze reaches a maximum concentration in February, decreases slowly through spring, and disappears by early June. The supercooling points of the larvae are lowest in February, when the antifreeze levels are highest, and increase as the antifreeze concentrations in the hemolymph decrease in the spring. Larvae collected in mid-February and warm-acclimated lost the antifreeze with-in 12 days. Larvae collected in early September and cold-acclimated required nearly two months to produce concentrations of antifreeze comparable to those of overwintering larvae. Temperature seems to be the major environmental factor responsible for the control of antifreeze levels in Meracantha; however, other environmental factors may also be involved.

  10. Maintained larval growth in mussel larvae exposed to acidified under-saturated seawater

    NASA Astrophysics Data System (ADS)

    Ventura, Alexander; Schulz, Sabrina; Dupont, Sam


    Ocean acidification (OA) is known to affect bivalve early life-stages. We tested responses of blue mussel larvae to a wide range of pH in order to identify their tolerance threshold. Our results confirmed that decreasing seawater pH and decreasing saturation state increases larval mortality rate and the percentage of abnormally developing larvae. Virtually no larvae reared at average pHT 7.16 were able to feed or reach the D-shell stage and their development appeared to be arrested at the trochophore stage. However larvae were capable of reaching the D-shell stage under milder acidification (pHT ≈ 7.35, 7.6, 7.85) including in under-saturated seawater with Ωa as low as 0.54 ± 0.01 (mean ± s. e. m.), with a tipping point for normal development identified at pHT 7.765. Additionally growth rate of normally developing larvae was not affected by lower pHT despite potential increased energy costs associated with compensatory calcification in response to increased shell dissolution. Overall, our results on OA impacts on mussel larvae suggest an average pHT of 7.16 is beyond their physiological tolerance threshold and indicate a shift in energy allocation towards growth in some individuals revealing potential OA resilience.

  11. Dipteran larvae and microbes facilitate nutrient sequestration in the Nepenthes gracilis pitcher plant host.


    Lam, Weng Ngai; Chong, Kwek Yan; Anand, Ganesh S; Tan, Hugh Tiang Wah


    The fluid-containing traps of Nepenthes carnivorous pitcher plants (Nepenthaceae) are often inhabited by organisms known as inquilines. Dipteran larvae are key components of such communities and are thought to facilitate pitcher nitrogen sequestration by converting prey protein into inorganic nitrogen, although this has never been demonstrated in Nepenthes Pitcher fluids are also inhabited by microbes, although the relationship(s) between these and the plant is still unclear. In this study, we examined the hypothesis of digestive mutualism between N. gracilis pitchers and both dipteran larvae and fluid microbes. Using dipteran larvae, prey and fluid volumes mimicking in situ pitcher conditions, we conducted in vitro experiments and measured changes in available fluid nitrogen in response to dipteran larvae and microbe presence. We showed that the presence of dipteran larvae resulted in significantly higher and faster releases of ammonium and soluble protein into fluids in artificial pitchers, and that the presence of fluid microbes did likewise for ammonium. We showed also that niche segregation occurs between phorid and culicid larvae, with the former fragmenting prey carcasses and the latter suppressing fluid microbe levels. These results clarify the relationships between several key pitcher-dwelling organisms, and show that pitcher communities facilitate nutrient sequestration in their host.

  12. A low trophic position of Japanese eel larvae indicates feeding on marine snow.


    Miller, Michael J; Chikaraishi, Yoshito; Ogawa, Nanako O; Yamada, Yoshiaki; Tsukamoto, Katsumi; Ohkouchi, Naohiko


    What eel larvae feed on in the surface layer of the ocean has remained mysterious. Gut contents and bulk nitrogen stable isotope studies suggested that these unusual larvae, called leptocephali, feed at a low level in the oceanic food web, whereas other types of evidence have suggested that small zooplankton are eaten. In this study, we determined the nitrogen isotopic composition of amino acids of both natural larvae and laboratory-reared larvae of the Japanese eel to estimate the trophic position (TP) of leptocephali. We observed a mean TP of 2.4 for natural leptocephali, which is consistent with feeding on particulate organic matter (POM) such as marine snow and discarded appendicularian houses containing bacteria, protozoans and other biological materials. The nitrogen isotope enrichment values of the reared larvae confirm that the primary food source of natural larvae is consistent only with POM. This shows that leptocephali feed on readily available particulate material originating from various sources closely linked to ocean primary production and that leptocephali are a previously unrecognized part of oceanic POM cycling.

  13. Apical organs in echinoderm larvae: insights into larval evolution in the Ambulacraria.


    Byrne, Maria; Nakajima, Yoko; Chee, Francis C; Burke, Robert D


    The anatomy and cellular organization of serotonergic neurons in the echinoderm apical organ exhibits class-specific features in dipleurula-type (auricularia, bipinnaria) and pluteus-type (ophiopluteus, echinopluteus) larvae. The apical organ forms in association with anterior ciliary structures. Apical organs in dipleurula-type larvae are more similar to each other than to those in either of the pluteus forms. In asteroid bipinnaria and holothuroid auricularia the apical organ spans ciliary band sectors that traverse the anterior-most end of the larvae. The asteroid apical organ also has prominent bilateral ganglia that connect with an apical network of neurites. The simple apical organ of the auricularia is similar to that in the hemichordate tornaria larva. Apical organs in pluteus forms differ markedly. The echinopluteus apical organ is a single structure on the oral hood between the larval arms comprised of two groups of cells joined by a commissure and its cell bodies do not reside in the ciliary band. Ophioplutei have a pair of lateral ganglia associated with the ciliary band of larval arms that may be the ophiuroid apical organ. Comparative anatomy of the serotonergic nervous systems in the dipleurula-type larvae of the Ambulacraria (Echinodermata+Hemichordata) suggests that the apical organ of this deuterostome clade originated as a simple bilaterally symmetric nerve plexus spanning ciliary band sectors at the anterior end of the larva. From this structure, the apical organ has been independently modified in association with the evolution of class-specific larval forms.

  14. Phage Therapy as an Approach to Prevent Vibrio anguillarum Infections in Fish Larvae Production

    PubMed Central

    Silva, Yolanda J.; Costa, Liliana; Pereira, Carla; Mateus, Cristiana; Cunha, Ângela; Calado, Ricardo; Gomes, Newton C. M.; Pardo, Miguel A.; Hernandez, Igor; Almeida, Adelaide


    Fish larvae in aquaculture have high mortality rates due to pathogenic bacteria, especially the Vibrio species, and ineffective prophylactic strategies. Vaccination is not feasible in larvae and antibiotics have reduced efficacy against multidrug resistant bacteria. A novel approach to controlling Vibrio infections in aquaculture is needed. The potential of phage therapy to combat vibriosis in fish larvae production has not yet been examined. We describe the isolation and characterization of two bacteriophages capable of infecting pathogenic Vibrio and their application to prevent bacterial infection in fish larvae. Two groups of zebrafish larvae were infected with V. anguillarum (∼106 CFU mL−1) and one was later treated with a phage lysate (∼108 PFU mL−1). A third group was only added with phages. A fourth group received neither bacteria nor phages (fish control). Larvae mortality, after 72 h, in the infected and treated group was similar to normal levels and significantly lower than that of the infected but not treated group, indicating that phage treatment was effective. Thus, directly supplying phages to the culture water could be an effective and inexpensive approach toward reducing the negative impact of vibriosis in larviculture. PMID:25464504

  15. A 2D virtual reality system for visual goal-driven navigation in zebrafish larvae

    PubMed Central

    Jouary, Adrien; Haudrechy, Mathieu; Candelier, Raphaël; Sumbre, German


    Animals continuously rely on sensory feedback to adjust motor commands. In order to study the role of visual feedback in goal-driven navigation, we developed a 2D visual virtual reality system for zebrafish larvae. The visual feedback can be set to be similar to what the animal experiences in natural conditions. Alternatively, modification of the visual feedback can be used to study how the brain adapts to perturbations. For this purpose, we first generated a library of free-swimming behaviors from which we learned the relationship between the trajectory of the larva and the shape of its tail. Then, we used this technique to infer the intended displacements of head-fixed larvae, and updated the visual environment accordingly. Under these conditions, larvae were capable of aligning and swimming in the direction of a whole-field moving stimulus and produced the fine changes in orientation and position required to capture virtual prey. We demonstrate the sensitivity of larvae to visual feedback by updating the visual world in real-time or only at the end of the discrete swimming episodes. This visual feedback perturbation caused impaired performance of prey-capture behavior, suggesting that larvae rely on continuous visual feedback during swimming. PMID:27659496

  16. Coral larvae exhibit few measurable transcriptional changes during the onset of coral-dinoflagellate endosymbiosis.


    Schnitzler, Christine E; Weis, Virginia M


    The cellular mechanisms controlling the successful establishment of a stable mutualism between cnidarians and their dinoflagellate partners are largely unknown. The planula larva of the solitary Hawaiian scleractinian coral Fungia scutaria and its dinoflagellate symbiont Symbiodinium sp. type C1f represents an ideal model for studying the onset of cnidarian-dinoflagellate endosymbiosis due to the predictable availability of gametes, the ability to raise non-symbiotic larvae and establish the symbiosis experimentally, and the ability to precisely quantify infection success. The goal of this study was to identify genes differentially expressed in F. scutaria larvae during the initiation of endosymbiosis with Symbiodinium sp. C1f. Newly symbiotic larvae were compared to non-symbiotic larvae using a custom cDNA microarray. The 5184-feature array was constructed with cDNA libraries from newly symbiotic and non-symbiotic F. scutaria larvae, including 3072 features (60%) that were enriched for either state by subtractive hybridization. Our analyses revealed very few changes in the F. scutaria transcriptome as a result of infection with Symbiodinium sp. C1f, similar to other studies focused on the early stages of this symbiotic interaction. We suggest that these results may be due, in part, to an inability to detect the transcriptional signal from the small percentage of infected cells compared to uninfected cells. We discuss several other potential explanations for this result, including suggesting that certain types of Symbiodinium sp. may have evolved mechanisms to suppress or circumvent cnidarian host responses to infection.

  17. Evaluation of the impact of polyethylene microbeads ingestion in European sea bass (Dicentrarchus labrax) larvae.


    Mazurais, D; Ernande, B; Quazuguel, P; Severe, A; Huelvan, C; Madec, L; Mouchel, O; Soudant, P; Robbens, J; Huvet, A; Zambonino-Infante, J


    Microplastics are present in marine habitats worldwide and may be ingested by low trophic organisms such as fish larvae, with uncertain physiological consequences. The present study aims at assessing the impact of polyethylene (PE 10-45 μM) microbeads ingestion in European sea bass (Dicentrarchus labrax) larvae. Fish were fed an inert diet including 0, 10(4) and 10(5) fluorescent microbeads per gram from 7 until 43 days post-hatching (dph). Microbeads were detected in the gastrointestinal tract in all fish fed diet incorporating PE. Our data revealed an efficient elimination of PE beads from the gut since no fluorescent was observed in the larvae after 48 h depuration. While the mortality rate increased significantly with the amount of microbeads scored per larvae at 14 and 20 dph, only ingestion of the highest concentration slightly impacted mortality rates. Larval growth and inflammatory response through Interleukine-1-beta (IL-1β) gene expression were not found to be affected while cytochrome-P450-1A1 (cyp1a1) expression level was significantly positively correlated with the number of microbeads scored per larva at 20 dph. Overall, these results suggest that ingestion of PE microbeads had limited impact on sea bass larvae possibly due to their high potential of egestion.

  18. Notes on facultative predation in Prosimulium larvae (Diptera: Simuliidae) in alpine and subalpine streams in Colorado.


    Al-Shaer, Layla; Pierce, Allison K; Larson, David; Hancock, Robert


    Although it is widely accepted that black fly larvae employ filter feeding as their primary mode of nutrient intake, other forms of food acquisition, such as predation, may be more prevalent than previously realized. It has been suggested that environments where particulate matter is low, such as high-elevation seasonal streams, may drive predatory behavior in black fly larvae. Relatively little is known about the frequency at which larvae prey on other organisms or if predation may be obligate in some species. In order to supplement the idea that larval black fly predation may be a common method of feeding under certain conditions, a preliminary survey of predation by Prosimulium larvae was conducted in order to assess predation frequency at high-elevation sites (> 3,200 m) in the Colorado Rocky Mountains. Larvae were sampled from alpine and subalpine locations, and their gut content analysis revealed evidence of facultative predation and possible cannibalism. Evidence of predation was observed in all but 1 Prosimulium species collected. Predation frequency was highest in the North Fork Snake River headwater location, a small tributary stream of the Snake River in central Colorado. This survey suggests that further inquiry into predatory behavior of black fly larvae should be conducted to determine the mechanisms, behavior, and ecological impact of this understudied feeding strategy.

