Science.gov

Sample records for dysprosium 163

  1. Isolation of 163Ho from dysprosium target material by HPLC for neutrino mass measurements

    DOE PAGES

    Mocko, Veronika; Taylor, Wayne  A.; Nortier, Francois M.; Engle, Jonathan  W.; Barnhart, Todd  E.; Nickles, Robert  J.; Pollington, Anthony  D.; Kunde, Gerd  J.; Rabin, Michael  W.; Birnbaum, Eva  R.

    2015-04-29

    The rare earth isotope 163Ho is of interest for neutrino mass measurements. This report describes the isolation of 163Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, 163Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm–3 α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized by MC-ICP-MSmore » to determine the 163Ho/165Ho ratio, 163Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4E5 for Dy. As a result, the isolated Ho fraction contained 24.8 ±1.3 ng of 163Ho corresponding to holmium recovery of 72 ± 3%.« less

  2. Isolation of 163Ho from dysprosium target material by HPLC for neutrino mass measurements

    SciTech Connect

    Mocko, Veronika; Taylor, Wayne  A.; Nortier, Francois M.; Engle, Jonathan  W.; Barnhart, Todd  E.; Nickles, Robert  J.; Pollington, Anthony  D.; Kunde, Gerd  J.; Rabin, Michael  W.; Birnbaum, Eva  R.

    2015-04-29

    The rare earth isotope 163Ho is of interest for neutrino mass measurements. This report describes the isolation of 163Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, 163Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm–3 α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized by MC-ICP-MS to determine the 163Ho/165Ho ratio, 163Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4E5 for Dy. As a result, the isolated Ho fraction contained 24.8 ±1.3 ng of 163Ho corresponding to holmium recovery of 72 ± 3%.

  3. Metals fact sheet - Dysprosium

    SciTech Connect

    1997-01-01

    The article contains a summary of factors pertinent to dysprosium use. Geology and exploitation, mineral sources, production processes, global production,applications, and the dysprosium market are reviewed. Applications very briefly described include use as a cooling agent in nuclear control rods, magnets, magnetostrictive devices, phosphors, photoelectric devices, and glass. Current and historical market prices are given.

  4. Magnetic relaxation in dysprosium-dysprosium collisions

    SciTech Connect

    Newman, Bonna K.; Johnson, Cort; Kleppner, Daniel; Greytak, Thomas J.; Brahms, Nathan; Au, Yat Shan; Connolly, Colin B.; Doyle, John M.

    2011-01-15

    The collisional magnetic reorientation rate constant g{sub R} is measured for magnetically trapped atomic dysprosium (Dy), an atom with large magnetic dipole moments. Using buffer gas cooling with cold helium, large numbers (>10{sup 11}) of Dy are loaded into a magnetic trap and the buffer gas is subsequently removed. The decay of the trapped sample is governed by collisional reorientation of the atomic magnetic moments. We find g{sub R}=1.9{+-}0.5x10{sup -11} cm{sup 3} s{sup -1} at 390 mK. We also measure the magnetic reorientation rate constant of holmium (Ho), another highly magnetic atom, and find g{sub R}=5{+-}2x10{sup -12} cm{sup 3} s{sup -1} at 690 mK. The Zeeman relaxation rates of these atoms are greater than expected for the magnetic dipole-dipole interaction, suggesting that another mechanism, such as an anisotropic electrostatic interaction, is responsible. Comparison with estimated elastic collision rates suggests that Dy is a poor candidate for evaporative cooling in a magnetic trap.

  5. Dysprosium magneto-optical traps

    SciTech Connect

    Youn, Seo Ho; Lu Mingwu; Ray, Ushnish; Lev, Benjamin L.

    2010-10-15

    Magneto-optical traps (MOTs) of highly magnetic lanthanides open the door to explorations of novel phases of strongly correlated matter such as lattice supersolids and quantum liquid crystals. We recently reported the first MOTs of the five high-abundance isotopes of the most magnetic atom, dysprosium. Described here are details of the experimental technique employed for repumper-free Dy MOTs containing up to half a billion atoms. Extensive characterization of the MOTs' properties--population, temperature, loading, metastable decay dynamics, and trap dynamics--is provided.

  6. Preparation and properties of dysprosium nanocapsules coated with boron, carbon, and dysprosium oxide

    SciTech Connect

    Si, P.Z.; Brueck, E.; Zhang, Z.D.; Skorvanek, I.; Kovac, J.; Zhang, M

    2004-06-08

    Boron-coated dysprosium/dysprosium oxide, carbon-coated dysprosium/DyC{sub 2}, and dysprosium oxide-coated dysprosium nanocapsules were prepared using an arc discharge method in diborane, methane, and argon, respectively. The magnetization of these nanocapsules has been measured at temperatures between 4 and 290 K, in applied fields up to 6 T. The transition temperature of nanocrystalline Dy from the helical phase to the ferromagnetic phase is much lower than that of bulk Dy. The linear temperature dependence of the inverse susceptibility of these nanocapsules, being a mixture of superparamagnetic Dy and paramagnetic dysprosium oxide or carbide, can be explained within the molecular field theory with magnetic moments with the total angular momentum J=15/2 and the Lande factor g=4/3. We discuss the relations between the structure and the magnetization of these nanocapsules.

  7. Paramagnetic dysprosium oxide nanoparticles and dysprosium hydroxide nanorods as T₂ MRI contrast agents.

    PubMed

    Kattel, Krishna; Park, Ja Young; Xu, Wenlong; Kim, Han Gyeol; Lee, Eun Jung; Bony, Badrul Alam; Heo, Woo Choul; Jin, Seonguk; Baeck, Jong Su; Chang, Yongmin; Kim, Tae Jeong; Bae, Ji Eun; Chae, Kwon Seok; Lee, Gang Ho

    2012-04-01

    We report here paramagnetic dysprosium nanomaterial-based T(2) MRI contrast agents. A large r(2) and a negligible r(1) is an ideal condition for T(2) MR imaging. At this condition, protons are strongly and nearly exclusively induced for T(2) MR imaging. The dysprosium nanomaterials fairly satisfy this because they are found to possess a decent r(2) but a negligible r(1) arising from L + S state 4f-electrons in Dy(III) ion ((6)H(15/2)). Their r(2) will also further increase with increasing applied field because of unsaturated magnetization at room temperature. Therefore, MR imaging and various physical properties of the synthesized d-glucuronic acid coated ultrasmall dysprosium oxide nanoparticles (d(avg) = 3.2 nm) and dysprosium hydroxide nanorods (20 × 300 nm) are investigated. These include hydrodynamic diameters, magnetic properties, MR relaxivities, cytotoxicities, and 3 tesla in vivo T(2) MR images. Here, MR imaging properties of dysprosium hydroxide nanorods have not been reported so far. These two samples show r(2)s of 65.04 and 181.57 s(-1)mM(-1), respectively, with negligible r(1)s at 1.5 tesla and at room temperature, no in vitro cytotoxicity up to 100 μM Dy, and clear negative contrast enhancements in 3 tesla in vivo T(2) MR images of a mouse liver, which will be even more improved at higher MR fields. Therefore, d-glucuronic acid coated ultrasmall dysprosium oxide nanoparticles with renal excretion can be a potential candidate as a sensitive T(2) MRI contrast agent at MR field greater than 3 tesla.

  8. Bose-Fermi mixtures of ultracold gases of dysprosium

    NASA Astrophysics Data System (ADS)

    Youn, Seo Ho

    Laser cooling and trapping of the most magnetic fermionic atom, dysprosium (Dy), may provide a framework to explore quantum liquid crystal (QLC) theory (Chapter 1). This thesis presents details of the Dy laser cooling and trapping apparatus including the laser systems at 421, 741, and 1064 nm, the ultra-high vacuum (UHV) chamber, and the computer control that has produced a magneto-optically (MOT) and magnetostatically (MT) trapped Dy gas (Chapters 3, 4, 5). Despite the fact that Dy has a complex energy level structure with nearly 140 metastable states (Chapter 2), Dy MOT at 421-nm transition with 32-MHz linewidth was realized without any rempumper, exploiting its large magnetic moment, which brought a strong magnetic confinement of metastable states of Dy. This unique MOT/MT dynamics is discussed and its quantitative measurements are shown in Chapter 6. When the Dy atoms dropped from the MOT were adsorptively imaged, it was observed that Dy MOT had a bimodal temperature distribution in contrast to the usual MOT described by a single temperature (Chapter 7). Such novel anisotropic sub-Doppler laser cooling of Dy, which breaks the symmetry in cooling, is due to Dy's large magnetic spin aligned along a strong axis of the quadrupole field of the MOT, and we further support this plausible conjecture with the velocity selective resonance (VSR) theory. The MOT at ˜1 mK was cooled to ˜ 10 muK by narrow-line cooling at 741 nm with a linewidth of 2 kHz, and we were able to load the optical dipole trap (ODT) at 1064 nm. By loading two isotopes of 164Dy and 163Dy in sequence to the MOT and narrow-line cooling them simultaneously, ultracold Bose-Fermi mixtures of Dy in the ODT were realized (Chapter 8). This thesis is concluded with a discussion of prospect on the Bose-Fermi mixtures of Dy.

  9. Distribution of heating in an LVRF bundle due to dysprosium in the central element

    SciTech Connect

    Tsang, K.; Buijs, A.

    2006-07-01

    The computer code MCNP was used to establish the effect of adding dysprosium to the central pin of the proposed BRUCE-B CANFLEX{sup R} Low-Void-Reactivity Fuel (LVRF) on the heat load of the central pin and the heat balance inside the fuel bundle. The Dy generates heat through radiative capture of thermal neutrons, as well as through beta decay of {sup 165}Dy to {sup 165}Ho. We conclude that for fresh fuel, the presence of Dy contributes 26% of the overall heat to the central pin, and 0.5% to the whole fuel bundle. These percentages decrease to 11% and 0.5% at the end-of-life burnup condition. A second, operational quantity is the HPFP ratio (heating-power to fission-power ratio). This ratio is 1.63 for fresh fuel and decreases to 1.19 for fuel at the end-of-life burnup condition. (authors)

  10. Phenalenyl-based mononuclear dysprosium complexes.

    PubMed

    Lan, Yanhua; Magri, Andrea; Fuhr, Olaf; Ruben, Mario

    2016-01-01

    The phenalenyl-based dysprosium complexes [Dy(PLN)2(HPLN)Cl(EtOH)] (1), [Dy(PLN)3(HPLN)]·[Dy(PLN)3(EtOH)]·2EtOH (2) and [Dy(PLN)3(H2O)2]·H2O (3), HPLN being 9-hydroxy-1H-phenalen-1-one, have been synthesized. All compounds were fully characterized by means of single crystal X-ray analysis, paramagnetic (1)H NMR, MALDI-TOF mass spectrometry, UV-vis spectrophotometry and magnetic measurements. Both static (dc) and dynamic (ac) magnetic properties of these complexes have been investigated, showing slow relaxation of magnetization, indicative of single molecule magnet (SMM) behavior. Attempts to synthesize sublimable phenalenyl-based dysprosium complexes have been made by implementing a synthetic strategy under anhydrous conditions. The sublimed species were characterized and their thermal stability was confirmed. This opens up the possibility to deposit phenalenyl-based lanthanides complexes by sublimation onto surfaces, an important prerequisite for ongoing studies in molecular spintronics. PMID:27547617

  11. Phenalenyl-based mononuclear dysprosium complexes

    PubMed Central

    Magri, Andrea; Fuhr, Olaf

    2016-01-01

    Summary The phenalenyl-based dysprosium complexes [Dy(PLN)2(HPLN)Cl(EtOH)] (1), [Dy(PLN)3(HPLN)]·[Dy(PLN)3(EtOH)]·2EtOH (2) and [Dy(PLN)3(H2O)2]·H2O (3), HPLN being 9-hydroxy-1H-phenalen-1-one, have been synthesized. All compounds were fully characterized by means of single crystal X-ray analysis, paramagnetic 1H NMR, MALDI-TOF mass spectrometry, UV–vis spectrophotometry and magnetic measurements. Both static (dc) and dynamic (ac) magnetic properties of these complexes have been investigated, showing slow relaxation of magnetization, indicative of single molecule magnet (SMM) behavior. Attempts to synthesize sublimable phenalenyl-based dysprosium complexes have been made by implementing a synthetic strategy under anhydrous conditions. The sublimed species were characterized and their thermal stability was confirmed. This opens up the possibility to deposit phenalenyl-based lanthanides complexes by sublimation onto surfaces, an important prerequisite for ongoing studies in molecular spintronics. PMID:27547617

  12. Phenalenyl-based mononuclear dysprosium complexes.

    PubMed

    Lan, Yanhua; Magri, Andrea; Fuhr, Olaf; Ruben, Mario

    2016-01-01

    The phenalenyl-based dysprosium complexes [Dy(PLN)2(HPLN)Cl(EtOH)] (1), [Dy(PLN)3(HPLN)]·[Dy(PLN)3(EtOH)]·2EtOH (2) and [Dy(PLN)3(H2O)2]·H2O (3), HPLN being 9-hydroxy-1H-phenalen-1-one, have been synthesized. All compounds were fully characterized by means of single crystal X-ray analysis, paramagnetic (1)H NMR, MALDI-TOF mass spectrometry, UV-vis spectrophotometry and magnetic measurements. Both static (dc) and dynamic (ac) magnetic properties of these complexes have been investigated, showing slow relaxation of magnetization, indicative of single molecule magnet (SMM) behavior. Attempts to synthesize sublimable phenalenyl-based dysprosium complexes have been made by implementing a synthetic strategy under anhydrous conditions. The sublimed species were characterized and their thermal stability was confirmed. This opens up the possibility to deposit phenalenyl-based lanthanides complexes by sublimation onto surfaces, an important prerequisite for ongoing studies in molecular spintronics.

  13. Dosimetry of in situ activated dysprosium microspheres.

    PubMed

    Adnani, N

    2004-03-01

    This paper presents the results of a study aimed at investigating the dosimetry of stable dysprosium microspheres activated, in situ, by a linac generated photon beam. In phantom measurements of the neutron flux within an 18 MV photon beam were performed using CR-39 detectors and gold activation. The results were used in conjunction with a Monte Carlo computer simulation to investigate the dose distribution resulting from the activation of dysprosium (Dy) microspheres using an 18 MV photon beam. Different depths, lesion volumes and volume concentrations of microspheres are investigated. The linac lower collimator jaws are assumed completely closed to shield the tumour volume from the photon dose. Using a single AP field with 0 x 0 cm2 field size (closed jaws), a photon dose rate of 600 MU min(-1) and 80 cm SSD for 10 min, an average dose exceeding 1 Gy can be delivered to spherical lesions of 0.5 cm and higher diameter. The variation of the average dose with the size of the lesion reaches saturation for tumour volumes exceeding 1 cm in diameter. This report shows that the photon beam of a high-energy linac can be used to activate Dy microspheres in situ and, as a result, deliver a significant dose of beta radiation. Non-radioactive Dy microspheres do not have the toxicity and imaging problems associated with commercially available yttrium-90 based products. PMID:15070199

  14. Dysprosium oxide and dysprosium-oxide-doped titanium oxide thin films grown by atomic layer deposition

    SciTech Connect

    Tamm, Aile Kozlova, Jekaterina; Aarik, Lauri; Aarik, Jaan; Kukli, Kaupo; Link, Joosep; Stern, Raivo

    2015-01-15

    Dysprosium oxide and dysprosium-oxide-doped titanium oxide thin films were grown by atomic layer deposition on silicon substrates. For depositing dysprosium and titanium oxides Dy(thd){sub 3}-O{sub 3} and TiCl{sub 4}-O{sub 3} were used as precursors combinations. Appropriate parameters for Dy(thd){sub 3}-O{sub 3} growth process were obtained by using a quartz crystal microbalance system. The Dy{sub 2}O{sub 3} films were deposited on planar substrates and on three-dimensional substrates with aspect ratio 1:20. The Dy/Ti ratio of Dy{sub 2}O{sub 3}-doped TiO{sub 2} films deposited on a planar silicon substrate ranged from 0.04 to 0.06. Magnetometry studies revealed that saturation of magnetization could not be observed in planar Dy{sub 2}O{sub 3} films, but it was observable in Dy{sub 2}O{sub 3} films on 3D substrates and in doped TiO{sub 2} films with a Dy/Ti atomic ratio of 0.06. The latter films exhibited saturation magnetization 10{sup −6} A cm{sup 2} and coercivity 11 kA/m at room temperature.

  15. Radiative strength functions in {sup 163,164}Dy

    SciTech Connect

    Nyhus, H. T.; Siem, S.; Guttormsen, M.; Larsen, A. C.; Buerger, A.; Syed, N. U. H.; Tveten, G. M.; Voinov, A.

    2010-02-15

    The nuclei {sup 163,164}Dy have been investigated using the Oslo method on data from the pickup reaction {sup 164}Dy({sup 3}He,{alpha}{gamma}){sup 163}Dy and the inelastic scattering {sup 164}Dy({sup 3}He,{sup 3}He{sup '}{gamma}){sup 164}Dy, respectively. The radiative strength functions for both nuclei have been extracted, and a small resonance centered around E{sub {gamma}}approx =3 MeV is observed in both cases. The parameters of this so-called pygmy M1 resonance (the scissors mode) are compared with previous results on {sup 160,161,162}Dy using the Oslo method, and with data on {sup 163}Dy measured by the Prague group using the two-step cascade method. In particular, the integrated reduced transition probability B(M1arrow up) of the pygmy resonance is compared with neighboring dysprosium isotopes. We also observe an enhanced strength in the region above E{sub {gamma}}approx =5 MeV in {sup 164}Dy. Possible origins of this feature are discussed.

  16. Tetravalent dysprosium in a perovskite-type oxide.

    PubMed

    Han, Donglin; Uda, Tetsuya; Nose, Yoshitaro; Okajima, Toshihiro; Murata, Hidenobu; Tanaka, Isao; Shinoda, Kozo

    2012-04-17

    The existence of tetravalent dysprosium in perovskite-type oxide barium zirconate is confirmed in this work. This discovery will stimulate many researchers in diverse fields such as catalysts, solid state ionics, sensors, and fluorescent materials.

  17. Dynamic polarizabilities and magic wavelengths for dysprosium

    SciTech Connect

    Dzuba, V. A.; Flambaum, V. V.; Lev, Benjamin L.

    2011-03-15

    We theoretically study dynamic scalar polarizabilities of the ground and select long-lived excited states of dysprosium, a highly magnetic atom recently laser cooled and trapped. We demonstrate that there is a set of magic wavelengths of the unpolarized lattice laser field for each pair of states, which includes the ground state and one of these excited states. At these wavelengths, the energy shift due to laser field is the same for both states, which can be useful for resolved sideband cooling on narrow transitions and precision spectroscopy. We present an analytical formula that, near resonances, allows for the determination of approximate values of the magic wavelengths without calculating the dynamic polarizabilities of the excited states.

  18. Transverse laser cooling of a thermal atomic beam of dysprosium

    SciTech Connect

    Leefer, N.; Cingoez, A.; Gerber-Siff, B.; Sharma, Arijit; Torgerson, J. R.; Budker, D.

    2010-04-15

    A thermal atomic beam of dysprosium atoms is cooled using the 4f{sup 10}6s{sup 2}(J=8){yields}4f{sup 10}6s6p(J=9) transition at 421 nm. The cooling is done via a standing light wave orthogonal to the atomic beam. Efficient transverse cooling to the Doppler limit is demonstrated for all observable isotopes of dysprosium. Branching ratios to metastable states are demonstrated to be <5x10{sup -4}. A scheme for enhancement of the nonzero-nuclear-spin-isotope cooling and a method for direct identification of possible trap states are proposed.

  19. Discovery of dysprosium, holmium, erbium, thulium, and ytterbium isotopes

    SciTech Connect

    Fry, C.; Thoennessen, M.

    2013-09-15

    Currently, thirty-one dysprosium, thirty-two holmium, thirty-two erbium, thirty-three thulium, and thirty-one ytterbium isotopes have been observed and the discovery of these isotopes is described here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented.

  20. {sup 163}Ho based experiments

    SciTech Connect

    Gastaldo, Loredana

    2015-07-15

    The analysis of the endpoint region of the calorimetrically measured {sup 163}Ho electron capture spectrum is a very promising way to determine the mass of the electron neutrino. The achievable sensitivity of {sup 163}Ho-based experiments and the experimental challenges will be presented. Three large collaborations aim at developing large scale experiments able to reach sub-eV sensitivity. Presently pilot experiments are performed to demonstrate the possibility to calorimetrically measure high precision and high statistics {sup 163}Ho spectra. The different approaches as well as the state of the art of the experimental efforts for the three collaborations will be discussed.

  1. Limit on the Temporal Variation of the Fine-Structure Constant Using Atomic Dysprosium

    SciTech Connect

    Cingoez, A.; Lapierre, A.; Leefer, N.; Nguyen, A.-T.; Lamoreaux, S. K.; Torgerson, J. R.; Budker, D.

    2007-01-26

    Over 8 months, we monitored transition frequencies between nearly degenerate, opposite-parity levels in two isotopes of atomic dysprosium (Dy). These frequencies are sensitive to variation of the fine-structure constant ({alpha}) due to relativistic corrections of opposite sign for the opposite-parity levels. In this unique system, in contrast to atomic-clock comparisons, the difference of the electronic energies of the opposite-parity levels can be monitored directly utilizing a rf electric-dipole transition between them. Our measurements show that the frequency variation of the 3.1-MHz transition in {sup 163}Dy and the 235-MHz transition in {sup 162}Dy are 9.0{+-}6.7 Hz/yr and -0.6{+-}6.5 Hz/yr, respectively. These results provide a rate of fractional variation of {alpha} of (-2.7{+-}2.6)x10{sup -15} yr{sup -1} (1{sigma}) without assumptions on constancy of other fundamental constants, indicating absence of significant variation at the present level of sensitivity.