  19. Efficacy of photodynamic therapy against larvae of Aedes aegypti: confocal microscopy and fluorescence-lifetime imaging

    NASA Astrophysics Data System (ADS)

    de Souza, L. M.; Pratavieira, S.; Inada, N. M.; Kurachi, C.; Corbi, J.; Guimarães, F. E. G.; Bagnato, V. S.


    Recently a few demonstration on the use of Photodynamic Reaction as possibility to eliminate larvae that transmit diseases for men has been successfully demonstrated. This promising tool cannot be vastly used due to many problems, including the lake of investigation concerning the mechanisms of larvae killing as well as security concerning the use of photosensitizers in open environment. In this study, we investigate some of the mechanisms in which porphyrin (Photogem) is incorporated on the Aedes aegypti larvae previously to illumination and killing. Larvae at second instar were exposed to the photosensitizer and after 30 minutes imaged by a confocal fluorescence microscope. It was observed the presence of photosensitizer in the gut and at the digestive tract of the larva. Fluorescence-Lifetime Imaging showed greater photosensitizer concentration in the intestinal wall of the samples, which produces a strong decrease of the Photogem fluorescence lifetime. For Photodynamic Therapy exposition to different light doses and concentrations of porphyrin were employed. Three different light sources (LED, Fluorescent lamp, Sun light) also were tested. Sun light and fluorescent lamp shows close to 100% of mortality after 24 hrs. of illumination. These results indicate the potential use of photodynamic effect against the LARVAE of Aedes aegypti.

  20. [Antifeeding effects of crude lantadene from Lantana camara on Plutella xylostella and Spodoptera litura larvae].


    Dong, Yizhi; Zhang, Maoxin; Ling, Bing


    In this study, crude lantadene was extracted from Lantana canmara leaves, and its antifeeding effects on Plutella xylostella and Spodoptera litura larvae were tested. In no-choice test, crude lantadene at 1.6 mg x ml(-1) concentration had antifeeding effects on the 2nd instar P. xylostella larvae and 1st instar S. litura larvae, with the antifeeding rate being 62.4% and 33.1%, respectively within 48 h. In choice test, even a low concentration (0.4 mg x ml(-1)) crude lantadene still had anti-feeding effects on the 2nd instar P. xylostella larvae, and the antifeeding rate at 0.4, 0.8 and 1.6 mg x ml(-1) concentration was 52.7%, 55.5% and 78.9%, respectively. Crude lantadene only at 1.6 mg x ml(-1) concentration had anti-feeding effects on the 1st instar S. litura larvae, and the antifeeding rate was 33.0%. For the 2nd instar S. litura larvae, crude lantadene had no antifeeding effects both in no-choice and in choice test.

  1. Transmission of lymphocystis disease virus to cultured gilthead seabream, Sparus aurata L., larvae.


    Cano, I; Valverde, E J; Garcia-Rosado, E; Alonso, M C; Lopez-Jimena, B; Ortiz-Delgado, J B; Borrego, J J; Sarasquete, C; Castro, D


    The transmission of lymphocystis disease virus (LCDV) to gilthead seabream, Sparus aurata L., larvae was investigated using fertilized eggs from a farm with previous reports of lymphocystis disease. LCDV genome was detected by PCR-hybridization in blood samples from 17.5% of the asymptomatic gilthead seabream broodstock analysed. Using the same methodology, eggs spawned from these animals were LCDV positive, as well as larvae hatched from them. The presence of infective viral particles was confirmed by cytopathic effects development on SAF-1 cells. Whole-mount in situ hybridization (ISH) and immunohistochemistry (IHC) showed the presence of LCDV in the epidermis of larvae hatched from LCDV-positive eggs. When fertilized eggs were disinfected with iodine, no viral DNA was detected either in eggs (analysed by PCR-hybridization) or in larvae (PCR-hybridization and ISH). These results suggest the vertical transmission of LCDV, the virus being transmitted on the egg surface. Larvae hatched from disinfected eggs remain LCDV negative during the endotrophic phase, as showed by PCR-hybridization, ISH and IHC. After feeding on LCDV-positive rotifers, viral antigens were observed in the digestive tract, which suggests that viral entry could be achieved via the alimentary canal, and that rotifers can act as a vector in LCDV transmission to gilthead seabream larvae.

  2. The promiscuous larvae: flexibility in the establishment of symbiosis in corals

    NASA Astrophysics Data System (ADS)

    Cumbo, V. R.; Baird, A. H.; van Oppen, M. J. H.


    Coral reefs thrive in part because of the symbiotic partnership between corals and Symbiodinium. While this partnership is one of the keys to the success of coral reef ecosystems, surprisingly little is known about many aspects of coral symbiosis, in particular the establishment and development of symbiosis in host species that acquire symbionts anew in each generation. More specifically, the point at which symbiosis is established (i.e., larva vs. juvenile) remains uncertain, as does the source of free-living Symbiodinium in the environment. In addition, the capacity of host and symbiont to form novel combinations is unknown. To explore patterns of initial association between host and symbiont, larvae of two species of Acropora were exposed to sediment collected from three locations on the Great Barrier Reef. A high proportion of larvae established symbiosis shortly after contact with sediments, and Acropora larvae were promiscuous, taking up multiple types of Symbiodinium. The Symbiodinium types acquired from the sediments reflected the symbiont assemblage within a wide range of cnidarian hosts at each of the three sites, suggesting potential regional differences in the free-living Symbiodinium assemblage. Coral larvae clearly have the capacity to take up Symbiodinium prior to settlement, and sediment is a likely source. Promiscuous larvae allow species to associate with Symbiodinium appropriate for potentially novel environments that may be experienced following dispersal.

  3. [Experimental infection of 2 species of laboratory rodents with invasive larvae of Elaphostrongylus cervi (Nematoda, Metastrongyloidea)].


    Demiaszkiewicz, A W


    Single doses (from 300 to 1000 larvi per an animal) of invasive larvae E. cervi Cameron, 1931, obtained from experimentally infected snails Helix pomatia L. were given to 17 guinea pigs and 17 golden hamsters. Clinical nervous symptoms in the form of paresis and paralysis of limbs occurred only in the guinea pigs which were given a dose of 1000 larvi. These animals died in the period from the 75th to 117th day of infection. From their central nervous system single adult males and females of E. cervi were isolated. In the lungs and mesenteries of 2 dead pigs live larvae of E. cervi were found. This fact proves that the guinea pig can fulfil the role of a final and a paratenic host of E. cervi. No clinical symptoms were noticed in any hamster. In hamsters dissected on the 7th day of infection live larvae of E. cervi were found in the mesentery and in the fleshy part of the diaphgram. After 14 days the larvae found both in the mesentery and in the diaphragm were dead and surrounded by cellular infiltration. A strong tissue reaction of the hamster after the administration of E. cervi larvae is responsible for the larvae destruction and resorption.

  4. Vibrio lentus protects gnotobiotic sea bass (Dicentrarchus labrax L.) larvae against challenge with Vibrio harveyi.


    Schaeck, M; Duchateau, L; Van den Broeck, W; Van Trappen, S; De Vos, P; Coulombet, C; Boon, N; Haesebrouck, F; Decostere, A


    Due to the mounting awareness of the risks associated with the use of antibiotics in aquaculture, treatment with probiotics has recently emerged as the preferred environmental-friendly prophylactic approach in marine larviculture. However, the presence of unknown and variable microbiota in fish larvae makes it impossible to disentangle the efficacy of treatment with probiotics. In this respect, the recent development of a germ-free culture model for European sea bass (Dicentrarchus labrax L.) larvae opened the door for more controlled studies on the use of probiotics. In the present study, 206 bacterial isolates, retrieved from sea bass larvae and adults, were screened in vitro for haemolytic activity, bile tolerance and antagonistic activity against six sea bass pathogens. Subsequently, the harmlessness and the protective effect of the putative probiotic candidates against the sea bass pathogen Vibrio harveyi were evaluated in vivo adopting the previously developed germ-free sea bass larval model. An equivalence trial clearly showed that no harmful effect on larval survival was elicited by all three selected probiotic candidates: Bacillus sp. LT3, Vibrio lentus and Vibrio proteolyticus. Survival of Vibrio harveyi challenged larvae treated with V. lentus was superior in comparison with the untreated challenged group, whereas this was not the case for the larvae supplemented with Bacillus sp. LT3 and V. proteolyticus. In this respect, our results unmistakably revealed the protective effect of V. lentus against vibriosis caused by V. harveyi in gnotobiotic sea bass larvae, rendering this study the first in its kind.

  5. Detailed investigation of the sequential pathological changes in silkworm larvae infected with Bombyx densovirus type 1.


    Ito, Katsuhiko; Kidokoro, Kurako; Shimura, Sachiko; Katsuma, Susumu; Kadono-Okuda, Keiko


    Bombyx mori densovirus type 1 (BmDNV-1) is a pathogen causing flacherie disease in silkworms. BmDNV-1 multiplies only in the nuclei of the columnar cells of larval midgut epithelium. Although several immunohistochemical studies using anti-BmDNV-1 antibody have been reported to date, sequential pathological changes in BmDNV-1-infected larvae have not been completely elucidated. In this paper, sequential investigations were performed on the pathological features of BmDNV-1-infected larvae and BmDNV-1 propagation. Oral infection experiments using newly ecdysed 4th instar larvae revealed that the larvae began to die 9 days post infection (dpi), and the remaining died 10 dpi. Histological observations revealed phenotypic alterations in the midgut cells from 4 dpi, and complete disruption of the midgut structure at 9 dpi. Quantitative RT-PCR of two BmDNV-1 genes indicated that BmDNV-1 began to propagate from 4 dpi, and gradually increased until the larvae died. These expression patterns revealed marked correlation with the histological changes observed in the virus-infected midgut cells. Moreover, bioassays using larvae at various developmental stages clearly indicated that the pathogenicity of this virus is not dependent on the larval stage or the molting process.

  6. Daily feeding and protein metabolism rhythms in Senegalese sole post-larvae

    PubMed Central

    Yúfera, Manuel; Engrola, Sofia


    ABSTRACT Fish hatcheries must adapt larval feeding protocols to feeding behavior and metabolism patterns to obtain more efficient feed utilization. Fish larvae exhibit daily ingesting rhythms rather than ingesting food continuously throughout the day. The aim of this study was to determine the daily patterns of feed intake, protein digestibility, protein retention and catabolism in Senegalese sole post-larvae (Solea senegalensis; 33 days post-hatching) using 14C-labeled Artemia protein and incubation in metabolic chambers. Sole post-larvae were fed at 09:00, 15:00, 21:00, 03:00 and 09:00+1 day; and those fed at 09:00, 21:00, 03:00 and 09:00+1 day showed significantly higher feed intake than post-larvae fed at 15:00 h (P=0.000). Digestibility and evacuation rate of ingested protein did not change during the whole cycle (P=0.114); however, post-larvae fed at 21:00 and 03:00 h showed the significantly highest protein retention efficiency and lowest catabolism (P=0.002). Therefore, results confirm the existence of daily rhythmicity in feeding activity and in the utilization of the ingested nutrients in Senegalese sole post-larvae. PMID:27895049

  7. Genomewide analysis indicates that queen larvae have lower methylation levels in the honey bee ( Apis mellifera)

    NASA Astrophysics Data System (ADS)

    Shi, Yuan Yuan; Yan, Wei Yu; Huang, Zachary Y.; Wang, Zi Long; Wu, Xiao Bo; Zeng, Zhi Jiang


    The honey bee is a social insect characterized by caste differentiation, by which a young larva can develop into either a queen or a worker. Despite possessing the same genome, queen and workers display marked differences in reproductive capacity, physiology, and behavior. Recent studies have shown that DNA methylation plays important roles in caste differentiation. To further explore the roles of DNA methylation in this process, we analyzed DNA methylome profiles of both queen larvae (QL) and worker larvae (WL) of different ages (2, 4, and 6 day old), by using methylated DNA immunoprecipitation-sequencing (meDIP-seq) technique. The global DNA methylation levels varied between the larvae of two castes. DNA methylation increased from 2-day- to 4-day-old QL and then decreased in 6-day-old larvae. In WL, methylation levels increased with age. The methylcytosines in both larvae were enriched in introns, followed by coding sequence (CDS) regions, CpG islands, 2 kbp downstream and upstream of genes, and 5' and 3' untranslated regions (UTRs). The number of differentially methylated genes (DMGs) in 2-, 4-, and 6-day-old QL and WL was 725, 3,013, and 5,049, respectively. Compared to 4- and 6-day-old WL, a large number of genes in QL were downmethylated, which were involved in many processes including development, reproduction, and metabolic regulation. In addition, some DMGs were concerned with caste differentiation.