  2. Selected-control synthesis of dysprosium hydroxide and oxide nanorods by adjusting hydrothermal temperature

    SciTech Connect

    Song Xuchun Zheng Yifan; Wang Yun

    2008-05-06

    Dysprosium hydroxide and oxide nanorods were prepared directly from commercial bulk Dy{sub 2}O{sub 3} crystals by facile hydrothermal process at 130 and 210 deg. C, respectively. The as-synthesized dysprosium hydroxide and oxide nanorods were investigated by various techniques of XRD, TEM, SEM, and EDS. In the process, the temperature was found to play important roles in determining produce dysprosium hydroxide and oxide nanorods.

  3. Study of electronic structure and spin polarization of dysprosium

    SciTech Connect

    Mund, H. S.

    2015-06-24

    In this paper, I have presented the spin-dependent momentum density of ferromagnetic dysprosium using spin polarized relativistic Korringa-Kohn-Rostoker method. A fully relativistic approach has been used to determine the magnetic Compton profile. The density of state in term of majority-spin and minority-spin of Dy also calculated using SPR-KKR. The magnetic Compton profile discussed in term of 4f and diffused electrons.

  4. 19 CFR 163.3 - Entry records.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Entry records. 163.3 Section 163.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.3 Entry records. Any person described in § 163.2(a) with reference to...

  5. 19 CFR 163.3 - Entry records.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Entry records. 163.3 Section 163.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.3 Entry records. Any person described in § 163.2(a) with reference to...

  6. 19 CFR 163.3 - Entry records.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 19 Customs Duties 2 2012-04-01 2012-04-01 false Entry records. 163.3 Section 163.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.3 Entry records. Any person described in § 163.2(a) with reference to...

  7. 19 CFR 163.3 - Entry records.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Entry records. 163.3 Section 163.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.3 Entry records. Any person described in § 163.2(a) with reference to...

  8. Magnetic structure of dysprosium in epitaxial Dy films and in Dy/Er superlattices

    SciTech Connect

    Dumesnil, K.; Dufour, C.; Mangin, P.; Marchal, G.; Hennion, M.

    1996-09-01

    We present a magnetization and neutron-diffraction study of the basal plane magnetic structure of Dy epitaxial films and Dy/Er superlattices. The thermal evolution of the magnetic phases, the stability of the helical phase under a magnetic field, the thermal variation of the dysprosium in-plane and {ital c} parameters, and of the dysprosium turn angle are successively shown. In Dy/Er superlattices, the dysprosium helix propagates coherently through paramagnetic erbium; at low temperature, individual dysprosium layers undergo a ferromagnetic transition and are coupled antiferromagnetically to each other for erbium layers thicknesses larger than 20 A. In dysprosium films, as expected from the epitaxy effect, the Curie temperature of dysprosium is reduced if dysprosium is grown on yttrium and increased if it is grown on erbium, whereas it is unexpectedly close to the bulk value in Dy/Er superlattices. This amazing value of the Curie temperature in superlattices is correlated to two main experimentally observed effects: (i) the magnetoelastic driving force is reduced compared to bulk dysprosium because of the clamped {gamma} distortion; (ii) the difference between the exchange energies in the helical and the ferromagnetic phases is increased compared to the bulk value. {copyright} {ital 1996 The American Physical Society.}

  9. Nuclear Data Sheets for A = 163

    SciTech Connect

    Reich, C.W.; Singh, Balraj

    2010-05-15

    The available data from the various reaction and decay studies leading to nuclides having mass number A=163 have been reviewed. These data are summarized and presented, together with adopted level schemes and properties, for nuclides from Eu (Z=63) through Os (Z=76). {sup 163}Eu represents a new addition to these nuclides. Level structures are now known for {sup 163}Ta and {sup 163}W through high-spin studies and recoil-decay tagging techniques. Several radioactive decays in this mass chain are not known at all or poorly established. No {beta} or {gamma}-ray data are available for {sup 163}Re-{sup 163}W-{sup 163}Ta-{sup 163}Hf {epsilon} decay chain. Those for {sup 163}Hf-{sup 163}Lu-{sup 163}Yb {epsilon} decay chain and {sup 163}Eu-{sup 163}Gd-{sup 163}Tb {beta}{sup -} decay chain are very sketchy. This evaluation is an update and revision of the previous one (2000Si01)

  10. Dysprosium electrodeposition from a hexaalkylguanidinium-based ionic liquid

    NASA Astrophysics Data System (ADS)

    Berger, Claudia A.; Arkhipova, Maria; Maas, Gerhard; Jacob, Timo

    2016-07-01

    The rare-earth element dysprosium (Dy) is an important additive that increases the magnetocrystalline anisotropy of neodymium magnets and additionally prevents from demagnetizing at high temperatures. Therefore, it is one of the most important elements for high-tech industries and is mainly used in permanent magnetic applications, for example in electric vehicles, industrial motors and direct-drive wind turbines. In an effort to develop a more efficient electrochemical technique for depositing Dy on Nd-magnets in contrast to commonly used costly physical vapor deposition, we investigated the electrochemical behavior of dysprosium(iii) trifluoromethanesulfonate in a custom-made guanidinium-based room-temperature ionic liquid (RTIL). We first examined the electrodeposition of Dy on an Au(111) model electrode. The investigation was carried out by means of cyclic voltammetry (CV) and X-ray photoelectron spectroscopy (XPS). The initial stages of metal deposition were followed by in situ scanning tunneling microscopy (STM). CV measurements revealed a large cathodic reduction peak, which corresponds to the growth of monoatomic high islands, based on STM images taken during the initial stages of deposition. XPS identified these deposited islands as dysprosium. A similar reduction peak was also observed on an Nd-Fe-B substrate, and positively identified as deposited Dy using XPS. Finally, we varied the concentration of the Dy precursor, electrolyte flow and temperature during Dy deposition and demonstrated that each of these parameters could be used to increase the thickness of the Dy deposit, suggesting that these parameters could be tuned simultaneously in a temperature-controlled flow cell to enhance the thickness of the Dy layer.The rare-earth element dysprosium (Dy) is an important additive that increases the magnetocrystalline anisotropy of neodymium magnets and additionally prevents from demagnetizing at high temperatures. Therefore, it is one of the most important

  11. Dysprosium electrodeposition from a hexaalkylguanidinium-based ionic liquid.

    PubMed

    Berger, Claudia A; Arkhipova, Maria; Maas, Gerhard; Jacob, Timo

    2016-08-01

    The rare-earth element dysprosium (Dy) is an important additive that increases the magnetocrystalline anisotropy of neodymium magnets and additionally prevents from demagnetizing at high temperatures. Therefore, it is one of the most important elements for high-tech industries and is mainly used in permanent magnetic applications, for example in electric vehicles, industrial motors and direct-drive wind turbines. In an effort to develop a more efficient electrochemical technique for depositing Dy on Nd-magnets in contrast to commonly used costly physical vapor deposition, we investigated the electrochemical behavior of dysprosium(iii) trifluoromethanesulfonate in a custom-made guanidinium-based room-temperature ionic liquid (RTIL). We first examined the electrodeposition of Dy on an Au(111) model electrode. The investigation was carried out by means of cyclic voltammetry (CV) and X-ray photoelectron spectroscopy (XPS). The initial stages of metal deposition were followed by in situ scanning tunneling microscopy (STM). CV measurements revealed a large cathodic reduction peak, which corresponds to the growth of monoatomic high islands, based on STM images taken during the initial stages of deposition. XPS identified these deposited islands as dysprosium. A similar reduction peak was also observed on an Nd-Fe-B substrate, and positively identified as deposited Dy using XPS. Finally, we varied the concentration of the Dy precursor, electrolyte flow and temperature during Dy deposition and demonstrated that each of these parameters could be used to increase the thickness of the Dy deposit, suggesting that these parameters could be tuned simultaneously in a temperature-controlled flow cell to enhance the thickness of the Dy layer. PMID:27121463

  12. Dysprosium electrodeposition from a hexaalkylguanidinium-based ionic liquid.

    PubMed

    Berger, Claudia A; Arkhipova, Maria; Maas, Gerhard; Jacob, Timo

    2016-08-01

    The rare-earth element dysprosium (Dy) is an important additive that increases the magnetocrystalline anisotropy of neodymium magnets and additionally prevents from demagnetizing at high temperatures. Therefore, it is one of the most important elements for high-tech industries and is mainly used in permanent magnetic applications, for example in electric vehicles, industrial motors and direct-drive wind turbines. In an effort to develop a more efficient electrochemical technique for depositing Dy on Nd-magnets in contrast to commonly used costly physical vapor deposition, we investigated the electrochemical behavior of dysprosium(iii) trifluoromethanesulfonate in a custom-made guanidinium-based room-temperature ionic liquid (RTIL). We first examined the electrodeposition of Dy on an Au(111) model electrode. The investigation was carried out by means of cyclic voltammetry (CV) and X-ray photoelectron spectroscopy (XPS). The initial stages of metal deposition were followed by in situ scanning tunneling microscopy (STM). CV measurements revealed a large cathodic reduction peak, which corresponds to the growth of monoatomic high islands, based on STM images taken during the initial stages of deposition. XPS identified these deposited islands as dysprosium. A similar reduction peak was also observed on an Nd-Fe-B substrate, and positively identified as deposited Dy using XPS. Finally, we varied the concentration of the Dy precursor, electrolyte flow and temperature during Dy deposition and demonstrated that each of these parameters could be used to increase the thickness of the Dy deposit, suggesting that these parameters could be tuned simultaneously in a temperature-controlled flow cell to enhance the thickness of the Dy layer.

  13. Joint solubility of samarium and dysprosium in solid magnesium

    NASA Astrophysics Data System (ADS)

    Rokhlin, L. L.; Dobatkina, T. V.; Lukyanova, E. A.; Korolkova, I. G.; Tarytina, I. E.

    2016-03-01

    The phase compositions of solid Mg-Sm-Dy alloys corresponding to the magnesium-corner region of the phase diagram are studied by optical and scanning electron microscopy, electrical resistivity measurements, and electron microprobe analysis. The obtained results allowed us to determine the joint solubility of samarium and dysprosium in solid magnesium at 500, 400, and 300°C; it decreases with decreasing temperature. The magnesium solid solution is found to be in equilibrium only with the Mg41Sm5 and Mg24Dy5 compounds, which are in equilibrium with the magnesium solid solution in the binary Mg-Sm and Mg-Dy systems.

  14. 21 CFR 163.113 - Cocoa.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a... requirements for label declaration of ingredients for breakfast cocoa in § 163.112, except that the cacao...

  15. 46 CFR 163.002-15 - Performance.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b)...

  16. 21 CFR 163.113 - Cocoa.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a... requirements for label declaration of ingredients for breakfast cocoa in § 163.112, except that the cacao...

  17. 21 CFR 163.113 - Cocoa.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a... requirements for label declaration of ingredients for breakfast cocoa in § 163.112, except that the cacao...

  18. 21 CFR 163.113 - Cocoa.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a... requirements for label declaration of ingredients for breakfast cocoa in § 163.112, except that the cacao...

  19. 25 CFR 163.61 - Evaluation committee.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Evaluation committee. 163.61 Section 163.61 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska... contracting and forestry....

  20. 25 CFR 163.61 - Evaluation committee.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Evaluation committee. 163.61 Section 163.61 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska... contracting and forestry....

  1. 25 CFR 163.61 - Evaluation committee.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Evaluation committee. 163.61 Section 163.61 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska... contracting and forestry....

  2. 25 CFR 163.61 - Evaluation committee.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Evaluation committee. 163.61 Section 163.61 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska... contracting and forestry....

  3. 16 CFR 16.3 - Policy.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Policy. 16.3 Section 16.3 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE ADVISORY COMMITTEE MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee...

  4. 16 CFR 16.3 - Policy.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 16 Commercial Practices 1 2011-01-01 2011-01-01 false Policy. 16.3 Section 16.3 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE ADVISORY COMMITTEE MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee...

  5. 16 CFR 16.3 - Policy.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 16 Commercial Practices 1 2013-01-01 2013-01-01 false Policy. 16.3 Section 16.3 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE ADVISORY COMMITTEE MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee only when it is essential to the conduct of...

  6. 16 CFR 16.3 - Policy.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 16 Commercial Practices 1 2012-01-01 2012-01-01 false Policy. 16.3 Section 16.3 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE ADVISORY COMMITTEE MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee...

  7. 50 CFR 16.3 - General restrictions.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false General restrictions. 16.3 Section 16.3..., POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS INJURIOUS WILDLIFE Introduction § 16.3 General restrictions. Any importation or transportation of...

  8. 50 CFR 16.3 - General restrictions.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 50 Wildlife and Fisheries 1 2011-10-01 2011-10-01 false General restrictions. 16.3 Section 16.3..., POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS INJURIOUS WILDLIFE Introduction § 16.3 General restrictions. Any importation or transportation of...

  9. 7 CFR 3015.163 - Real property.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 7 Agriculture 15 2011-01-01 2011-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the...

  10. 46 CFR 163.003-25 - Marking.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 46 Shipping 6 2011-10-01 2011-10-01 false Marking. 163.003-25 Section 163.003-25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-25 Marking. (a) Each pilot ladder...

  11. 46 CFR 163.003-25 - Marking.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Marking. 163.003-25 Section 163.003-25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-25 Marking. (a) Each pilot ladder...

  12. 50 CFR 648.163 - Gear restrictions.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Gear restrictions. 648.163 Section 648.163... Bluefish Fishery § 648.163 Gear restrictions. If the Council determines through its annual review or framework adjustment process that gear restrictions are necessary to assure that the fishing mortality...

  13. 21 CFR 163.130 - Milk chocolate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Milk chocolate. 163.130 Section 163.130 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a) Description. (1) Milk chocolate is the solid or semiplastic food prepared by intimately mixing and...

  14. 21 CFR 163.130 - Milk chocolate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Milk chocolate. 163.130 Section 163.130 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a) Description. (1) Milk chocolate is the solid or semiplastic food prepared by intimately mixing and...

  15. 21 CFR 163.130 - Milk chocolate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Milk chocolate. 163.130 Section 163.130 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a) Description. (1) Milk chocolate is the solid or semiplastic food prepared by intimately mixing and...

  16. 21 CFR 163.130 - Milk chocolate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Milk chocolate. 163.130 Section 163.130 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a) Description. (1) Milk chocolate is the solid or semiplastic food prepared by intimately mixing and...

  17. 21 CFR 163.130 - Milk chocolate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk chocolate. 163.130 Section 163.130 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a) Description. (1) Milk chocolate is the solid or semiplastic food prepared by intimately mixing and...

  18. 32 CFR 16.3 - Available sentences.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 32 National Defense 1 2012-07-01 2012-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in...

  19. 15 CFR 16.3 - Definitions.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 16.3 Section 16.3 Commerce and Foreign Trade Office of the Secretary of Commerce PROCEDURES FOR A VOLUNTARY CONSUMER PRODUCT INFORMATION LABELING PROGRAM § 16.3 Definitions. (a) The term Secretary means the Secretary of Commerce or...

  20. 19 CFR 163.0 - Scope.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Scope. 163.0 Section 163.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.0 Scope. This part sets forth the recordkeeping requirements and procedures governing...

  1. 40 CFR 408.163 - [Reserved

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 29 2014-07-01 2012-07-01 true 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing Subcategory § 408.163...

  2. 40 CFR 408.163 - [Reserved

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 30 2012-07-01 2012-07-01 false 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing Subcategory § 408.163...

  3. 40 CFR 408.163 - [Reserved

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 30 2013-07-01 2012-07-01 true 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing Subcategory § 408.163...

  4. 40 CFR 408.163 - [Reserved

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing Subcategory § 408.163...

  5. 40 CFR 408.163 - [Reserved

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 29 2011-07-01 2009-07-01 true 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing Subcategory § 408.163...

  6. 36 CFR 223.163 - [Reserved

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Export and Substitution Restrictions § 223.163...

  7. 46 CFR 163.003-17 - Strength.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must...

  8. 46 CFR 163.003-17 - Strength.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 46 Shipping 6 2014-10-01 2014-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must...

  9. 46 CFR 163.003-17 - Strength.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 46 Shipping 6 2011-10-01 2011-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must...

  10. 46 CFR 163.003-17 - Strength.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 46 Shipping 6 2012-10-01 2012-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must...

  11. 46 CFR 163.003-17 - Strength.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 46 Shipping 6 2013-10-01 2013-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must...

  12. 25 CFR 163.21 - Bonds required.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Bonds required. 163.21 Section 163.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with...

  13. 25 CFR 163.2 - Information collection.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Information collection. 163.2 Section 163.2 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.2 Information collection. The information collection requirements contained in 25 CFR...

  14. 25 CFR 163.72 - Supervisory relationship.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary,...

  15. 25 CFR 163.2 - Information collection.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Information collection. 163.2 Section 163.2 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.2 Information collection. The information collection requirements contained in 25 CFR...

  16. 25 CFR 163.12 - Harvesting restrictions.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Harvesting restrictions. 163.12 Section 163.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.12 Harvesting restrictions. (a) Harvesting timber on commercial forest...

  17. 25 CFR 163.12 - Harvesting restrictions.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Harvesting restrictions. 163.12 Section 163.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.12 Harvesting restrictions. (a) Harvesting timber on commercial forest...

  18. 25 CFR 163.2 - Information collection.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Information collection. 163.2 Section 163.2 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.2 Information collection. The information collection requirements contained in 25 CFR...

  19. 25 CFR 163.2 - Information collection.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Information collection. 163.2 Section 163.2 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.2 Information collection. The information collection requirements contained in 25 CFR...

  20. 25 CFR 163.12 - Harvesting restrictions.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Harvesting restrictions. 163.12 Section 163.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.12 Harvesting restrictions. (a) Harvesting timber on commercial forest...

  1. 25 CFR 163.21 - Bonds required.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Bonds required. 163.21 Section 163.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with...

  2. 25 CFR 163.12 - Harvesting restrictions.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Harvesting restrictions. 163.12 Section 163.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.12 Harvesting restrictions. (a) Harvesting timber on commercial forest...

  3. 25 CFR 163.72 - Supervisory relationship.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary,...

  4. 25 CFR 163.21 - Bonds required.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Bonds required. 163.21 Section 163.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with...

  5. 25 CFR 163.34 - Environmental compliance.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Environmental compliance. 163.34 Section 163.34 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.34 Environmental compliance. Actions taken by the Secretary under...

  6. 25 CFR 163.2 - Information collection.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Information collection. 163.2 Section 163.2 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.2 Information collection. The information collection requirements contained in 25 CFR...

  7. 25 CFR 163.34 - Environmental compliance.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Environmental compliance. 163.34 Section 163.34 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.34 Environmental compliance. Actions taken by the Secretary under...

  8. 25 CFR 163.21 - Bonds required.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Bonds required. 163.21 Section 163.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with...

  9. 25 CFR 163.72 - Supervisory relationship.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary,...

  10. 25 CFR 163.72 - Supervisory relationship.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary,...

  11. 25 CFR 163.21 - Bonds required.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Bonds required. 163.21 Section 163.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with...

  12. 25 CFR 163.72 - Supervisory relationship.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary,...

  13. 25 CFR 163.34 - Environmental compliance.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Environmental compliance. 163.34 Section 163.34 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.34 Environmental compliance. Actions taken by the Secretary under...

  14. 25 CFR 163.12 - Harvesting restrictions.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Harvesting restrictions. 163.12 Section 163.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.12 Harvesting restrictions. (a) Harvesting timber on commercial forest...

  15. 21 CFR 163.111 - Chocolate liquor.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Chocolate liquor. 163.111 Section 163.111 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor. (a) Description. (1) Chocolate liquor is the solid or semiplastic food prepared by finely...

  16. 25 CFR 163.61 - Evaluation committee.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Evaluation committee. 163.61 Section 163.61 Indians... Native Technical Assistance Program § 163.61 Evaluation committee. (a) The Secretary shall establish an evaluation committee to assess and rate technical assistance project proposals. This committee will...

  17. 7 CFR 1.163 - The complaint.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 7 Agriculture 1 2011-01-01 2011-01-01 false The complaint. 1.163 Section 1.163 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Rules of Practice Governing Cease and Desist Proceedings Under Section 2 of the Capper-Volstead Act § 1.163 The complaint. The complaint...

  18. 7 CFR 1.163 - The complaint.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false The complaint. 1.163 Section 1.163 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Rules of Practice Governing Cease and Desist Proceedings Under Section 2 of the Capper-Volstead Act § 1.163 The complaint. The complaint...

  19. 7 CFR 1.163 - The complaint.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 1 2014-01-01 2014-01-01 false The complaint. 1.163 Section 1.163 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Rules of Practice Governing Cease and Desist Proceedings Under Section 2 of the Capper-Volstead Act § 1.163 The complaint. The complaint...

  20. 7 CFR 1.163 - The complaint.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 1 2013-01-01 2013-01-01 false The complaint. 1.163 Section 1.163 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Rules of Practice Governing Cease and Desist Proceedings Under Section 2 of the Capper-Volstead Act § 1.163 The complaint. The complaint...

  1. 25 CFR 163.71 - Agreement funding.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance...

  2. 25 CFR 163.71 - Agreement funding.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance...

  3. 25 CFR 163.71 - Agreement funding.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance...

  4. 25 CFR 163.71 - Agreement funding.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance...

  5. 25 CFR 163.71 - Agreement funding.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance...

  6. 19 CFR 163.7 - Summons.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Summons. 163.7 Section 163.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.7 Summons. (a) Who may be served. During the course of any investigation or...

  7. 19 CFR 163.0 - Scope.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Scope. 163.0 Section 163.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.0 Scope. This part sets forth the recordkeeping requirements and procedures governing...

  8. 19 CFR 163.7 - Summons.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Summons. 163.7 Section 163.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.7 Summons. (a) Who may be served. During the course of any investigation, audit or...