  8. Photodynamic treatment of Chaoborus crystallinus larvae with chlorophyllin induces necrosis and apoptosis.


    Wohllebe, Stephanie; Ulbrich, Claudia; Grimm, Daniela; Pietsch, Jessica; Erzinger, Gilmar; Richter, Roland; Lebert, Michael; Richter, Peter Rolf; Häder, Donat-Peter


    Chlorophyllin kills mosquito larvae (Culex, Aedes) in the aquatic habitat at low concentrations via photodynamic reactions under irradiation. The effects of chlorophyllin were investigated at the cellular level using the transparent larvae of Chaoborus crystallinus as a model system. Their transparency enabled in situ fluorescence investigation, showing that chlorophyllin accumulates in the intestine of the larvae. Uptake of chlorophyllin at room temperature took about 2 h. The fluorescence signal peaked after 5 h of incubation. Chlorophyllin accumulates up to about 15 ng per larvae. The intestine of treated larvae was dissected and stained with several dyes (acridine orange, Hoechst 33342 and propidium iodide). Apoptosis and necrosis increased with higher concentrations of chlorophyllin (to a smaller extent in dark controls) and were elevated in irradiated samples. Single cells from treated larvae were isolated and subjected to Annexin V flow cytometry. The fraction of apoptotic and necrotic cells increased significantly at a high chlorophyllin concentration (21.4 mg L(-1)) and under intensive irradiation. The activity of caspases-3, -8 and -9 as well as Bcl-2 and cytochrome c was investigated by means of western blot analysis. The data suggest a possible chlorophyllin concentration-dependent shift of the apoptotic pathway.

  9. Acute ecotoxicology of natural oil and gas condensate to coral reef larvae

    NASA Astrophysics Data System (ADS)

    Negri, Andrew P.; Brinkman, Diane L.; Flores, Florita; Botté, Emmanuelle S.; Jones, Ross J.; Webster, Nicole S.


    Risks posed by oil spills to coral reefs are difficult to evaluate, partially due to the absence of studies that adequately assess toxicity to relevant coral reef species. Here we experimentally tested the acute toxicity of condensate, representing a fraction of light crude oil, to coral (Acropora tenuis) and sponge (Rhopaloeides odorabile) larvae. The metamorphosis of coral larvae was inhibited at total petroleum aromatic hydrocarbon (TPAH) concentrations of water accommodated fractions (WAF) as low as 103 μg l‑1, similar to concentrations detected in seawater following large spills. The sensitivity of coral larvae increased by 40% when co-exposed to UV light that they might encounter in shallow reefal systems. Condensate WAF was more toxic to coral larvae than predicted by summing the toxicity of its main components (benzene, toluene, p-xylene and napthalene). In contrast, the sensitivity of sponge larvae to condensate WAF (>10,000 μg l‑1 TPAH) was far less than coral in the presence and absence of UV, but similar to that of other marine invertebrates. While these results highlight the relative sensitivity of coral larvae to oil, further research is needed to better understand and predict the impacts and risks posed by hydrocarbons to tropical reef systems.

  10. Development of black soldier fly (Diptera: Stratiomyidae) larvae fed dairy manure.


    Myers, Heidi M; Tomberlin, Jeffery K; Lambert, Barry D; Kattes, David


    Black soldier flies, Hermetia illucens L., are a common colonizer of animal wastes. However, all published development data for this species are from studies using artificial diets. This study represents the first examining black soldier fly development on animal wastes. Additionally, this study examined the ability of black soldier fly larvae to reduce dry matter and associated nutrients in manure. Black soldier fly larvae were fed four rates of dairy manure to determine their effects on larval and adult life history traits. Feed rate affected larval and adult development. Those fed less ration daily weighed less than those fed a greater ration. Additionally, larvae provided the least amount of dairy manure took longer to develop to the prepupal stage; however, they needed less time to reach the adult stage. Adults resulting from larvae provided 27 g dairy manure/d lived 3-4 d less than those fed 70 g dairy manure. Percentage survivorship to the prepupal or adult stages did not differ across treatments. Larvae fed 27 g dairy manure daily reduced manure dry matter mass by 58%, whereas those fed 70 g daily reduced dry matter 33%. Black soldier fly larvae were able to reduce available P by 61-70% and N by 30-50% across treatments. Based on results from this study, the black soldier fly could be used to reduce wastes and associated nutrients in confined bovine facilities.

  11. LARVA: an integrative framework for large-scale analysis of recurrent variants in noncoding annotations

    PubMed Central

    Lochovsky, Lucas; Zhang, Jing; Fu, Yao; Khurana, Ekta; Gerstein, Mark


    In cancer research, background models for mutation rates have been extensively calibrated in coding regions, leading to the identification of many driver genes, recurrently mutated more than expected. Noncoding regions are also associated with disease; however, background models for them have not been investigated in as much detail. This is partially due to limited noncoding functional annotation. Also, great mutation heterogeneity and potential correlations between neighboring sites give rise to substantial overdispersion in mutation count, resulting in problematic background rate estimation. Here, we address these issues with a new computational framework called LARVA. It integrates variants with a comprehensive set of noncoding functional elements, modeling the mutation counts of the elements with a β-binomial distribution to handle overdispersion. LARVA, moreover, uses regional genomic features such as replication timing to better estimate local mutation rates and mutational hotspots. We demonstrate LARVA's effectiveness on 760 whole-genome tumor sequences, showing that it identifies well-known noncoding drivers, such as mutations in the TERT promoter. Furthermore, LARVA highlights several novel highly mutated regulatory sites that could potentially be noncoding drivers. We make LARVA available as a software tool and release our highly mutated annotations as an online resource ( PMID:26304545

  12. Maintained larval growth in mussel larvae exposed to acidified under-saturated seawater.


    Ventura, Alexander; Schulz, Sabrina; Dupont, Sam


    Ocean acidification (OA) is known to affect bivalve early life-stages. We tested responses of blue mussel larvae to a wide range of pH in order to identify their tolerance threshold. Our results confirmed that decreasing seawater pH and decreasing saturation state increases larval mortality rate and the percentage of abnormally developing larvae. Virtually no larvae reared at average pHT 7.16 were able to feed or reach the D-shell stage and their development appeared to be arrested at the trochophore stage. However larvae were capable of reaching the D-shell stage under milder acidification (pHT ≈ 7.35, 7.6, 7.85) including in under-saturated seawater with Ωa as low as 0.54 ± 0.01 (mean ± s. e. m.), with a tipping point for normal development identified at pHT 7.765. Additionally growth rate of normally developing larvae was not affected by lower pHT despite potential increased energy costs associated with compensatory calcification in response to increased shell dissolution. Overall, our results on OA impacts on mussel larvae suggest an average pHT of 7.16 is beyond their physiological tolerance threshold and indicate a shift in energy allocation towards growth in some individuals revealing potential OA resilience.

  13. Acute ecotoxicology of natural oil and gas condensate to coral reef larvae

    PubMed Central

    Negri, Andrew P.; Brinkman, Diane L.; Flores, Florita; Botté, Emmanuelle S.; Jones, Ross J.; Webster, Nicole S.


    Risks posed by oil spills to coral reefs are difficult to evaluate, partially due to the absence of studies that adequately assess toxicity to relevant coral reef species. Here we experimentally tested the acute toxicity of condensate, representing a fraction of light crude oil, to coral (Acropora tenuis) and sponge (Rhopaloeides odorabile) larvae. The metamorphosis of coral larvae was inhibited at total petroleum aromatic hydrocarbon (TPAH) concentrations of water accommodated fractions (WAF) as low as 103 μg l−1, similar to concentrations detected in seawater following large spills. The sensitivity of coral larvae increased by 40% when co-exposed to UV light that they might encounter in shallow reefal systems. Condensate WAF was more toxic to coral larvae than predicted by summing the toxicity of its main components (benzene, toluene, p-xylene and napthalene). In contrast, the sensitivity of sponge larvae to condensate WAF (>10,000 μg l−1 TPAH) was far less than coral in the presence and absence of UV, but similar to that of other marine invertebrates. While these results highlight the relative sensitivity of coral larvae to oil, further research is needed to better understand and predict the impacts and risks posed by hydrocarbons to tropical reef systems. PMID:26892387

  14. Acute ecotoxicology of natural oil and gas condensate to coral reef larvae.


    Negri, Andrew P; Brinkman, Diane L; Flores, Florita; Botté, Emmanuelle S; Jones, Ross J; Webster, Nicole S


    Risks posed by oil spills to coral reefs are difficult to evaluate, partially due to the absence of studies that adequately assess toxicity to relevant coral reef species. Here we experimentally tested the acute toxicity of condensate, representing a fraction of light crude oil, to coral (Acropora tenuis) and sponge (Rhopaloeides odorabile) larvae. The metamorphosis of coral larvae was inhibited at total petroleum aromatic hydrocarbon (TPAH) concentrations of water accommodated fractions (WAF) as low as 103 μg l(-1), similar to concentrations detected in seawater following large spills. The sensitivity of coral larvae increased by 40% when co-exposed to UV light that they might encounter in shallow reefal systems. Condensate WAF was more toxic to coral larvae than predicted by summing the toxicity of its main components (benzene, toluene, p-xylene and napthalene). In contrast, the sensitivity of sponge larvae to condensate WAF (>10,000 μg l(-1) TPAH) was far less than coral in the presence and absence of UV, but similar to that of other marine invertebrates. While these results highlight the relative sensitivity of coral larvae to oil, further research is needed to better understand and predict the impacts and risks posed by hydrocarbons to tropical reef systems.

  15. A Determination of Metallothionein in Larvae of Freshwater Midges (Chironomus riparius) Using Brdicka Reaction

    PubMed Central

    Fabrik, Ivo; Ruferova, Zuzana; Hilscherova, Klara; Adam, Vojtech; Trnkova, Libuse; Kizek, Rene


    Among wide spectrum of biomolecules induced by various stress factors low molecular mass protein called metallothionein (MT) is suitable for assessment of the heavy metal environmental pollution. The aim of this work was to determine the metallothionein and total thiols content in larvae of freshwater midges (Chironomus riparius) sampled from laboratory exposure to cadmium(II) ions and from field studies using differential pulse voltammetry Brdicka reaction. Unique electrochemical instrument, stationary electrochemical analyser Autolab coupled with autosampler, was utilized for the analysis of the samples. The detection limit for MT was evaluated as 5 nM. The larvae exposed to two doses (50 ng/g or 50 μg/g) of cadmium(II) ions for fifteen days under laboratory controlled conditions were at the end of the exposure killed, homogenized and analysed. MT content in control samples was 1.2 μM, in larvae exposed to 50 ng Cd/g it was 2.0 μM and in larvae exposed to 50 μg Cd/g 2.9 μM. Moreover at field study chironomid larvae as well as sediment samples have been collected from eight field sites with different levels of pollution by heavy. The metals content (chromium, nickel, copper, zinc, arsenic, molybdenum, cadmium, tin and lead) in the sediment and or MT content in the chironomid larvae were determined by inductively coupled plasma mass spectrometry or Brdicka reaction, respectively. PMID:27879923

  16. Cyathostomin larvae: presence on Brachiaria humidicola grass during the rainy and dry seasons of Brazil.


    dos Santos, Claudia Navarro; de Souza, Luciene Soares; Vieira, Vivian Suane de Freitas; Pinheiro, Jairo; Rodrigues, Maria de Lurdes de Azevedo


    The presence of cyathostomin larvae is directly associated to climatic conditions of each region. This study aimed to evaluate the ecology of infective larvae on Brachiaria humidicola during the dry and rainy seasons from October 2007 to September 2008 in a tropical region, Rio de Janeiro state, southeastern Brazil. Stools were collected from the rectum of horses naturally infected with cyathostomins at the beginning of the rainy season (October to March) and dry season (April to September). They were divided into four samples of 500 g and deposited on a grass patch of B. humidicola. Seven days later and every 15 days thereafter samples of feces and grass were collected and processed by the Baermann technique. The mean number of larvae recovered from the grass varied according to the season, with greater recovery of larvae during the peak of the dry season (14,700¹ DM). There was a statistically significant difference between L3 recovered from feces and grass, but not between L3 recovered from the grass base and apex. These results show that the region's climate favors the development and survival of infective cyathostomin larvae throughout the year, with a greater number of larvae during the dry season.

  17. A 2D virtual reality system for visual goal-driven navigation in zebrafish larvae.


    Jouary, Adrien; Haudrechy, Mathieu; Candelier, Raphaël; Sumbre, German


    Animals continuously rely on sensory feedback to adjust motor commands. In order to study the role of visual feedback in goal-driven navigation, we developed a 2D visual virtual reality system for zebrafish larvae. The visual feedback can be set to be similar to what the animal experiences in natural conditions. Alternatively, modification of the visual feedback can be used to study how the brain adapts to perturbations. For this purpose, we first generated a library of free-swimming behaviors from which we learned the relationship between the trajectory of the larva and the shape of its tail. Then, we used this technique to infer the intended displacements of head-fixed larvae, and updated the visual environment accordingly. Under these conditions, larvae were capable of aligning and swimming in the direction of a whole-field moving stimulus and produced the fine changes in orientation and position required to capture virtual prey. We demonstrate the sensitivity of larvae to visual feedback by updating the visual world in real-time or only at the end of the discrete swimming episodes. This visual feedback perturbation caused impaired performance of prey-capture behavior, suggesting that larvae rely on continuous visual feedback during swimming.