  9. 19 CFR 163.0 - Scope.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Scope. 163.0 Section 163.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.0 Scope. This part sets forth the recordkeeping requirements and procedures governing...

  10. 19 CFR 163.0 - Scope.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 19 Customs Duties 2 2012-04-01 2012-04-01 false Scope. 163.0 Section 163.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.0 Scope. This part sets forth the recordkeeping requirements and procedures governing...

  11. 25 CFR 163.32 - Forest development.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Forest development. 163.32 Section 163.32 Indians BUREAU... Management and Operations § 163.32 Forest development. Forest development pertains to forest land management activities undertaken to improve the sustainable productivity of commercial Indian forest land. The...

  12. 25 CFR 163.32 - Forest development.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Forest development. 163.32 Section 163.32 Indians BUREAU... Management and Operations § 163.32 Forest development. Forest development pertains to forest land management activities undertaken to improve the sustainable productivity of commercial Indian forest land. The...

  13. 25 CFR 163.32 - Forest development.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Forest development. 163.32 Section 163.32 Indians BUREAU... Management and Operations § 163.32 Forest development. Forest development pertains to forest land management activities undertaken to improve the sustainable productivity of commercial Indian forest land. The...

  14. 25 CFR 163.32 - Forest development.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Forest development. 163.32 Section 163.32 Indians BUREAU... Management and Operations § 163.32 Forest development. Forest development pertains to forest land management activities undertaken to improve the sustainable productivity of commercial Indian forest land. The...

  15. 25 CFR 163.32 - Forest development.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Forest development. 163.32 Section 163.32 Indians BUREAU... Management and Operations § 163.32 Forest development. Forest development pertains to forest land management activities undertaken to improve the sustainable productivity of commercial Indian forest land. The...

  16. 21 CFR 163.114 - Lowfat cocoa.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Lowfat cocoa. 163.114 Section 163.114 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a) Description. Lowfat cocoa is the food that conforms to the definition and standard of identity, and is...

  17. 21 CFR 163.113 - Cocoa.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to...

  18. 16 CFR 16.3 - Policy.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 16 Commercial Practices 1 2014-01-01 2014-01-01 false Policy. 16.3 Section 16.3 Commercial... MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee only... provided to the Congress and the public regarding advisory committees, and that there are...

  19. 46 CFR 163.002-11 - Materials.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 46 Shipping 6 2011-10-01 2011-10-01 false Materials. 163.002-11 Section 163.002-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-11 Materials. (a) Gears. Each gear in a...

  20. 46 CFR 163.002-11 - Materials.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 46 Shipping 6 2012-10-01 2012-10-01 false Materials. 163.002-11 Section 163.002-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-11 Materials. (a) Gears. Each gear in a...

  1. 25 CFR 163.34 - Environmental compliance.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Environmental compliance. 163.34 Section 163.34 Indians... Management and Operations § 163.34 Environmental compliance. Actions taken by the Secretary under the regulations in this part must comply with the National Environmental Policy Act of 1969, applicable Council...

  2. 50 CFR 16.3 - General restrictions.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 50 Wildlife and Fisheries 1 2012-10-01 2012-10-01 false General restrictions. 16.3 Section 16.3 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING, POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS INJURIOUS WILDLIFE Introduction § 16.3...

  3. Oxyfluorotellurite glasses doped by dysprosium ions. Thermal and optical properties

    NASA Astrophysics Data System (ADS)

    Klimesz, Barbara; Ryba-Romanowski, Witold; Lisiecki, Radosław

    2015-04-01

    The paper shows results of investigation of thermal and optical properties of oxyfluorotellurite (65 - x)TeO2-20ZnF2-12Pb2O5-3Nb2O5-xDy2O3 (x = 0.5, 2 and 5) glass systems. Thermal stability and the onset of crystallization of the materials were monitored by differential thermal analysis (DTA). It was found that characteristic parameters, namely glass transition temperatures (Tg), onset of crystallization temperatures (Tc) and thermal stability criteria ΔT and H' increased with increasing Dy2O3 content indicating that the incorporation of dysprosium ions improves substantially thermal stability of glass system under study. Optical absorption and emission spectra of Dy3+ ions in oxyfluorotellurite glass were investigated at room temperature in the visible (VIS) and near-infrared (NIR) region. Oscillator strengths, phenomenological Judd-Ofelt (JO) intensity parameters Ω2,4,6, radiative transition probabilities, branching ratios and radiative lifetimes of luminescent levels were determined. Decay curves of the 4F9/2 luminescence of incorporated Dy3+ ions were recorded and analysed. Lifetimes and the luminescence dynamics were studied as a function of the Dy2O3 concentration. It was concluded that good thermal stability combined with desirable spectroscopic parameters of investigated dysprosium-doped oxyfluorotellurite glass point at the suitability of this material for the design of UV-excited visible phosphors.

  4. Photoelectric and luminescent properties of dysprosium-doped silver chloride

    SciTech Connect

    Novikov, G. F. Rabenok, E. V.; Bocharov, K. V.; Lichkova, N. V.; Ovchinnikov, O. V.; Latyshev, A. N.

    2011-02-15

    The influence of dysprosium doping on the photoelectric and luminescent properties of AgCl crystals is studied by methods of microwave photoconductivity and photoluminescence. Doping affects both the loss kinetics of photogenerated electrons and luminescence spectra and parameters of photostimulated burst of luminescence. It is shown that the charged [Dy{sub Ag}{sup {center_dot}{center_dot}} {center_dot} V Prime {sub Ag}]{sup {center_dot}} or neutral [Dy{sub Ag}{sup {center_dot}{center_dot}} {center_dot} 2V Prime {sub Ag}]{sup x} complexes are responsible for a new luminescence band peaked at 470 nm, which manifests itself at weight concentrations of the doping additive >10{sup -6}%. The long-wavelength shoulder at 570 nm in the photoluminescence spectra is attributed to intracenter transitions in the Dy{sup 3+} ions. The rate constant of the reaction of electron capture into the traps forming upon introduction of the dopant, k{sub t} = (3-5) Multiplication-Sign 10{sup -8} cm{sup 3} s{sup -1}, is evaluated. It is assumed that the traps are Dy{sup 3+} dysprosium ions.

  5. Two dysprosium-incorporated tungstoarsenates: synthesis, structures and magnetic properties.

    PubMed

    Li, Fengyan; Guo, Weihua; Xu, Lin; Ma, Lifang; Wang, Yuchao

    2012-08-14

    Two dysprosium-containing tungstoarsenates [C(NH(2))(3)](11)[Dy(2)(Hcit)(2)(AsW(10)O(38))]·9H(2)O (1) and K(8-n)H(3-n)[Dy(3-n)K(n)(H(2)O)(3)(CO(3))(A-α-AsW(9)O(34))(A-β-AsW(9)O(34))]·22H(2)O (n = 0 or 1) (2) have been synthesized and characterized by single-crystal X-ray diffraction, elemental analyses, thermogravimetric analyses and infrared spectroscopy. Compound 1 is a citrate-decorated Keggin type di-substituted Ln/POM derivative with the two non-adjacent substituted sites occupied. Compound 2 is composed of two different trivacant Keggin unit isomers [A-α-AsW(9)O(34)](9-) and [A-β-AsW(9)O(34)](9-), linked to each other via one {Dy(3-n)K(n)(H(2)O)(3)(CO(3))}((7 - 2n)+) (n = 0 or 1) unit, where CO(3)(2-) is encapsulated in the triangle plane, resulting in a stable dysprosium carbonate-containing sandwich-type polyoxoanion with D(2h) symmetry. The investigation on both static and dynamic magnetic properties of 1 and 2 show that the magnetic relaxation behavior of 2 appear in a static magnetic field of 5000 Oe, while 1 shows no positive out-of-phase ac susceptibility.

  6. Dysprosium oxide ceramic arc tube for HID lamps

    NASA Astrophysics Data System (ADS)

    Wei, G. C.; Lapatovich, W. P.; Browne, J.; Snellgrove, R.

    2008-07-01

    Polycrystalline dysprosium oxide is a candidate arc tube material for advanced metal halide lamps because of high transparency, low thermodynamic driving potentials for corrosion and reaction with the salt fills, satisfactory mechanical strength and resistance to thermal shock. This material is cubic and can be polished to achieve higher in-line transmittance than the conventional polycrystalline alumina arc tubes. Rare-earth halide fills, glass frit seals and niobium leads were used in the construction of the Dy2O3 lamps. The experimental lamps exhibited a colour temperature of ~2500 K and CRI of ~90 with rapid warm-up behaviour. The transparent Dy2O3 ceramic offers opportunities to push the limit of ceramic envelopes for improved discharge lamps.

  7. Theoretical study of some experimentally relevant states of dysprosium

    SciTech Connect

    Dzuba, V. A.; Flambaum, V. V.

    2010-05-15

    Configuration interaction method is used to calculate transition amplitudes and other properties of the low states of dysprosium which are used in cooling and in the study of the time variation of the fine structure constant and violation of fundamental symmetries. The branching ratio for the cooling state to decay to states other than ground states is found to be smaller than 10{sup -4}. The matrix element of the weak interaction between degenerate states at E=19797.96 cm{sup -1} is about 4 Hz which is consistent with the experimental limit |H{sub W}|=|2.3{+-}2.9(stat.){+-}0.7(syst.)| Hz [A. T. Nguyen, D. Budker, D. DeMille, and M. Zolotorev, Phys. Rev. A 56, 3453 (1997)] and points to feasibility of its experimental measurement. Applications include the search for physics beyond the standard model using the parity nonconservation (PNC) isotopic chain approach.

  8. Peptoid-ligated pentadecanuclear yttrium and dysprosium hydroxy clusters.

    PubMed

    Thielemann, Dominique T; Wagner, Anna T; Lan, Yanhua; Oña-Burgos, Pascual; Fernández, Ignacio; Rösch, Esther S; Kölmel, Dominik K; Powell, Annie K; Bräse, Stefan; Roesky, Peter W

    2015-02-01

    A new family of pentadecanuclear coordination cluster compounds (from now on simply referred to as clusters) [{Ln15 (OH)20 (PepCO2 )10 (DBM)10 Cl}Cl4 ] (PepCO2 =2-[{3-(((tert-butoxycarbonyl)amino)methyl)benzyl}amino]acetate, DBM=dibenzoylmethanide) with Ln=Y and Dy was obtained by using the cell-penetrating peptoid (CPPo) monomer PepCO2 H and dibenzoylmethane (DBMH) as supporting ligands. The combination of an inorganic cluster core with an organic cell-penetrating peptoid in the coordination sphere resulted in a core component {Ln15 (μ3 -OH)20 Cl}(24+) (Ln=Y, Dy), which consists of five vertex-sharing heterocubane {Ln4 (μ3 -OH)4 }(8+) units that assemble to give a pentagonal cyclic structure with one Cl atom located in the middle of the pentagon. The solid-state structures of both clusters were established by single-crystal X-ray crystallography. MS (ESI) experiments suggest that the cluster core is robust and maintained in solution. Pulsed gradient spin echo (PGSE) NMR diffusion measurements were carried out on the diamagnetic yttrium compound and confirmed the stability of the cluster in its dicationic form [{Y15 (μ3 -OH)20 (PepCO2 )10 (DBM)10 Cl}Cl2 ](2+) . The investigation of both static (dc) and dynamic (ac) magnetic properties in the dysprosium cluster revealed a slow relaxation of magnetization, indicative of single-molecule magnet (SMM) behavior below 8 K. Furthermore, the χT product as a function of temperature for the dysprosium cluster gave evidence that this is a ferromagnetically coupled compound below 11 K.