  18. Maintained larval growth in mussel larvae exposed to acidified under-saturated seawater

    PubMed Central

    Ventura, Alexander; Schulz, Sabrina; Dupont, Sam


    Ocean acidification (OA) is known to affect bivalve early life-stages. We tested responses of blue mussel larvae to a wide range of pH in order to identify their tolerance threshold. Our results confirmed that decreasing seawater pH and decreasing saturation state increases larval mortality rate and the percentage of abnormally developing larvae. Virtually no larvae reared at average pHT 7.16 were able to feed or reach the D-shell stage and their development appeared to be arrested at the trochophore stage. However larvae were capable of reaching the D-shell stage under milder acidification (pHT ≈ 7.35, 7.6, 7.85) including in under-saturated seawater with Ωa as low as 0.54 ± 0.01 (mean ± s. e. m.), with a tipping point for normal development identified at pHT 7.765. Additionally growth rate of normally developing larvae was not affected by lower pHT despite potential increased energy costs associated with compensatory calcification in response to increased shell dissolution. Overall, our results on OA impacts on mussel larvae suggest an average pHT of 7.16 is beyond their physiological tolerance threshold and indicate a shift in energy allocation towards growth in some individuals revealing potential OA resilience. PMID:27020613

  19. Using parasitic trematode larvae to quantify an elusive vertebrate host.


    Byers, James E; Altman, Irit; Grosse, Andrew M; Huspeni, Todd C; Maerz, John C


    Digenean trematode parasites require multiple host species to complete their life cycles, and their abundance can often be strongly correlated with the abundance of their host species. Species richness and abundance of parasites in easily sampled host species may yield an accurate estimate of the species richness and abundance of other hosts in a parasite's life cycle that are difficult to survey directly. Accordingly, we investigated whether prevalence and mean abundance of trematodes could be used to estimate the abundance of one of their host species, diamondback terrapins (Malaclemys terrapin), which are difficult to sample and are designated as near threatened (by the International Union for Conservation of Nature [IUCN Red List]) along some U.S. coasts. As an adult the trematode Pleurogonius malaclemys is specific to terrapins. Its larval stages live first inside mud snails (Ilyanassa obsoleta) and are subsequently shed into the environment where they form external metacercarial cysts on hard surfaces such as snail opercula. The life cycle of P. malaclemys is completed when terrapins ingest these cysts. At 12 sites along the coast of Georgia (U.S.A.), we determined the prevalence of internal P. malaclemys larvae in mud snails (proportion of infected snails in a population) and the prevalence and mean abundance of external trematode cysts. We examined whether these data were correlated with terrapin abundance, which we estimated with mark-recapture methods. The abundance of external cysts and salinity explained ≥59% of the variability in terrapin abundance. We suggest that dependent linkages between the life stages of multihost parasites make them reliable predictors of host species' abundance, including hosts with abundances that are challenging to quantify directly.

  20. A transcriptomic survey of Migdolus fryanus (sugarcane rhizome borer) larvae

    PubMed Central

    Nakayama, Darlan Gonçalves; Santos Júnior, Célio Dias; Kishi, Luciano Takeshi; Pedezzi, Rafael; Santiago, Adelita Carolina; Soares-Costa, Andrea; Henrique-Silva, Flavio


    Sugarcane, a major crop grown in the tropical and subtropical areas of the world, is produced mainly for sucrose, which is used as a sweetener or for the production of bioethanol. Among the numerous pests that significantly affect the yield of sugarcane, the sugarcane rhizome borer (Migdolus fryanus, a cerambycidae beetle) is known to cause severe damage to the crops in Brazil. The absence of molecular information about this insect reinforces the need for studies and an effective method to control this pest. In this study, RNA-Seq technology was employed to study different parts of M. fryanus larvae. The generated data will help in further investigations about the taxonomy, development, and adaptation of this insect. RNA was extracted from six different parts (head, fat body, integument, hindgut, midgut, and foregut) using Trizol methodology. Using Illumina paired-end sequencing technology and the Trinity platform, trimming and de novo assembly was performed, resulting in 44,567 contigs longer than 200 nt for a reunion of data from all transcriptomes, with a mean length of 1,095.27 nt. Transcripts were annotated using BLAST against different protein databanks (Uniprot/Swissprot, PFAM, KEEG, SignalP 4.1, Gene Ontology, and CAZY) and were compared for similarity using a Venn diagram. Differential expression patterns were studied for select genes through qPCR and FPKM comprising important protein families (digestive peptidases, glucosyl hydrolases, serine protease inhibitors and otopetrin), which allowed a better understanding of the insect’s digestion, immunity and gravity sensorial mechanisms. PMID:28248990

  1. Electroretinogram Analysis of the Visual Response in Zebrafish Larvae

    PubMed Central

    Chrispell, Jared D.; Rebrik, Tatiana I.; Weiss, Ellen R.


    The electroretinogram (ERG) is a noninvasive electrophysiological method for determining retinal function. Through the placement of an electrode on the surface of the cornea, electrical activity generated in response to light can be measured and used to assess the activity of retinal cells in vivo. This manuscript describes the use of the ERG to measure visual function in zebrafish. Zebrafish have long been utilized as a model for vertebrate development due to the ease of gene suppression by morpholino oligonucleotides and pharmacological manipulation. At 5-10 dpf, only cones are functional in the larval retina. Therefore, the zebrafish, unlike other animals, is a powerful model system for the study of cone visual function in vivo. This protocol uses standard anesthesia, micromanipulation and stereomicroscopy protocols that are common in laboratories that perform zebrafish research. The outlined methods make use of standard electrophysiology equipment and a low light camera to guide the placement of the recording microelectrode onto the larval cornea. Finally, we demonstrate how a commercially available ERG stimulator/recorder originally designed for use with mice can easily be adapted for use with zebrafish. ERG of larval zebrafish provides an excellent method of assaying cone visual function in animals that have been modified by morpholino oligonucleotide injection as well as newer genome engineering techniques such as Zinc Finger Nucleases (ZFNs), Transcription Activator-Like Effector Nucleases (TALENs), and Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/Cas9, all of which have greatly increased the efficiency and efficacy of gene targeting in zebrafish. In addition, we take advantage of the ability of pharmacological agents to penetrate zebrafish larvae to evaluate the molecular components that contribute to the photoresponse. This protocol outlines a setup that can be modified and used by researchers with various experimental goals. PMID

  2. Ca2+ dynamics along identified synaptic terminals in Drosophila larvae.


    Lnenicka, Gregory A; Grizzaffi, Jeffrey; Lee, Bomi; Rumpal, Nidhi


    Changes in intracellular Ca2+ concentration ([Ca2+]i) play an important role in the function and plasticity of synapses. We characterized the changes in [Ca2+]i produced by action potentials (APs) along two identified motor terminals found on separate muscle fibers in Drosophila larvae and examined factors that influence the amplitude and duration of the residual Ca2+ signal. We were able to measure Ca2+ transients produced along terminals by both single APs and AP trains using Oregon Green 488 BAPTA-1 and streaming images at 20-50 Hz. The decay of [Ca2+]i after single APs or AP trains was well fit by a single exponential. For single APs, the Ca2+ transient amplitude and decay rate were similar at boutons and bottleneck regions and much smaller at the axon. Also, the amplitude of single-AP Ca2+ transients was inversely correlated with bouton width. During AP trains, the increase in [Ca2+]i became more uniform: the difference in boutons and axons was reduced, and the increase in [Ca2+]i was not correlated with bouton width. The [Ca2+]i decay tau was directly correlated with bouton width for both single APs and AP trains. For one terminal, distal boutons had larger single-AP Ca2+ transients than proximal ones, probably attributable to greater Ca2+ influx for distal boutons. Pharmacological studies showed that Ca2+ clearance from these synaptic terminals after single APs and AP trains was primarily attributable to Ca2+ extrusion by the plasma membrane Ca2+ ATPase (PMCA). Immunostaining of larval muscle fibers showed high levels of the PMCA at the neuromuscular junction.

  3. Electroretinogram analysis of the visual response in zebrafish larvae.


    Chrispell, Jared D; Rebrik, Tatiana I; Weiss, Ellen R


    The electroretinogram (ERG) is a noninvasive electrophysiological method for determining retinal function. Through the placement of an electrode on the surface of the cornea, electrical activity generated in response to light can be measured and used to assess the activity of retinal cells in vivo. This manuscript describes the use of the ERG to measure visual function in zebrafish. Zebrafish have long been utilized as a model for vertebrate development due to the ease of gene suppression by morpholino oligonucleotides and pharmacological manipulation. At 5-10 dpf, only cones are functional in the larval retina. Therefore, the zebrafish, unlike other animals, is a powerful model system for the study of cone visual function in vivo. This protocol uses standard anesthesia, micromanipulation and stereomicroscopy protocols that are common in laboratories that perform zebrafish research. The outlined methods make use of standard electrophysiology equipment and a low light camera to guide the placement of the recording microelectrode onto the larval cornea. Finally, we demonstrate how a commercially available ERG stimulator/recorder originally designed for use with mice can easily be adapted for use with zebrafish. ERG of larval zebrafish provides an excellent method of assaying cone visual function in animals that have been modified by morpholino oligonucleotide injection as well as newer genome engineering techniques such as Zinc Finger Nucleases (ZFNs), Transcription Activator-Like Effector Nucleases (TALENs), and Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/Cas9, all of which have greatly increased the efficiency and efficacy of gene targeting in zebrafish. In addition, we take advantage of the ability of pharmacological agents to penetrate zebrafish larvae to evaluate the molecular components that contribute to the photoresponse. This protocol outlines a setup that can be modified and used by researchers with various experimental goals.

  4. Optogenetic Control of Serotonin and Dopamine Release in Drosophila Larvae

    PubMed Central


    Optogenetic control of neurotransmitter release is an elegant method to investigate neurobiological mechanisms with millisecond precision and cell type-specific resolution. Channelrhodopsin-2 (ChR2) can be expressed in specific neurons, and blue light used to activate those neurons. Previously, in Drosophila, neurotransmitter release and uptake have been studied after continuous optical illumination. In this study, we investigated the effects of pulsed optical stimulation trains on serotonin or dopamine release in larval ventral nerve cords. In larvae with ChR2 expressed in serotonergic neurons, low-frequency stimulations produced a distinct, steady-state response while high-frequency patterns were peak shaped. Evoked serotonin release increased with increasing stimulation frequency and then plateaued. The steady-state response and the frequency dependence disappeared after administering the uptake inhibitor fluoxetine, indicating that uptake plays a significant role in regulating the extracellular serotonin concentration. Pulsed stimulations were also used to evoke dopamine release in flies expressing ChR2 in dopaminergic neurons and similar frequency dependence was observed. Release due to pulsed optical stimulations was modeled to determine the uptake kinetics. For serotonin, Vmax was 0.54 ± 0.07 μM/s and Km was 0.61 ± 0.04 μM; and for dopamine, Vmax was 0.12 ± 0.03 μM/s and Km was 0.45 ± 0.13 μM. The amount of serotonin released per stimulation pulse was 4.4 ± 1.0 nM, and the amount of dopamine was 1.6 ± 0.3 nM. Thus, pulsed optical stimulations can be used to mimic neuronal firing patterns and will allow Drosophila to be used as a model system for studying mechanisms underlying neurotransmission. PMID:24849718

  5. A parvo-like virus persistently infecting a C6/36 clone of Aedes albopictus mosquito cell line and pathogenic for Aedes aegypti larvae.


    Jousset, F X; Barreau, C; Boublik, Y; Cornet, M


    We have isolated and partially characterized from an apparently healthy C6/36 subclone of Aedes albopictus cell line a small icosahedral non-enveloped DNA virus, designated AaPV. This virus proved to be highly pathogenic for Aedes aegypti neonate larvae. Viral infection persisted for over 4 years in the cell culture without any cytopathic effect. Attempts to infect suckling mice, Drosophila melanogaster adults and Spodoptera littoralis larvae with AaPV were unsuccessful. Similarly, the AaPV failed to replicate in vertebrate and Drosophila cell lines. Virions, about 22 nm in diameter, had a buoyant density of 1.43 g/cm3 and contained three capsid polypeptides with molecular weights of 53, 41 and 40 kDa. A preliminary study of the viral genome indicated the presence of single-stranded DNA. By its biophysical and biochemical properties, this virus appears to be related to the genus Densovirus within the family Parvoviridae, but lacks serological relationships with the other members of this genus.

  6. Extraction of gunshot residues from the larvae of the forensically important blowfly Calliphora dubia (Macquart) (Diptera: Calliphoridae).


    Roeterdink, Evan M; Dadour, Ian R; Watling, R John


    Whole body concentrations of lead (Pb), barium (Ba) and antimony (Sb) were determined in larvae of the blowfly Calliphora dubia (Macquart) (Diptera: Calliphoridae) removed from a piece of beef shot and contaminated with gunshot residue and compared with the concentrations detected within larvae feeding on a control piece of beef. Whole larvae were taken into solution and analysed using inductively coupled plasma-mass spectrometry (ICP-MS). Significantly higher concentrations of Pb, Ba and Sb were detected within the larvae feeding on the shot piece of beef compared with larvae that were feeding on the control piece of beef. Initial results indicate that the concentrations of Pb and Sb within the larvae decrease as the duration of feeding increases, whereas Ba concentrations appear to increase, suggesting a bioaccumulation of Ba within the larvae. The second part of this experiment investigated the depuration of Pb, Ba and Sb from the larvae following removal of the gunshot residue source. A significant reduction in Pb, Ba and Sb concentrations within the larvae was observed following the transfer of larvae from the shot piece of beef to the control piece of beef.

  7. Desiccation resistance in pre-diapause, diapause and post-diapause larvae of Choristoneura fumiferana (Lepidoptera: Tortricidae).


    Bauce E; Han, E


    Desiccation resistance was examined in pre-diapause, diapause and post-diapause larvae of the spruce budworm, Choristoneura fumiferana (Clemens), in terms of passive water evaporation under three desiccation conditions: freeze-drying, desiccant-drying at 2 degrees C and desiccant-drying at 18 degrees C. Diapausing second instar larvae and post-diapause non-feeding second instar larvae showed strongest desiccation resistance: a significant amount of water was retained after repeated drying under desiccating conditions, while pre-diapause first instar larvae and post-diapause feeding second instar larvae lost almost all their water content after one or two drying cycles. A hibernaculum covering had no effect on water evaporation. While dead larvae tended to lose significantly more water than their living counterparts, particularly among first instar larvae, such an impact was much weaker among diapausing second instar larvae. Desiccation resistance was lost when post-diapause second instar larvae were allowed access to water while the level of desiccation resistance was maintained or enhanced when the larvae did not have access to water. These results are discussed in the context of overwintering ecology of the species and possible mechanisms for the desiccation resistance are also discussed.

  8. Growth and survival of blowfly Lucilia sericata larvae under simulated wound conditions: implications for maggot debridement therapy.


    Čičková, H; Kozánek, M; Takáč, P


    Maggot debridement therapy has become a well-established method of wound debridement. Despite its success, little information is available about the optimum duration of the treatment cycle and larval growth in wounds. This study examines the development of Lucilia sericata (Diptera: Calliphoridae) larvae under two containment conditions (bagged and free range) under simulated wound conditions and assesses the impact of transport and further storage of larvae on their survival and growth. There was no significant difference in size between bagged and free-range larvae over the 72-h experimental period. Larvae grew fastest 8-24 h after inoculation and completed their growth at 40-48 h. Mortality rates were similar (0.12-0.23% per hour) in both containment conditions and did not differ significantly (P = 0.3212). Survival of free-range larvae was on average 16% lower than survival of bagged larvae. Refrigeration of larvae upon simulated delivery for > 1 day reduced their survival to < 50% and caused a reduction in growth of up to 30% at 12 h, but not at 48 h, of incubation. Therefore, it is recommended that free-range larvae are left in the wound for a maximum of 40-48 h, and bagged larvae for 48-72 h. Larvae should be used within 24 h of delivery to avoid high mortality caused by prolonged refrigeration.

  9. Presence of anisakid larvae in the European anchovy, Engraulis encrasicolus, fished off the Tyrrhenian coast of central Italy.


    De Liberato, Claudio; Bossù, Teresa; Scaramozzino, Paola; Nicolini, Giuseppe; Ceddia, Pietro; Mallozzi, Salvatore; Cavallero, Serena; D'Amelio, Stefano


    A survey was carried out to determine the prevalence of anisakid nematode larvae in European anchovy (Engraulis encrasicolus) fished off the Tyrrhenian coast of central Italy. From February through July 2012, 1,490 specimens of E. encrasicolus caught in three different fishing areas (off Civitavecchia, Anzio, and Gaeta in the northern, central, and southern Lazio region of Italy, respectively) were tested for the presence of anisakid larvae, both by visual microscopic inspection and enzymatic digestion. In each of the three fishing areas, each of two sampling times produced 250 fish (with the exception of one sampling time in Gaeta that produced 240 fish). Larvae of the family Anisakidae were detected with an overall estimated prevalence of 2.3%, and each positive fish harbored a single larva. No anisakid larvae were detected in fish caught off Gaeta. Fish with larvae were significantly longer (standard length) than fish without larvae. Twenty-six larvae (74.3%) were detected by visual inspection of the viscera, eight larvae (22.8%) were detected by visual inspection of the fillets, and one larva (2.8%) was detected after digestion of pooled fillets. Molecular analysis to fully characterize the 35 detected larvae revealed 15 specimens of Anisakis pegreffii, 10 specimens of Hysterothylacium aduncum, and one hybrid genotype of A. pegreffii × Anisakis simplex. For nine specimens, no visible product was obtained after PCR amplification. The overall prevalence for A. pegreffii and H. aduncum was 1.0 and 0.7%, respectively. A comparison between fishes harboring A. pegreffii larvae and those harboring H. aduncum revealed that those with A. pegreffii were significantly heavier. The prevalence of anisakid larvae found in the present study is lower then that reported previously in E. encrasicolus collected in the Mediterranean Sea.

  10. The larva of the genus Palaeosynthemis Förster, 1903 (Odonata: Anisoptera: Synthemistidae) and a generic key to the larvae of non-New Caledonian Synthemistidae.


    Fleck, Günther; El Adouzi, Marine


    The larva of Palaeosynthemis Förster, 1903, based on P. cyrene (Lieftinck, 1953), is described and illustrated for the first time. A diagnosis of the genus is given. A larval generic key to all known non-New Caledonian genera of Synthemistidae is provided.

  11. Effects of different concentrations of crude oil on first feeding larvae of Atlantic herring ( Clupea harengus)

    NASA Astrophysics Data System (ADS)

    Ingvarsdóttir, A.; Bjørkblom, C.; Ravagnan, E.; Godal, B. F.; Arnberg, M.; Joachim, D. L.; Sanni, S.


    Studies have shown that exposure to Polycyclic Aromatic Hydrocarbons (PAHs) and other oil related components alter normal fish larvae development and can cause increased mortality in early life stages. Modelling of results from controlled laboratory exposure experiments will help relate typical oil exposure parameters (biomarkers) to field observations and are valuable tools for oil exposure monitoring and risk assessment. Post yolk sack larval stages of Atlantic herring were exposed to different concentrations of dispersed Arctic crude oil. The selected nominal concentrations were 0.015, 0.040, 0.060, 0.250 and 0.750 mg l - 1 raw dispersed oil (0.129, 0.373, 0.496, 2.486 and 6.019 μg l - 1 Total Polycyclic Aromatic Hydrocarbons (TPAH) respectively), and control seawater in flow through systems. The larvae were exposed for 12 days and daily mortality recorded in all treatments. Thereafter, the larvae were transported to two large (300 l) rearing tanks, one for control/trace oil and one for oil exposed larvae. The larvae were allowed to recover for 8 weeks after exposure, and mortality and morphological factors then assessed, giving preliminary information on recovery of Atlantic herring larvae after oil exposure. Throughout the testing period, there was a general trend for higher mortality of herring larvae in the oil exposure concentrations than in control, and significantly higher mortality was found in all oil concentrations than in the control after 12 days. We did not detect a clear dose related mortality for our test concentrations, except for the highest concentration. There was no difference found in mortality rates of the herring larvae from either the oil or control/trace oil batch during the recovery phase during the following 60 days. Morphological observations of the herring larvae after 2 months recovery in clean seawater showed that the oil exposed larvae had morphological features that could be described as deformities, and growth was found to be

  12. Effects of phenol on metabolic activities and transcription profiles of cytochrome P450 enzymes in Chironomus kiinensis larvae.


    Cao, C W; Sun, L L; Niu, F; Liu, P; Chu, D; Wang, Z Y


    Phenol, also known as carbolic acid or phenic acid, is a priority pollutant in aquatic ecosystems. The present study has investigated metabolic activities and transcription profiles of cytochrome P450 enzymes in Chironomus kiinensis under phenol stress. Exposure of C. kiinensis larvae to three sublethal doses of phenol (1, 10 and 100 µM) inhibited cytochrome P450 enzyme activity during the 96 h exposure period. The P450 activity measured after the 24 h exposure to phenol stress could be used to assess the level (low or high) of phenol contamination in the environment. To investigate the potential of cytochrome P450 genes as molecular biomarkers to monitor phenol contamination, the cDNA of ten CYP6 genes from the transcriptome of C. kiinensis were identified and sequenced. The open reading frames of the CYP6 genes ranged from 1266 to 1587 bp, encoding deduced polypeptides composed of between 421 and 528 amino acids, with predicted molecular masses from 49.01 to 61.94 kDa and isoelectric points (PI) from 6.01 to 8.89. Among the CYP6 genes, the mRNA expression levels of the CYP6EW3, CYP6EV9, CYP6FV1 and CYP6FV2 genes significantly altered in response to phenol exposure; therefore, these genes could potentially serve as biomarkers in the environment. This study shows that P450 activity combined with one or multiple CYP6 genes could be used to monitor phenol pollution.

  13. Bioactivity Evaluation of Plant Extracts Used in Indigenous Medicine against the Snail, Biomphalaria glabrata, and the Larvae of Aedes aegypti

    PubMed Central

    dos Santos, Edilson Alves; de Carvalho, Cenira M.; Costa, Ana L. S.; Conceição, Adilva S.; Moura, Flávia de B. Prado; Santana, Antônio Euzébio Goulart


    This investigation examined the molluscicidal and larvicidal activity of eight plants that are used in the traditional medicine of the Pankararé indigenous people in the Raso da Catarina region, Bahia state, Brazil. The tested plants were chosen based on the results of previous studies. Only those plants that were used either as insect repellents or to treat intestinal parasitic infections were included in the study. Crude extracts (CEs) of these plants were tested for their larvicidal activity (against Aedes aegypti larvae in the fourth instar) and molluscicidal activity (against the snail Biomphalaria glabrata). The plant species Scoparia dulcis and Helicteres velutina exhibited the best larvicidal activities (LC50 83.426 mg/L and LC50 138.896 mg/L, resp.), and Poincianella pyramidalis, Chenopodium ambrosoides, and Mimosa tenuiflora presented the best molluscicidal activities (LC50 0.94 mg/L, LC50 13.51 mg/L, and LC50 20.22 mg/L, resp.). As we used crude extracts as the tested materials, further study is warranted to isolate and purify the most active compounds. PMID:22194773

  14. Molecular cloning of soluble trehalase from Chironomus riparius larvae, its heterologous expression in Escherichia coli and bioinformatic analysis.


    Forcella, Matilde; Mozzi, Alessandra; Bigi, Alessandra; Parenti, Paolo; Fusi, Paola


    Trehalase is involved in the control of trehalose concentration, the main blood sugar in insects. Here, we describe the molecular cloning of the cDNA encoding for the soluble form of the trehalase from the midge larvae of Chironomus riparius, a well-known bioindicator of the quality of freshwater environments. Molecular cloning was achieved through multiple alignment of Diptera trehalase sequences, allowing the synthesis of internal homology-based primers; the complete open reading frame(ORF) was subsequently obtained through RACE-PCR(where RACE is rapid amplification of cDNA ends). The cDNA contained the 5' untranslated region (UTR), the 3' UTR including a poly(A) tail and the ORF of 1,725 bp consisting of 574 amino acid residues with a predicted molecular mass of 65,778 Da. Recombinant trehalase was successfully expressed in Escherichia coli as a His-tagged protein and purified on Ni-NTA affinity chromatography. Primary structure analysis showed a series of characteristic features shared by all insect trehalases, while three-dimensional structure prediction yielded the typical glucosidase fold, the two key residues involved in the catalytic mechanism being conserved. Production of recombinant insect trehalases opens the way to structural characterizations of the catalytic site, which might represent, among others, an element for reconsidering the enzyme as a target in pest insects' control.