  9. Butterfly-shaped pentanuclear dysprosium single-molecule magnets.

    PubMed

    Tian, Haiquan; Zhao, Lang; Lin, Haifeng; Tang, Jinkui; Li, Guangshe

    2013-09-23

    Two new "butterfly-shaped" pentanuclear dysprosium(III) clusters, [Dy5(μ3-OH)3(opch)6(H2O)3]⋅3 MeOH⋅9 H2O (1) and [Dy5(μ3-OH)3(Hopch)2(opch)4(MeOH)(H2O)2]⋅(ClO4)2⋅6 MeOH⋅4 H2O (2), which were based on the heterodonor-chelating ligand o-vanillin pyrazine acylhydrazone (H2opch), have been successfully synthesized by applying different reaction conditions. Single-crystal X-ray diffraction analysis revealed that the butterfly-shaped cores in both compounds were comparable. However, their magnetic properties were drastically different. Indeed, compound 1 showed dual slow-relaxation processes with a transition between them that corresponded to energy gaps (Δ) of 8.1 and 37.9 K and pre-exponential factors (τ0) of 1.7×10(-5) and 9.7×10(-8)  s for the low- and high-temperature domains, respectively, whilst only a single relaxation process was noted for compound 2 (Δ = 197 K, τ0 = 3.2×10(-9)  s). These significant disparities are most likely due to the versatile coordination of the H2opch ligands with particular keto-enol tautomerism, which alters the strength of the local crystal field and, hence, the nature or direction of the easy axes of anisotropic dysprosium ions.

  10. Peptoid-ligated pentadecanuclear yttrium and dysprosium hydroxy clusters.

    PubMed

    Thielemann, Dominique T; Wagner, Anna T; Lan, Yanhua; Oña-Burgos, Pascual; Fernández, Ignacio; Rösch, Esther S; Kölmel, Dominik K; Powell, Annie K; Bräse, Stefan; Roesky, Peter W

    2015-02-01

    A new family of pentadecanuclear coordination cluster compounds (from now on simply referred to as clusters) [{Ln15 (OH)20 (PepCO2 )10 (DBM)10 Cl}Cl4 ] (PepCO2 =2-[{3-(((tert-butoxycarbonyl)amino)methyl)benzyl}amino]acetate, DBM=dibenzoylmethanide) with Ln=Y and Dy was obtained by using the cell-penetrating peptoid (CPPo) monomer PepCO2 H and dibenzoylmethane (DBMH) as supporting ligands. The combination of an inorganic cluster core with an organic cell-penetrating peptoid in the coordination sphere resulted in a core component {Ln15 (μ3 -OH)20 Cl}(24+) (Ln=Y, Dy), which consists of five vertex-sharing heterocubane {Ln4 (μ3 -OH)4 }(8+) units that assemble to give a pentagonal cyclic structure with one Cl atom located in the middle of the pentagon. The solid-state structures of both clusters were established by single-crystal X-ray crystallography. MS (ESI) experiments suggest that the cluster core is robust and maintained in solution. Pulsed gradient spin echo (PGSE) NMR diffusion measurements were carried out on the diamagnetic yttrium compound and confirmed the stability of the cluster in its dicationic form [{Y15 (μ3 -OH)20 (PepCO2 )10 (DBM)10 Cl}Cl2 ](2+) . The investigation of both static (dc) and dynamic (ac) magnetic properties in the dysprosium cluster revealed a slow relaxation of magnetization, indicative of single-molecule magnet (SMM) behavior below 8 K. Furthermore, the χT product as a function of temperature for the dysprosium cluster gave evidence that this is a ferromagnetically coupled compound below 11 K. PMID:25483296

  11. A nine-coordinated dysprosium(III) compound with an oxalate-bridged dysprosium(III) layer exhibiting two slow magnetic relaxation processes.

    PubMed

    Zhang, Sheng; Ke, Hongshan; Liu, Xiangyu; Wei, Qing; Xie, Gang; Chen, Sanping

    2015-10-21

    A 2D oxalate-bridged dysprosium(III) compound, formulated as [Dy(C2O4)1.5(H2O)3]n·2nH2O (1), has been hydrothermally isolated. As for compound 1, structural analysis reveals that the nine-coordinated Dy(III) ions reside in a slightly distorted tricapped trigonal prism. Under an applied magnetic field of 700 Oe, the compound was magnetically characterized as a new example that two slow relaxations of the magnetization processes can be observed in a 2D oxalate-bridged dysprosium(III) layer. PMID:26327427

  12. A nine-coordinated dysprosium(III) compound with an oxalate-bridged dysprosium(III) layer exhibiting two slow magnetic relaxation processes.

    PubMed

    Zhang, Sheng; Ke, Hongshan; Liu, Xiangyu; Wei, Qing; Xie, Gang; Chen, Sanping

    2015-10-21

    A 2D oxalate-bridged dysprosium(III) compound, formulated as [Dy(C2O4)1.5(H2O)3]n·2nH2O (1), has been hydrothermally isolated. As for compound 1, structural analysis reveals that the nine-coordinated Dy(III) ions reside in a slightly distorted tricapped trigonal prism. Under an applied magnetic field of 700 Oe, the compound was magnetically characterized as a new example that two slow relaxations of the magnetization processes can be observed in a 2D oxalate-bridged dysprosium(III) layer.

  13. 12 CFR 303.163 - Processing.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Processing. 303.163 Section 303.163 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE FILING PROCEDURES Mutual-To... the Office of Thrift Supervision (OTS) (12 CFR part 563b), as currently in effect at the time...

  14. 14 CFR 145.163 - Training requirements.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Training requirements. 145.163 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Personnel § 145.163 Training requirements. (a) A certificated repair station must have an employee training program approved by the FAA that consists of...

  15. 19 CFR 191.163 - Documentation.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Documentation. 191.163 Section 191.163 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform to...

  16. 21 CFR 556.163 - Clorsulon.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Clorsulon. 556.163 Section 556.163 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS... residues of clorsulon is 8 micrograms per kilogram of body weight per day. (b) Tolerances—(1)...

  17. 36 CFR 223.163 - [Reserved

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 36 Parks, Forests, and Public Property 2 2011-07-01 2011-07-01 false 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber Export...

  18. 19 CFR 191.163 - Documentation.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Documentation. 191.163 Section 191.163 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform to...

  19. 19 CFR 191.163 - Documentation.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Documentation. 191.163 Section 191.163 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform to...

  20. 49 CFR 173.163 - Hydrogen fluoride.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned...

  1. 50 CFR 648.163 - Gear restrictions.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 50 Wildlife and Fisheries 10 2011-10-01 2011-10-01 false Gear restrictions. 648.163 Section 648... Atlantic Bluefish Fishery § 648.163 Gear restrictions. Link to an amendment published at 76 FR 60640, Sept... gear restrictions are necessary to assure that the fishing mortality rate is not exceeded, or to...

  2. 21 CFR 163.135 - Buttermilk chocolate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products §...

  3. 24 CFR 982.163 - Fraud recoveries.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... Administration of Program § 982.163 Fraud recoveries. Under 24 CFR part 792, the PHA may retain a portion of program fraud losses that the PHA recovers from a family or owner by litigation, court-order or a... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Fraud recoveries. 982.163...

  4. 21 CFR 163.110 - Cacao nibs.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Cacao nibs. 163.110 Section 163.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...) Description. (1) Cacao nibs is the food prepared by removing the shell from cured, cleaned, dried, and...

  5. 21 CFR 163.110 - Cacao nibs.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Cacao nibs. 163.110 Section 163.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...) Description. (1) Cacao nibs is the food prepared by removing the shell from cured, cleaned, dried, and...

  6. 21 CFR 163.110 - Cacao nibs.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cacao nibs. 163.110 Section 163.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...) Description. (1) Cacao nibs is the food prepared by removing the shell from cured, cleaned, dried, and...

  7. 21 CFR 163.110 - Cacao nibs.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Cacao nibs. 163.110 Section 163.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...) Description. (1) Cacao nibs is the food prepared by removing the shell from cured, cleaned, dried, and...

  8. 27 CFR 26.163 - General requirements.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false General requirements. 26.163 Section 26.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep...

  9. 24 CFR 982.163 - Fraud recoveries.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... Administration of Program § 982.163 Fraud recoveries. Under 24 CFR part 792, the PHA may retain a portion of program fraud losses that the PHA recovers from a family or owner by litigation, court-order or a... 24 Housing and Urban Development 4 2013-04-01 2013-04-01 false Fraud recoveries. 982.163...

  10. 24 CFR 982.163 - Fraud recoveries.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... Administration of Program § 982.163 Fraud recoveries. Under 24 CFR part 792, the PHA may retain a portion of program fraud losses that the PHA recovers from a family or owner by litigation, court-order or a... 24 Housing and Urban Development 4 2011-04-01 2011-04-01 false Fraud recoveries. 982.163...

  11. 24 CFR 982.163 - Fraud recoveries.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... Administration of Program § 982.163 Fraud recoveries. Under 24 CFR part 792, the PHA may retain a portion of program fraud losses that the PHA recovers from a family or owner by litigation, court-order or a... 24 Housing and Urban Development 4 2012-04-01 2012-04-01 false Fraud recoveries. 982.163...

  12. 24 CFR 982.163 - Fraud recoveries.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... Administration of Program § 982.163 Fraud recoveries. Under 24 CFR part 792, the PHA may retain a portion of program fraud losses that the PHA recovers from a family or owner by litigation, court-order or a... 24 Housing and Urban Development 4 2014-04-01 2014-04-01 false Fraud recoveries. 982.163...

  13. 25 CFR 163.34 - Environmental compliance.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Environmental compliance. 163.34 Section 163.34 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest... Environmental Quality Regulations, and tribal laws and regulations....

  14. 46 CFR 163.002-11 - Materials.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials. 163.002-11 Section 163.002-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... materials. Materials of a pilot hoist that are not in watertight enclosures must be— (1)...

  15. 46 CFR 163.002-11 - Materials.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 46 Shipping 6 2014-10-01 2014-10-01 false Materials. 163.002-11 Section 163.002-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... materials. Materials of a pilot hoist that are not in watertight enclosures must be— (1)...

  16. 46 CFR 163.002-11 - Materials.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 46 Shipping 6 2013-10-01 2013-10-01 false Materials. 163.002-11 Section 163.002-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... materials. Materials of a pilot hoist that are not in watertight enclosures must be— (1)...