  15. PFOS Induces Behavioral Alterations, Including Spontaneous Hyperactivity That Is Corrected by Dexamfetamine in Zebrafish Larvae

    PubMed Central

    Spulber, Stefan; Kilian, Pascal; Wan Ibrahim, Wan Norhamidah; Onishchenko, Natalia; Ulhaq, Mazhar; Norrgren, Leif; Negri, Sara; Di Tuccio, Marcello; Ceccatelli, Sandra


    Perfluorooctane sulfonate (PFOS) is a widely spread environmental contaminant. It accumulates in the brain and has potential neurotoxic effects. The exposure to PFOS has been associated with higher impulsivity and increased ADHD prevalence. We investigated the effects of developmental exposure to PFOS in zebrafish larvae, focusing on the modulation of activity by the dopaminergic system. We exposed zebrafish embryos to 0.1 or 1 mg/L PFOS (0.186 or 1.858 µM, respectively) and assessed swimming activity at 6 dpf. We analyzed the structure of spontaneous activity, the hyperactivity and the habituation during a brief dark period (visual motor response), and the vibrational startle response. The findings in zebrafish larvae were compared with historical data from 3 months old male mice exposed to 0.3 or 3 mg/kg/day PFOS throughout gestation. Finally, we investigated the effects of dexamfetamine on the alterations in spontaneous activity and startle response in zebrafish larvae. We found that zebrafish larvae exposed to 0.1 mg/L PFOS habituate faster than controls during a dark pulse, while the larvae exposed to 1 mg/L PFOS display a disorganized pattern of spontaneous activity and persistent hyperactivity. Similarly, mice exposed to 0.3 mg/kg/day PFOS habituated faster than controls to a new environment, while mice exposed to 3 mg/kg/day PFOS displayed more intense and disorganized spontaneous activity. Dexamfetamine partly corrected the hyperactive phenotype in zebrafish larvae. In conclusion, developmental exposure to PFOS in zebrafish induces spontaneous hyperactivity mediated by a dopaminergic deficit, which can be partially reversed by dexamfetamine in zebrafish larvae. PMID:24740186

  16. Proteomic and metabolomic analysis reveals rapid and extensive nicotine detoxification ability in honey bee larvae.


    du Rand, Esther E; Human, Hannelie; Smit, Salome; Beukes, Mervyn; Apostolides, Zeno; Nicolson, Susan W; Pirk, Christian W W


    Despite potential links between pesticides and bee declines, toxicology information on honey bee larvae (Apis mellifera) is scarce and detoxification mechanisms in this development stage are virtually unknown. Larvae are exposed to natural and synthetic toxins present in pollen and nectar through consumption of brood food. Due to the characteristic intensive brood care displayed by honey bees, which includes progressive feeding throughout larval development, it is generally assumed that larvae rely on adults to detoxify for them and exhibit a diminished detoxification ability. We found the opposite. We examined the proteomic and metabolomic responses of in vitro reared larvae fed nicotine (an alkaloid found in nectar and pollen) to understand how larvae cope on a metabolic level with dietary toxins. Larvae were able to effectively detoxify nicotine through an inducible detoxification mechanism. A coordinated stress response complemented the detoxification processes, and we detected significant enrichment of proteins functioning in energy and carbohydrate metabolism, as well as in development pathways, suggesting that nicotine may promote larval growth. Further exploration of the metabolic fate of nicotine using targeted mass spectrometry analysis demonstrated that, as in adult bees, formation of 4-hydroxy-4-(3-pyridyl) butanoic acid, the result of 2'C-oxidation of nicotine, is quantitatively the most significant pathway of nicotine metabolism. We provide conclusive evidence that larvae are capable of effectively catabolising a dietary toxin, suggesting that increased larval sensitivity to specific toxins is not due to diminished detoxification abilities. These findings broaden the current understanding of detoxification biochemistry at different organizational levels in the colony, bringing us closer to understanding the capacity of the colony as a superorganism to tolerate and resist toxic compounds, including pesticides, in the environment.

  17. Oxidative Stress and Digestive Enzyme Activity of Flatfish Larvae in a Changing Ocean.


    Pimentel, Marta S; Faleiro, Filipa; Diniz, Mário; Machado, Jorge; Pousão-Ferreira, Pedro; Peck, Myron A; Pörtner, Hans O; Rosa, Rui


    Until now, it is not known how the antioxidant and digestive enzymatic machinery of fish early life stages will change with the combined effects of future ocean acidification and warming. Here we show that high pCO2 (~1600 μatm) significantly decreased metabolic rates (up to 27.4 %) of flatfish larvae, Solea senegalensis, at both present (18 °C) and warmer temperatures (+4 °C). Moreover, both warming and hypercapnia increased the heat shock response and the activity of antioxidant enzymes, namely catalase (CAT) and glutathione S-transferase (GST), mainly in post-metamorphic larvae (30 dph). The lack of changes in the activity of CAT and GST of pre-metamorphic larvae (10 dph) seems to indicate that earlier stages lack a fully-developed antioxidant defense system. Nevertheless, the heat shock and antioxidant responses of post-metamorphic larvae were not enough to avoid the peroxidative damage, which was greatly increased under future environmental conditions. Digestive enzymatic activity of S. senegalensis larvae was also affected by future predictions. Hypercapnic conditions led to a decrease in the activity of digestive enzymes, both pancreatic (up to 26.1 % for trypsin and 74.5 % for amylase) and intestinal enzymes (up to 36.1 % for alkaline phosphatase) in post-metamorphic larvae. Moreover, the impact of ocean acidification and warming on some of these physiological and biochemical variables (namely, lower OCR and higher HSP and MDA levels) were translated into larvae performance, being significantly correlated with decreased larval growth and survival or increased incidence of skeletal deformities. The increased vulnerability of flatfish early life stages under future ocean conditions is expected to potentially determine recruitment and population dynamics in marine ecosystems.

  18. Sensory Flask Cells in Sponge Larvae Regulate Metamorphosis via Calcium Signaling.


    Nakanishi, Nagayasu; Stoupin, Daniel; Degnan, Sandie M; Degnan, Bernard M


    The Porifera (sponges) is one of the earliest phyletic lineages to branch off the metazoan tree. Although the body-plan of sponges is among the simplest in the animal kingdom and sponges lack nervous systems that communicate environmental signals to other cells, their larvae have sensory systems that generate coordinated responses to environmental cues. In eumetazoans (Cnidaria and Bilateria), the nervous systems of larvae often regulate metamorphosis through Ca(2+)-dependent signal transduction. In sponges, neither the identity of the receptor system that detects an inductive environmental cue (hereafter "metamorphic cues") nor the signaling system that mediates settlement and metamorphosis are known. Using a combination of behavioral assays and surgical manipulations, we show here that specialized epithelial cells-referred to as flask cells-enriched in the anterior third of the Amphimedon queenslandica larva are most likely to be the sensory cells that detect the metamorphic cues. Surgical removal of the region enriched in flask cells in a larva inhibits the initiation of metamorphosis. The flask cell has an apical sensory apparatus with a cilium surrounded by an apical F-actin-rich protrusion, and numerous vesicles, hallmarks of eumetazoan sensory-neurosecretory cells. We demonstrate that these flask cells respond to metamorphic cues by elevating intracellular Ca(2+) levels, and that this elevation is necessary for the initiation of metamorphosis. Taken together, these analyses suggest that sponge larvae have sensory-secretory epithelial cells capable of converting exogenous cues into internal signals via Ca(2+)-mediated signaling, which is necessary for the initiation of metamorphosis. Similarities in the morphology, physiology, and function of the sensory flask cells in sponge larvae with the sensory/neurosecretory cells in eumetazoan larvae suggest this sensory system predates the divergence of Porifera and Eumetazoa.

  19. Natural Populations of Shipworm Larvae Are Attracted to Wood by Waterborne Chemical Cues

    PubMed Central

    Toth, Gunilla B.; Larsson, Ann I.; Jonsson, Per R.; Appelqvist, Christin


    The life cycle of many sessile marine invertebrates includes a dispersive planktonic larval stage whose ability to find a suitable habitat in which to settle and transform into benthic adults is crucial to maximize fitness. To facilitate this process, invertebrate larvae commonly respond to habitat-related chemical cues to guide the search for an appropriate environment. Furthermore, small-scale hydrodynamic conditions affect dispersal of chemical cues, as well as swimming behavior of invertebrate larvae and encounter with potential habitats. Shipworms within the family Teredinidae are dependent on terrestrially derived wood in order to complete their life cycle, but very little is known about the cues and processes that promote settlement. We investigated the potential for remote detection of settling substrate via waterborne chemical cues in teredinid larvae through a combination of empirical field and laboratory flume experiments. Natural populations of teredinid larvae were significantly more abundant close to wooden structures enclosed in plankton net compared to empty control nets, clearly showing that shipworm larvae can sense and respond to chemical cues associated with suitable settling substrate in the field. However, the flume experiments, using ecologically relevant flow velocities, showed that the boundary layer around experimental wooden panels was thin and that the mean flow velocity exceeded larval swimming velocity approximately 5 mm (≈ 25 larval body lengths) from the panel surface. Therefore, we conclude that the scope for remote detection of waterborne cues is limited and that the likely explanation for the higher abundance of shipworm larvae associated with the wooden panels in the field is a response to a cue during or after attachment on, or very near, the substrate. Waterborne cues probably guide the larva in its decision to remain attached and settle, or to detach and continue swimming and drifting until the next encounter with a solid

  20. Sun Compass Orientation Helps Coral Reef Fish Larvae Return to Their Natal Reef

    PubMed Central

    Mouritsen, Henrik; Atema, Jelle; Kingsford, Michael J.; Gerlach, Gabriele


    Reef fish sustain populations on isolated reefs and show genetic diversity between nearby reefs even though larvae of many species are swept away from the natal site during pelagic dispersal. Retention or recruitment to natal reefs requires orientation capabilities that enable larvae to find their way. Although olfactory and acoustically based orientation has been implicated in homing when larvae are in the reef’s vicinity, it is still unclear how they cope with greater distances. Here we show evidence for a sun compass mechanism that can bring the larvae to the vicinity of their natal reef. In a circular arena, pre-settlement larvae and early settlers (<24 hours) of the cardinal fish, Ostorhinchus doederleini, showed a strong SSE directional swimming response, which most likely has evolved to compensate for the locally prevailing large scale NNW current drift. When fish were clock-shifted 6 hours, they changed their orientation by ca. 180° as predicted by the tropical sun curve at One Tree Island, i.e. they used a time-compensated sun compass. Furthermore, the fish oriented most consistently at times of the day when the sun azimuth is easy to determine. Microsatellite markers showed that the larvae that had just arrived at One Tree Island genetically belonged to either the local reef population or to Fitzroy Reef located 12 kilometers to the SSE. The use of a sun compass adds a missing long-distance link to the hierarchy of other sensory abilities that can direct larvae to the region of origin, including their natal reef. Predominant local recruitment, in turn, can contribute to genetic isolation and potential speciation. PMID:23840396

  1. Reduced size and starvation resistance in adult mosquitoes, Aedes notoscriptus, exposed to predation cues as larvae.


    van Uitregt, Vincent O; Hurst, Timothy P; Wilson, Robbie S


    1. Many prey organisms exhibit adaptive phenotypic plasticity in life-history traits that facilitate a better chance of survival in the presence of predators. The evolution of such plastic traits requires that the defensive phenotype incurs a cost in the absence of predation. 2. Model systems that are used to examine predator-induced defences are often organisms with complex life histories that only induce defences during the larval stage. While many studies have detected costs of inducible defences during the larval stage, detecting the costs of larval defences after metamorphosis is also important. 3. We examine the benefits and costs of inducible larval defences in the urban mosquito, Aedes notoscriptus, by rearing them in the presence and absence of predation cues. We compared survival of larvae inducing behavioural defences, when exposed to predation cues, in predation trials with predatory fish Hypseleotris galii to that of larvae reared in the absence predation cues. We also compared life-history traits of predator-exposed larvae to larvae reared in control conditions. 4. Larvae exposed to chemical predation cues limited activity and were able to avoid predation for longer in trials with H. galii. However, predator-exposed larvae suffered retarded larval growth and development, were smaller at metamorphosis and less resistant to starvation as adults. 5. While it is difficult to understand the 'fitness costs' that poorer starvation resistance might confer to adult mosquitoes, it is likely that smaller adult size of predator-exposed individuals would reduce fitness, particularly for females where body size limits the size of blood meal they could take to facilitate egg production. We suggest that the demonstrable costs of inducible defences in mosquito larvae make this a good system for testing theoretical models for the evolutionary maintenance of adaptive phenotypic plasticity.