  17. 25 CFR 163.33 - Administrative appeals.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.33 Administrative appeals. Any challenge to action under 25 CFR part 163... provisions of 25 CFR part 2, Appeals from administrative actions, except that an appeal of any action...

  18. 25 CFR 163.33 - Administrative appeals.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.33 Administrative appeals. Any challenge to action under 25 CFR part 163... provisions of 25 CFR part 2, Appeals from administrative actions, except that an appeal of any action...

  19. 25 CFR 163.29 - Trespass.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and... deferral is not requested, the designated Bureau of Indian Affairs forestry trespass official...

  20. 25 CFR 163.33 - Administrative appeals.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.33 Administrative appeals. Any challenge to action under 25 CFR part 163... provisions of 25 CFR part 2, Appeals from administrative actions, except that an appeal of any action...

  1. 25 CFR 163.33 - Administrative appeals.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.33 Administrative appeals. Any challenge to action under 25 CFR part 163... provisions of 25 CFR part 2, Appeals from administrative actions, except that an appeal of any action...

  2. 25 CFR 163.29 - Trespass.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and... deferral is not requested, the designated Bureau of Indian Affairs forestry trespass official...

  3. 25 CFR 163.29 - Trespass.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and... deferral is not requested, the designated Bureau of Indian Affairs forestry trespass official...

  4. 25 CFR 163.29 - Trespass.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and... deferral is not requested, the designated Bureau of Indian Affairs forestry trespass official...

  5. 25 CFR 163.33 - Administrative appeals.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.33 Administrative appeals. Any challenge to action under 25 CFR part 163... provisions of 25 CFR part 2, Appeals from administrative actions, except that an appeal of any action...

  6. 25 CFR 163.29 - Trespass.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and... deferral is not requested, the designated Bureau of Indian Affairs forestry trespass official...

  7. 36 CFR 223.163 - [Reserved

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 36 Parks, Forests, and Public Property 2 2014-07-01 2014-07-01 false 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber Export...

  8. 36 CFR 223.163 - [Reserved

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 36 Parks, Forests, and Public Property 2 2012-07-01 2012-07-01 false 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber Export...

  9. 36 CFR 223.163 - [Reserved

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 36 Parks, Forests, and Public Property 2 2013-07-01 2013-07-01 false 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber Export...

  10. 21 CFR 163.135 - Buttermilk chocolate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate...

  11. 21 CFR 163.135 - Buttermilk chocolate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate...

  12. 32 CFR 552.163 - Applicability.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 32 National Defense 3 2014-07-01 2014-07-01 false Applicability. 552.163 Section 552.163 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY MILITARY RESERVATIONS AND NATIONAL CEMETERIES REGULATIONS AFFECTING MILITARY RESERVATIONS Land Use Policy for Fort Lewis, Yakima Training Center, and Camp Bonneville §...

  13. 10 CFR 501.163 - OFE evaluation.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 10 Energy 4 2014-01-01 2014-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT... OFE evaluation. (a) The record shall consist of the complaint and any supporting documents and all..., and may utilize in its evaluation any relevant facts obtained by such investigation or from any...

  14. 10 CFR 501.163 - OFE evaluation.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT... OFE evaluation. (a) The record shall consist of the complaint and any supporting documents and all..., and may utilize in its evaluation any relevant facts obtained by such investigation or from any...

  15. 21 CFR 163.135 - Buttermilk chocolate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard...

  16. 21 CFR 163.135 - Buttermilk chocolate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard...

  17. 49 CFR 173.163 - Hydrogen fluoride.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 49 Transportation 2 2013-10-01 2013-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned...

  18. 49 CFR 173.163 - Hydrogen fluoride.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 49 Transportation 2 2011-10-01 2011-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned...

  19. 49 CFR 173.163 - Hydrogen fluoride.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 49 Transportation 2 2012-10-01 2012-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned...

  20. 49 CFR 173.163 - Hydrogen fluoride.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 49 Transportation 2 2014-10-01 2014-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned...

  1. 14 CFR 21.163 - Privileges.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Privileges. 21.163 Section 21.163 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION... aircraft's type design under § 21.24(b), provided the training is given by a person holding a...

  2. 14 CFR 21.163 - Privileges.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 14 Aeronautics and Space 1 2011-01-01 2011-01-01 false Privileges. 21.163 Section 21.163 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION... aircraft's type design under § 21.24(b), provided the training is given by a person holding a...

  3. 40 CFR 721.9511 - Silicic acid (H6SiO2O7), magnesium, strontium salt(1:1:2), dysprosium and europium-doped.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ..., strontium salt(1:1:2), dysprosium and europium-doped. 721.9511 Section 721.9511 Protection of Environment...), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new..., strontium salt(1:1:2), dysprosium and europium-doped. (PMN P-98-848; CAS No.181828-07-9) is subject...

  4. 40 CFR 721.9511 - Silicic acid (H6SiO2O7), magnesium, strontium salt(1:1:2), dysprosium and europium-doped.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ..., strontium salt(1:1:2), dysprosium and europium-doped. 721.9511 Section 721.9511 Protection of Environment...), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new..., strontium salt(1:1:2), dysprosium and europium-doped. (PMN P-98-848; CAS No.181828-07-9) is subject...

  5. 25 CFR 163.26 - Forest product harvesting permits.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Forest product harvesting permits. 163.26 Section 163.26... Forest Management and Operations § 163.26 Forest product harvesting permits. (a) Except as provided in §§ 163.13 and 163.27 of this part, removal of forest products that are not under formal...

  6. 25 CFR 163.26 - Forest product harvesting permits.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Forest product harvesting permits. 163.26 Section 163.26... Forest Management and Operations § 163.26 Forest product harvesting permits. (a) Except as provided in §§ 163.13 and 163.27 of this part, removal of forest products that are not under formal...

  7. 25 CFR 163.26 - Forest product harvesting permits.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Forest product harvesting permits. 163.26 Section 163.26... Forest Management and Operations § 163.26 Forest product harvesting permits. (a) Except as provided in §§ 163.13 and 163.27 of this part, removal of forest products that are not under formal...

  8. 25 CFR 163.26 - Forest product harvesting permits.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Forest product harvesting permits. 163.26 Section 163.26... Forest Management and Operations § 163.26 Forest product harvesting permits. (a) Except as provided in §§ 163.13 and 163.27 of this part, removal of forest products that are not under formal...

  9. 25 CFR 163.26 - Forest product harvesting permits.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Forest product harvesting permits. 163.26 Section 163.26... Forest Management and Operations § 163.26 Forest product harvesting permits. (a) Except as provided in §§ 163.13 and 163.27 of this part, removal of forest products that are not under formal...

  10. Molecular beam epitaxy growth and characterization of dysprosium phosphide and dysprosium arsenide in gallium arsenide and gallium phosphide

    NASA Astrophysics Data System (ADS)

    Lee, Paul Piyawong

    The ability to grow thermally stable Schottky/ohmic contacts and buried, epitaxial metallic or semimetallic layers on semiconductors has many potential applications in novel device structures. Many rare earth group-V compounds with the sodium chloride structure possess the properties that make them potential candidates for stable contacts, buried layers, and other applications. In this work, two novel rare earth compounds, namely dysprosium phosphide (DyP) and dysprosium arsenide (DyAs) have been studied for high temperature ohmic/Schottky contacts to III-V semiconductors as well as for buried metal layers in semiconductor/metal/semiconductor structures. DyP and DyAs have been grown by molecular beam epitaxy on GaAs and GaP substrates. Both DyP and DyAs display metallic behavior and have room temperature resistivities of 8 x 10--5 and 1 x 10--4 Ocm, respectively. The electron concentrations for DyP and DyAs are about 4 x 1020 and 1 x 1021 cm--3, respectively. High quality DyP films as determined by XRD, AFM, and TEM can be achieved at a wide range of substrate temperatures (500°C to 600°C) with excess phosphorus pressure. Unlike most rare earth-group V compounds, DyP films are stable in air with no sign of oxidation. DyP films deposited on n-type GaAs and GaP exhibit Schottky behavior with room temperature barrier heights of 0.83 and 0.90 eV, respectively, with ideality factors close to unity and low reverse bias leakage current densities. These contacts are stable up to 250°C and 350°C for GaAs and GaP, respectively. DyAs films on the other hand, oxidize in air and display weak Schottky behavior on n-type GaAs. DyP has been grown as buried layers in both GaAs/DyP/GaAs and GaAs/DyP/GaP structures. Although high quality DyP layers have been achieved, the GaAs overlayers contain defects such as twins. The poor wetting of GaAs on DyP and the crystal symmetry between the two materials are responsible for the three-dimensional growth and the defects found in the Ga

  11. Dysprosium detector for neutron dosimetry in external beam radiotherapy

    NASA Astrophysics Data System (ADS)

    Ostinelli, A.; Berlusconi, C.; Conti, V.; Duchini, M.; Gelosa, S.; Guallini, F.; Vallazza, E.; Prest, M.

    2014-09-01

    Radiotherapy treatments with high-energy (>8 MeV) photon beams are a standard procedure in clinical practice, given the skin and near-target volumes sparing effect, the accurate penetration and the uniform spatial dose distribution. On the other hand, despite these advantages, neutrons may be produced via the photo-nuclear (γ,n) reactions of the high-energy photons with the high-Z materials in the accelerator head, in the treatment room and in the patient, resulting in an unwanted dose contribution which is of concern, given its potential to induce secondary cancers, and which has to be monitored. This work presents the design and the test of a portable Dysprosium dosimeter to be used during clinical treatments to estimate the "in vivo" dose to the patient. The dosimeter has been characterized and validated with tissue-equivalent phantom studies with a Varian Clinical iX 18 MV photon beam, before using it with a group of patients treated at the S. Anna Hospital in Como. The working principle of the dosimeter together with the readout chain and the results in terms of delivered dose are presented.

  12. Anomalous Elastic Behavior in hcp- and Sm-Type Dysprosium

    SciTech Connect

    Tschauner, Oliver; Grubor-Urosevic, Ognjen; Dera, Przemyslaw; Mulcahy, Sean R.

    2012-04-11

    The compression behavior of elemental dysprosium in the hcp- and the Sm-type phases has been examined under hydrostatic pressure. Sm-type Dy has been found about 1% denser than the hcp phase. This increase in density is due to c-axis contraction in Sm-type Dy, whereas the a-axis even expands compared with the hcp-phase. Both the hcp- and the Sm-type phases show an inversion in the pressure derivative of the c/a ratio. For hcp-Dy this inversion is very sharp with minimal c/a at 2.5 GPa. At the same pressure, the compression behavior of hcp-Dy changes abruptly from dominantly c-axis compression to almost isotropic compression with slightly softer S{sub 11}. The bulk modulus increases at this point by a factor of {approx}2. Both hcp- and Sm-type Dy exhibit a crossover from highly anisotropic compression mostly along the c-axis to almost isotropic compression. We discuss these anomalies with respect to a possible Lifshitz transition and structural soft modes.