  2. The First Complete 3D Reconstruction of a Spanish Fly Primary Larva (Lytta vesicatoria, Meloidae, Coleoptera)

    PubMed Central

    Ge, Si-Qin; Wipfler, Benjamin; Pohl, Hans; Hua, Yi; Ślipiński, Adam; Yang, Xing-Ke; Beutel, Rolf Georg


    The first detailed anatomical study of a primary larva of Meloidae is presented. Thereby techniques such as three-dimensional reconstructions, microtome sections, SEM (scanning electronic microscopy) and CLSM (confocal laser scanning microscopy) are applied. The structural features are discussed in the context of phylogeny, but also possible correlations with parasitism, phoresy and miniaturisation. The triungulin first instar larva is likely an apomorphy of Meloidae excl. Eleticinae and linked with a specialisation on acridoid eggs or larvae and provisions of bees. The campodeid body shape of Lytta and Meloinae is a groundplan feature of Meloidae, whereas a navicular body is an autapomorphy of the generally phoretic larvae of Nemognathinae. Head structures of Lytta and features of the postcephalic body are largely plesiomorphic. The musculature of the head is only moderately simplified while the one of the postcephalic body is well developed. Its thorax is largely characterised by plesiomorphies. The characteristics of the legs suggest phoretic habits, even though this does not apply to larvae of Lytta. It is conceivable that a phoretic behaviour is secondarily lost, together with some but not all morphological modifications related to it. Derived features of the abdomen of Meloidae are the complete loss of the fixed urogomphi (also missing in Rhipiphoridae and other related groups) and the presence of one or two conspicuous caudal bristles. Only few features of Lytta are shared with the parasitic larvae of Rhipiphoridae and Strepsiptera. These characteristics, which are possibly linked with specialised life habits, have obviously evolved independently. Miniaturisation effects are minimal in the larvae of Lytta. PMID:23300692

  3. The first complete 3D reconstruction of a Spanish fly primary larva (Lytta vesicatoria, Meloidae, Coleoptera).


    Ge, Si-Qin; Wipfler, Benjamin; Pohl, Hans; Hua, Yi; Slipiński, Adam; Yang, Xing-Ke; Beutel, Rolf Georg


    The first detailed anatomical study of a primary larva of Meloidae is presented. Thereby techniques such as three-dimensional reconstructions, microtome sections, SEM (scanning electronic microscopy) and CLSM (confocal laser scanning microscopy) are applied. The structural features are discussed in the context of phylogeny, but also possible correlations with parasitism, phoresy and miniaturisation. The triungulin first instar larva is likely an apomorphy of Meloidae excl. Eleticinae and linked with a specialisation on acridoid eggs or larvae and provisions of bees. The campodeid body shape of Lytta and Meloinae is a groundplan feature of Meloidae, whereas a navicular body is an autapomorphy of the generally phoretic larvae of Nemognathinae. Head structures of Lytta and features of the postcephalic body are largely plesiomorphic. The musculature of the head is only moderately simplified while the one of the postcephalic body is well developed. Its thorax is largely characterised by plesiomorphies. The characteristics of the legs suggest phoretic habits, even though this does not apply to larvae of Lytta. It is conceivable that a phoretic behaviour is secondarily lost, together with some but not all morphological modifications related to it. Derived features of the abdomen of Meloidae are the complete loss of the fixed urogomphi (also missing in Rhipiphoridae and other related groups) and the presence of one or two conspicuous caudal bristles. Only few features of Lytta are shared with the parasitic larvae of Rhipiphoridae and Strepsiptera. These characteristics, which are possibly linked with specialised life habits, have obviously evolved independently. Miniaturisation effects are minimal in the larvae of Lytta.

  4. Natural populations of shipworm larvae are attracted to wood by waterborne chemical cues.


    Toth, Gunilla B; Larsson, Ann I; Jonsson, Per R; Appelqvist, Christin


    The life cycle of many sessile marine invertebrates includes a dispersive planktonic larval stage whose ability to find a suitable habitat in which to settle and transform into benthic adults is crucial to maximize fitness. To facilitate this process, invertebrate larvae commonly respond to habitat-related chemical cues to guide the search for an appropriate environment. Furthermore, small-scale hydrodynamic conditions affect dispersal of chemical cues, as well as swimming behavior of invertebrate larvae and encounter with potential habitats. Shipworms within the family Teredinidae are dependent on terrestrially derived wood in order to complete their life cycle, but very little is known about the cues and processes that promote settlement. We investigated the potential for remote detection of settling substrate via waterborne chemical cues in teredinid larvae through a combination of empirical field and laboratory flume experiments. Natural populations of teredinid larvae were significantly more abundant close to wooden structures enclosed in plankton net compared to empty control nets, clearly showing that shipworm larvae can sense and respond to chemical cues associated with suitable settling substrate in the field. However, the flume experiments, using ecologically relevant flow velocities, showed that the boundary layer around experimental wooden panels was thin and that the mean flow velocity exceeded larval swimming velocity approximately 5 mm (≈ 25 larval body lengths) from the panel surface. Therefore, we conclude that the scope for remote detection of waterborne cues is limited and that the likely explanation for the higher abundance of shipworm larvae associated with the wooden panels in the field is a response to a cue during or after attachment on, or very near, the substrate. Waterborne cues probably guide the larva in its decision to remain attached and settle, or to detach and continue swimming and drifting until the next encounter with a solid

  5. Influences of acute ethanol exposure on locomotor activities of zebrafish larvae under different illumination.


    Guo, Ning; Lin, Jia; Peng, Xiaolan; Chen, Haojun; Zhang, Yinglan; Liu, Xiuyun; Li, Qiang


    Larval zebrafish present unique opportunities to study the behavioral responses of a model organism to environmental challenges during early developmental stages. The purpose of the current study was to investigate the locomotor activities of AB strain zebrafish larvae at 5 and 7 days post-fertilization (dpf) in response to light changes under the influence of ethanol, and to explore potential neurological mechanisms that are involved in ethanol intoxication. AB strain zebrafish larvae at both 5 and 7 dpf were treated with ethanol at 0% (control), 0.1%, 0.25%, 0.5%, 1%, and 2% (v/v%). The locomotor activities of the larvae during alternating light-dark challenges, as well as the locomotor responses immediately following the light transitions, were investigated. The levels of various neurotransmitters were also measured in selected ethanol-treated groups. The larvae at 5 and 7 dpf demonstrated similar patterns of locomotor responses to ethanol treatment. Ethanol treatment at 1% increased the swimming distances of the zebrafish larvae in the dark periods, but had no effect on the swimming distances in the light periods. In contrast, ethanol treatment at 2% increased the swimming distances in the light periods, but did not potentiate the swimming activity in the dark periods, compared to controls. Differences in the levels of neurotransmitters that are involved in norepinephrine, dopamine, and serotonin pathways were also observed in groups with different ethanol treatments. These results indicated the behavioral studies concerning the ethanol effects on locomotor activities of zebrafish larvae could be carried out as early as 5 dpf. The 1% and 2% ethanol-treated zebrafish larvae modeled ethanol effects at different intoxication states, and the differences in neurotransmitter levels suggested the involvement of various neurotransmitter pathways in different ethanol intoxication states.

  6. Evaluation of the toxic potential of cefotaxime in the third instar larvae of transgenic Drosophila melanogaster.


    Rahul; Jyoti, Smita; Naz, Falaq; Siddique, Yasir Hasan


    The present study was carried out to evaluate the toxic potential of cefotaxime in the third instar larvae of transgenic Drosophila melanogaster (hsp70-lacZ)Bg(9). Cefotaxime at final concentration of 10, 20, 40, 60 and 80 μg/ml was mixed in the diet and the larvae were exposed to the selected doses for 6, 12, 24, 48 h. The hsp70 expression, trypan blue exclusion test, in situ histochemical β-galactosidase activity, lipid peroxidation, total protein content, glutathione (GSH) content, glutathione-S-transferase (GST) activity, protein carbonyl content, caspase 3 and 9 activity, apoptotic index and comet assay were taken as parameters for the study. The larvae exposed to 40, 60 and 80 μg/ml for 12, 24 and 48 h showed a dose and duration dependent significant increase in the activity of β-galactosidase and lipid peroxidation but decrease in the total GSH content as compared to unexposed larvae. The decrease in protein content was observed in the larvae exposed to 40, 60 and 80 μg/ml of cefotaxime for 24 and 48 h. The larvae exposed to 40, 60 and 80 μg/ml of cefotaxime for 24 and 48 h showed a dose and duration dependent increase in the tissue damage, GST, caspase 3 and 9 activity, PC content, apoptosis and the DNA tail length (comet assay). The result suggests that the cefotaxime is toxic at 40, 60 and 80 μg/ml of doses for the third instar larvae of transgenic D. melanogaster (hsp70-lacZ)Bg(9). Cefotaxime at 10 and 20 μg/ml was not toxic for any duration of exposure.

  7. Looking for Larvae Above an Erupting Submarine Volcano, NW Rota-1, Mariana Arc

    NASA Astrophysics Data System (ADS)

    Hanson, M.; Beaulieu, S.; Tunnicliffe, V.; Chadwick, W.; Breuer, E. R.


    In 2009 the first marine protected areas for deep-sea hydrothermal vents in U.S. waters were established as part of the Volcanic Unit of the Marianas Trench Marine National Monument. In this region, hydrothermal vents are located along the Mariana Arc and back-arc spreading center. In particular hydrothermal vents are located near the summit of NW Rota-1, an active submarine volcano on the Mariana Arc which was erupting between 2003 through 2010 and ceased as of 2014. In late 2009, NW Rota-1 experienced a massive landslide decimating the habitat on the southern side of the volcano. This presented an enormous natural disturbance to the community. This project looked at zooplankton tow samples taken from the water column above NW Rota-1 in 2010, searching specifically for larvae which have the potential to recolonize the sea floor after such a major disturbance. We focused on samples for which profiles with a MAPR sensor indicated hydrothermal plumes in the water column. Samples were sorted in entirety into coarse taxa, and then larvae were removed for DNA barcoding. Overall zooplankton composition was dominated by copepods, ostracods, and chaetognaths, the majority of which are pelagic organisms. Comparatively few larvae of benthic invertebrates were found, but shrimp, gastropod, barnacle, and polychaete larvae did appear in low numbers in the samples. Species-level identification obtained via genetic barcoding will allow for these larvae to be matched to species known to inhabit the benthic communities at NW Rota-1. Identified larvae will give insight into the organisms which can re-colonize the seafloor vent communities after a disturbance such as the 2009 landslide. Communities at hydrothermal vents at other submarine volcanoes in the Monument also can act as sources for these planktonic, recolonizing larvae. As the microinvertebrate biodiversity in the Monument has yet to be fully characterized, our project also provides an opportunity to better describe both

  8. Ontogeny of critical and prolonged swimming performance for the larvae of six Australian freshwater fish species.


    Kopf, S M; Humphries, P; Watts, R J


    Critical (<30 min) and prolonged (>60 min) swimming speeds in laboratory chambers were determined for larvae of six species of Australian freshwater fishes: trout cod Maccullochella macquariensis, Murray cod Maccullochella peelii, golden perch Macquaria ambigua, silver perch Bidyanus bidyanus, carp gudgeon Hypseleotris spp. and Murray River rainbowfish Melanotaenia fluviatilis. Developmental stage (preflexion, flexion, postflexion and metalarva) better explained swimming ability than did length, size or age (days after hatch). Critical speed increased with larval development, and metalarvae were the fastest swimmers for all species. Maccullochella macquariensis larvae had the highest critical [maximum absolute 46.4 cm s(-1) and 44.6 relative body lengths (L(B)) s(-1)] and prolonged (maximum 15.4 cm s(-1), 15.6 L(B) s(-1)) swimming speeds and B. bidyanus larvae the lowest critical (minimum 0.1 cm s(-1), 0.3 L(B) s(-1)) and prolonged swimming speeds (minimum 1.1 cm s(-1), 1.0 L(B) s(-1)). Prolonged swimming trials determined that the larvae of some species could not swim for 60 min at any speed, whereas the larvae of the best swimming species, M. macquariensis, could swim for 60 min at 44% of the critical speed. The swimming performance of species with precocial life-history strategies, with well-developed larvae at hatch, was comparatively better and potentially had greater ability to influence their dispersal by actively swimming than species with altricial life-history strategies, with poorly developed larvae at hatch.

  9. Mass Death of Predatory Carp, Chanodichthys erythropterus, Induced by Plerocercoid Larvae of Ligula intestinalis (Cestoda: Diphyllobothriidae)

    PubMed Central

    Sohn, Woon-Mok; Na, Byoung-Kuk; Jung, Soo Gun; Kim, Koo Hwan


    We describe here the mass death of predatory carp, Chanodichthys erythropterus, in Korea induced by plerocercoid larvae of Ligula intestinalis as a result of host manipulation. The carcasses of fish with ligulid larvae were first found in the river-edge areas of Chilgok-bo in Nakdong-gang (River), Korea at early February 2016. This ecological phenomena also occurred in the adjacent areas of 3 dams of Nakdong-gang, i.e., Gangjeong-bo, Dalseong-bo, and Hapcheon-Changnyeong-bo. Total 1,173 fish carcasses were collected from the 4 regions. To examine the cause of death, we captured 10 wondering carp in the river-edge areas of Hapcheon-Changnyeong-bo with a landing net. They were 24.0-28.5 cm in length and 147-257 g in weight, and had 2-11 plerocercoid larvae in the abdominal cavity. Their digestive organs were slender and empty, and reproductive organs were not observed at all. The plerocercoid larvae occupied almost all spaces of the abdominal cavity under the air bladders. The proportion of larvae per fish was 14.6-32.1% of body weight. The larvae were ivory-white, 21.5-63.0 cm long, and 6.0-13.8 g in weight. We suggest that the preference for the river-edge in infected fish during winter is a modified behavioral response by host manipulation of the tapeworm larvae. The life cycle of this tapeworm seems to be successfully continued as the infected fish can be easily eaten by avian definitive hosts. PMID:27417095

  10. Cryopreservation of veliger larvae of trumpet shell, Charonia sauliae: an essential preparation to artificial propagation

    NASA Astrophysics Data System (ADS)

    Kang, Kyoung Ho; Zhang, Zhifeng; Bao, Zhenmin; Shao, Mingyu


    Trumpet shell, Charonia sauliae, is an endangered and valuable species, but its artificial propagation protocol has not been successfully established. To estimate the possibility of cryopreservation for larvae of C. sauliae, which is a potential preparation for its artificial reproduction and further research, in this study a protocol for the cryopreservation of veliger larvae of trumpet shell was optimized. Through a two-step cryopreservation procedure, four kinds of cryoprotectants (ethylene glycol, 1, 2-propanediol, dimethyl sulfoxide and glycerol) were employed at three concentrations (1.0, 1.5 and 2.0 molL-1) respectively and survival rates of larvae were determined after a storage of 1h. The larvae frozen with these four cryoprotectants after 1 h storage were cultured, and then survival rates were determined at 24, 72 and 120 h after thawing. Dimethyl sulfoxide at a concentration of 1.5 molL-1 showed the best protective effect in all experiments ( p<0.05). And survival rates of larvae frozen with dimethyl sulfoxide were determined after 1, 7 and 15 d of storage. The survival rates of larvae frozen with 1.5 molL-1 dimethyl sulfoxide after 1 h, 1 d, 7 d and 15 d of storage were 80.77% ±7.51%, 80.34% ±11.28%, 83.10% ±9.14% and 77.23% ±6.22% respectively. No significant differences in survival rates of larvae frozen with dimethyl sulfoxide were observed after various storage periods ( p>0.05).

  11. Oxidative Stress and Digestive Enzyme Activity of Flatfish Larvae in a Changing Ocean

    PubMed Central

    Pimentel, Marta S.; Faleiro, Filipa; Diniz, Mário; Machado, Jorge; Pousão-Ferreira, Pedro; Peck, Myron A.; Pörtner, Hans O.; Rosa, Rui


    Until now, it is not known how the antioxidant and digestive enzymatic machinery of fish early life stages will change with the combined effects of future ocean acidification and warming. Here we show that high pCO2 (~1600 μatm) significantly decreased metabolic rates (up to 27.4 %) of flatfish larvae, Solea senegalensis, at both present (18 °C) and warmer temperatures (+4 °C). Moreover, both warming and hypercapnia increased the heat shock response and the activity of antioxidant enzymes, namely catalase (CAT) and glutathione S-transferase (GST), mainly in post-metamorphic larvae (30 dph). The lack of changes in the activity of CAT and GST of pre-metamorphic larvae (10 dph) seems to indicate that earlier stages lack a fully-developed antioxidant defense system. Nevertheless, the heat shock and antioxidant responses of post-metamorphic larvae were not enough to avoid the peroxidative damage, which was greatly increased under future environmental conditions. Digestive enzymatic activity of S. senegalensis larvae was also affected by future predictions. Hypercapnic conditions led to a decrease in the activity of digestive enzymes, both pancreatic (up to 26.1 % for trypsin and 74.5 % for amylase) and intestinal enzymes (up to 36.1 % for alkaline phosphatase) in post-metamorphic larvae. Moreover, the impact of ocean acidification and warming on some of these physiological and biochemical variables (namely, lower OCR and higher HSP and MDA levels) were translated into larvae performance, being significantly correlated with decreased larval growth and survival or increased incidence of skeletal deformities. The increased vulnerability of flatfish early life stages under future ocean conditions is expected to potentially determine recruitment and population dynamics in marine ecosystems. PMID:26221723

  12. UV-A induced delayed development in the larvae of coral Seriatopora caliendrum.


    Zhou, Jie; Fan, Tung-Yung; Beardall, John; Gao, Kunshan


    Coral reefs are vulnerable to ultraviolet radiation (UVR, 280-400nm). Not only do the fluxes of UVR fluctuate daily, they are also increasing due to global ocean and atmospheric changes. The deleterious effects of UVR on scleractinian corals have been intensively studied, but much less is known about the response of corals in the early pre-settlement phase. In this study, we tested how UVR exposure affects survival and development of Seriatopora caliendrum larvae and examined the photophysiological changes induced in the symbiotic dinoflagellate Symbiodinium. Results showed that the contents of chl c and carotenoids normalized to the number of algae cells in the larvae decreased significantly when larvae were exposed to UVR compared to those protected from UVR, while the cell density of Symbiodinium was higher in UVR-exposed larvae. The effective photochemical efficiency of the symbiotic algae increased when cultured under PAR plus UV-A (here taken as 320-395nm). We further present the novel finding that during the development experiment, presence of UV-A induced a decline in the rates of metamorphosis and settlement, which disappeared when the larvae were also exposed to UV-B (here defined as 295-320nm). However, UVR had no distinguishable effect on the numbers of larvae that either survived, metamorphosed or settled by the end of the culture period. Therefore, it is concluded from this study that UV-A radiation may extend the planktonic duration of coral larvae, but not have an overall inhibitory effect on developmental outcomes.

  13. New Agar Technique Compared with Sand Flotation for Obtaining Salt Marsh Culicoides mississippiensis Hoffman (Diptera: Ceratopogonidae) Larvae,

    DTIC Science & Technology


    compared with 1% and 2% (wt/v) agar formulations for extracting Culicoides ndisaiooippiensis Hoffman larvae from marsh soil samples. The 1% agar formula...been used to recover larvae of biting midges (CuZ.,o;1aa spp .) from salt marsh substrate (soil) samples. They are: (1) sieve-flotation (Kettle and Lawson...Kettle et al., (1975) in which tabanid and culicoid larvae were successfully reared in agar media, we decided that one possibility was to replace the

  14. The in vitro effect of prolactin on the growth, motility and expression of prolactin receptors in larvae of Toxocara canis.


    Chávez-Güitrón, L E; Morales-Montor, J; Muñoz-Guzmán, M A; Nava-Castro, K E; Ramírez-Álvarez, H; Moreno-Méndoza, N A; Hernández-Cervantes, R; Alba-Hurtado, F


    The in vitro effect of prolactin (PRL) on the growth and motility of Toxocara canis larvae was assessed. Additionally, the expression and location of prolactin receptors (PRL-Rs) were determined in the larvae. Larvae of T. canis were incubated with different concentrations of PRL for different periods of time. The stimulated larvae accelerated their enlargement and increased their motility. The mean percentage of PRL-R+ cells in non-stimulated larvae, measured by flow cytometry was 7.3±0.3%. Compared with non-stimulated larvae, the mean fluorescence intensity (p<0.05) increased in larvae incubated with 40ng/mL of PRL for 10 days. A 465-bp length fragment was amplified from larvae gDNA by PCR. The sequence of this fragment showed 99% similarity with the gene fragment that codes for the PRL-R of the domestic dog. A high concentration of PRL-Rs was immune-located in the posterior region of the larval intestine; therefore, the intestinal cells in this region were most likely the targets for this hormone. Based on these results, PRL-Rs were identified in T. canis larvae, and the in vitro stimulation with PRL increased the number of these receptors, accelerated the growth and modified the activity of larvae. All of the above suggest that T. canis larvae are evolutionarily adapted to recognize the PRL of their definitive host and furthermore might explain the reactivation of tissue-arrested larvae during the gestation of bitches, which does not occur in gestating females of other species.

  15. Entomopathogenic nematodes, root weevil larvae, and dynamic interactions among soil texture, plant growth, herbivory, and predation.


    El-Borai, Fahiem E; Stuart, Robin J; Campos-Herrera, Raquel; Pathak, Ekta; Duncan, Larry W


    Greenhouse experiments were conducted to assess the influence of soil texture on the persistence, efficacy and plant protection ability of entomopathogenic nematodes (EPNs) applied to control larvae of the Diaprepes root weevil (DRW), Diaprepes abbreviatus, infesting potted citrus seedlings. Seedlings were grown in pots containing either coarse sand, fine sand, or sandy loam. Three DRW larvae were added to each of 80 pots of each soil type. 24 h later, 20 pots of each soil type that had received weevil larvae were inoculated with EPN infective juveniles (IJs) of one of the following species: Steinernema diaprepesi, Steinernema riobrave and Heterorhabditis indica. Pots of each soil without EPNs were established as controls with DRW and controls without DRWs. Subsequently, pots with larvae received three additional larvae monthly, and the experiment continued for 9 months. Plant root and top weights at the end of the experiment were affected by both soil (P≤0.0001) and nematodes (P≤0.0001), and nematode species protected plants differently in different soils (interaction P≤0.0001). Soil porosity was inversely related to plant damage by DRW, whether or not EPNs were present; and porosity was directly related to the level of plant protection by EPNs. Mortality of caged sentinel weevil larvae placed in pots near the end of the experiment was highest in pots treated with S. diaprepesi. In a second, similar experiment that included an additional undescribed steinernematid of the Steinernema glaseri-group, soil type affected root damage by DRW and root protection by EPNs in the same manner as in the first experiment. Final numbers of S. diaprepesi and Steinernema sp. as measured by real-time PCR were much greater than those of S. riobrave or H. indica in all soils. Across all treatments, the number of weevil larvae in soil at the end the experiment was inversely related to soil porosity. In all soils, fewer weevil larvae survived in soil treated with S. diaprepesi or

  16. Digestion of Yeasts and Beta-1,3-Glucanases in Mosquito Larvae: Physiological and Biochemical Considerations

    PubMed Central

    Souza, Raquel Santos; Diaz-Albiter, Hector Manuel; Dillon, Vivian Maureen; Dillon, Rod J.; Genta, Fernando Ariel


    Aedes aegypti larvae ingest several kinds of microorganisms. In spite of studies regarding mosquito digestion, little is known about the nutritional utilization of ingested cells by larvae. We investigated the effects of using yeasts as the sole nutrient source for A. aegypti larvae. We also assessed the role of beta-1,3-glucanases in digestion of live yeast cells. Beta-1,3-glucanases are enzymes which hydrolyze the cell wall beta-1,3-glucan polyssacharide. Larvae were fed with cat food (controls), live or autoclaved Saccharomyces cerevisiae cells and larval weight, time for pupation and adult emergence, larval and pupal mortality were measured. The presence of S. cerevisiae cells inside the larval gut was demonstrated by light microscopy. Beta-1,3-glucanase was measured in dissected larval samples. Viability assays were performed with live yeast cells and larval gut homogenates, with or without addition of competing beta-1,3-glucan. A. aegypti larvae fed with yeast cells were heavier at the 4th instar and showed complete development with normal mortality rates. Yeast cells were efficiently ingested by larvae and quickly killed (10% death in 2h, 100% in 48h). Larvae showed beta-1,3-glucanase in head, gut and rest of body. Gut beta-1,3-glucanase was not derived from ingested yeast cells. Gut and rest of body activity was not affected by the yeast diet, but head homogenates showed a lower activity in animals fed with autoclaved S. cerevisiae cells. The enzymatic lysis of live S. cerevisiae cells was demonstrated using gut homogenates, and this activity was abolished when excess beta-1,3-glucan was added to assays. These results show that live yeast cells are efficiently ingested and hydrolyzed by A. aegypti larvae, which are able to fully-develop on a diet based exclusively on these organisms. Beta-1,3-glucanase seems to be essential for yeast lytic activity of A. aegypti larvae, which possess significant amounts of these enzyme in all parts investigated. PMID

  17. The immunological capacity in the larvae of Pacific oyster Crassostrea gigas.


    Song, Xiaorui; Wang, Hao; Xin, Lusheng; Xu, Jiachao; Jia, Zhihao; Wang, Lingling; Song, Linsheng


    As the immune system has not fully developed during early developmental stages, bivalve larvae are more susceptible for pathogens, which frequently leads to the significant mortality in hatcheries. In the present study, the development of immune system and its response against bacteria challenge were investigated in order to characterize the repertoire of immunological capacity of Pacific oyster Crassostrea gigas during the ontogenesis. The phagocytosis was firstly observed in the early D-veliger larvae (17 hpf), especially in their velum site, which indicated the appearance of functional hemocytes during early D-veliger larvae stage. The whole-mount immunofluorescence assay of three pattern recognition receptors (integrin β-1, caspase-3 and C-type lectin 3) and one immune effector gene (IL17-5) was performed in blastula, early D-veliger and umbo larvae, suggested that velum and digestive gland were the potential sites of i