  13. A Low-Symmetry Dysprosium Metallocene Single-Molecule Magnet with a High Anisotropy Barrier.

    PubMed

    Pugh, Thomas; Chilton, Nicholas F; Layfield, Richard A

    2016-09-01

    The single-molecule magnet (SMM) properties of the isocarbonyl-ligated dysprosium metallocene [Cp*2 Dy{μ-(OC)2 FeCp}]2 (1Dy ), which contains a rhombus-shaped Dy2 Fe2 core, are described. Combining a strong axial [Cp*](-) ligand field with a weak equatorial field consisting of the isocarbonyl ligands leads to an anisotropy barrier of 662 cm(-1) in zero applied field. The dominant thermal relaxation pathways in 1Dy involves at least the fourth-excited Kramers doublet, thus demonstrating that prominent SMM behavior can be observed for dysprosium in low-symmetry environments. PMID:27460170

  14. A Low-Symmetry Dysprosium Metallocene Single-Molecule Magnet with a High Anisotropy Barrier.

    PubMed

    Pugh, Thomas; Chilton, Nicholas F; Layfield, Richard A

    2016-09-01

    The single-molecule magnet (SMM) properties of the isocarbonyl-ligated dysprosium metallocene [Cp*2 Dy{μ-(OC)2 FeCp}]2 (1Dy ), which contains a rhombus-shaped Dy2 Fe2 core, are described. Combining a strong axial [Cp*](-) ligand field with a weak equatorial field consisting of the isocarbonyl ligands leads to an anisotropy barrier of 662 cm(-1) in zero applied field. The dominant thermal relaxation pathways in 1Dy involves at least the fourth-excited Kramers doublet, thus demonstrating that prominent SMM behavior can be observed for dysprosium in low-symmetry environments.

  15. 21 CFR 163.114 - Lowfat cocoa.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a... that the cacao fat content is less than 10 percent by weight, as determined by the method prescribed...

  16. 19 CFR 163.1 - Definitions.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... affecting § 163.1, see the List of CFR Sections Affected, which appears in the Finding Aids section of the... treatment under the United States-Singapore Free Trade Agreement (SFTA), including a SFTA...

  17. 19 CFR 163.1 - Definitions.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    .... Editorial Note: For Federal Register citations affecting § 163.1, see the List of CFR Sections Affected... treatment under the United States-Singapore Free Trade Agreement (SFTA), including a SFTA...

  18. 19 CFR 163.1 - Definitions.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... affecting § 163.1, see the List of CFR Sections Affected, which appears in the Finding Aids section of the... treatment under the United States-Singapore Free Trade Agreement (SFTA), including a SFTA...

  19. 21 CFR 163.114 - Lowfat cocoa.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a... that the cacao fat content is less than 10 percent by weight, as determined by the method prescribed...

  20. 21 CFR 163.114 - Lowfat cocoa.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a... that the cacao fat content is less than 10 percent by weight, as determined by the method prescribed...

  1. 21 CFR 163.114 - Lowfat cocoa.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a... that the cacao fat content is less than 10 percent by weight, as determined by the method prescribed...

  2. Exploration of dysprosium: the most critical element for Japan

    NASA Astrophysics Data System (ADS)

    Watanabe, Y.

    2012-04-01

    Dysprosium (Dy), one of the heavy rare earth elements, is used mainly as an additive for NdFeB permanent magnets which are installed in various modern industrial products such as voice coil motors in computers, factory automation machinery, hybrid and electric vehicles, home electronics, and wind turbine, to improve heat resistance of the magnets. Dy has been produced about 2,000t per year from the ores from ion adsorption type deposits in southern China. However, the produced amount of Dy was significantly reduced in 2011 in China due to reservation of heavy rare earth resources and protection of natural environment, resulting in soaring of Dy price in the world. In order to respond the increasing demand of Dy, unconventional supply sources are inevitably developed, in addition to heavy rare earth enriched ion adsorption type deposits outside China. Heavy rare earth elements including Dy are dominantly hosted in xenotime, fergusonite, zircon, eudialyte, keiviite, kainosite, iimoriite, etc. Concentration of xenotime is found in placer deposits in Malaysia and India, hydrothermal deposits associated with unconformity-type uranium mineralization (Athabasca basin in Canada, Western Australia), iron-oxide fluorite mineralization (South Africa) and Sn-bearing alkaline granite (Brazil). Zircon and fergusontie concentration is found as igneous and hydrothermal products in peralkaline syenite, alkaline granite and pegmatite (e.g., Nechalacho in Canada). Eudialyte concentration is found in some peralkaline syenite bodies in Greenland, Canada, Sweden and Russia. Among these sources, large Dy resources are estimated in the deposits hosted in peralkaline rocks (Nechalacho: 79,000t, Kvanefjeld: 49,000t, Norra Karr: 15,700t, etc.) compared to the present demand of Dy. Thus, Dy will be supplied from the deposits associated with peralkaline and alkaline deposits in future instead of ion adsorption type deposits in southern China.

  3. Observation of an intermediate phase in dysprosium near the Neel point by neutron diffraction

    SciTech Connect

    Bessergenev, V.G.; Gogava, V.V.; Kovalevskaya, Y.A.; Mandzhavidze, A.G.; Fedorov, V.M.; Shilo, S.I.

    1985-11-25

    The magnetic structure of dysprosium near the point of magnetic disordering has been studied as a function of the thermal history of the sample by neutron diffraction. An intermediate vortex phase appears during cooling from the paramagnetic phase and then converts into a helicoidal phase.

  4. Systematic study on surface and magnetostructural changes in Mn-substituted dysprosium ferrite by hydrothermal method

    NASA Astrophysics Data System (ADS)

    Rekha, G.; Tholkappiyan, R.; Vishista, K.; Hamed, Fathalla

    2016-11-01

    Dysprosium iron garnets are of scientific importance because of the wide range of magnetic properties that can be obtained in substituting dysprosium by a rare earth metal. In the present work, the effect of Mn substitution on magnetostructural changes in dysprosium ferrite nanoparticles is studied. Highly crystalline pure and Mn doped dysprosium ferrite nanoparticles were synthesized by hydrothermal method. The samples were calcined at 1100 °C for 2 h in air atmosphere which is followed by characterization using XRD, FT-IR analysis, SEM, XPS and VSM. The average crystallite size of synthesized samples were calculated by X-ray diffraction falls in the range of 88.4-86.8 nm and was found to be in cubic garnet structure. For further investigation of the structure and corresponding changes in the tetrahedral and octahedral stretching vibrational bonds, FT-IR was used. The synthesized samples consist of multiple oxidation (Fe3+ and Fe2+) states for Fe ions and (Mn3+ and Mn2+) Mn ions analyzed in three ways of Fe 2p and Mn 2p spectra from the XPS analysis. With respect to Mn dopant in Dy3Fe5O12, the cationic distributions of elements were discussed from high resolution XPS spectra by peak position and shift, area, width. To find out the porous/void surface morphology of the sample, scanning electron microscopy was used. From XPS analysis, the presence of elements (Dy, Mn, Fe and O) and their composition in the prepared samples were confirmed. Further, the role of dopant on the magnetic properties of the dysprosium ferrite nanoparticles was also observed from VSM which shows the ferromagnetic behavior. It was concluded that the magnetic properties of synthesized nanoparticles mainly depended on the oxidation state of elements, cationic distribution and crystallinity.

  5. Synthesis, structural characterization and in vitro testing of dysprosium containing silica particles as potential MRI contrast enhancing agents

    NASA Astrophysics Data System (ADS)

    Chiriac, L. B.; Trandafir, D. L.; Turcu, R. V. F.; Todea, M.; Simon, S.

    2016-11-01

    The work is focused on synthesis and structural characterization of novel dysprosium-doped silica particles which could be considered as MRI contrast agents. Sol-gel derived silica rich particles obtained via freeze-drying and spray-drying processing methods were structurally characterized by XRD, 29Si MAS-NMR and XPS methods. The occurrence of dysprosium on the outermost layer of dysprosium containing silica particles was investigated by XPS analysis. The MRI contrast agent characteristics have been tested using RARE-T1 and RARE-T2 protocols. The contrast of MRI images delivered by the investigated samples was correlated with their local structure. Dysprosium disposal on microparticles with surface structure characterised by decreased connectivity of the silicate network units favours dark T2-weighted MRI contrast properties.

  6. Slow magnetic relaxation in a hydrogen-bonded 2D array of mononuclear dysprosium(III) oxamates.

    PubMed

    Fortea-Pérez, Francisco R; Vallejo, Julia; Julve, Miguel; Lloret, Francesc; De Munno, Giovanni; Armentano, Donatella; Pardo, Emilio

    2013-05-01

    The reaction of N-(2,6-dimethylphenyl)oxamic acid with dysprosium(III) ions in a controlled basic media afforded the first example of a mononuclear lanthanide oxamate complex exhibiting a field-induced slow magnetic relaxation behavior typical of single-ion magnets (SIMs). The hydrogen-bond-mediated self-assembly of this new bifunctional dysprosium(III) SIM in the solid state provides a unique example of 2D hydrogen-bonded polymer with a herringbone net topology.

  7. 50 CFR 216.163 - Mitigation.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... Range moving beyond the mammal's last verified location. (2) If a North Atlantic right whale or other... additional aerial monitoring of the Safety Range shows that no other right whales or other ESA-listed marine... Conventional Explosives in the Offshore Waters of the U.S. Atlantic Coast § 216.163 Mitigation. (a) Under...

  8. 46 CFR 163.003-15 - Performance.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be capable of being rolled up for storage. (b) Each ladder when rolled up must be able to unroll freely and hang vertically. (c) Each suspension member must be arranged so that, when the ladder is in use on...

  9. 46 CFR 163.003-1 - Scope.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... APPROVAL CONSTRUCTION Pilot Ladder § 163.003-1 Scope. (a) This subpart contains standards and approval and production tests for a pilot ladder used on a merchant vessel to embark and disembark pilots and other persons when away from the dock. (b) The requirements in this subpart apply to a pilot ladder designed...

  10. 46 CFR 163.003-1 - Scope.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... APPROVAL CONSTRUCTION Pilot Ladder § 163.003-1 Scope. (a) This subpart contains standards and approval and production tests for a pilot ladder used on a merchant vessel to embark and disembark pilots and other persons when away from the dock. (b) The requirements in this subpart apply to a pilot ladder designed...

  11. 46 CFR 163.003-15 - Performance.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be capable of being rolled up for storage. (b) Each ladder when rolled up must be able to unroll freely and hang vertically. (c) Each suspension member must be arranged so that, when the ladder is in use on...

  12. 46 CFR 163.002-1 - Scope.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... APPROVAL CONSTRUCTION Pilot Hoist § 163.002-1 Scope. (a) This subpart contains standards and approval and production tests for pilot hoists used on merchant vessels. (b) The requirements in this subpart apply to a pilot hoist designed for use along a vertical portion of a vessel's hull....

  13. 12 CFR 163.47 - Pension plans.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... and Structure § 163.47 Pension plans. (a) General. No Federal savings association or service... employee pension plan is defined in section 3(2) of the Employee Retirement Income Security Act of 1974, as... stated in or determinable from the plan, and, for a defined benefit plan, shall also be based upon...

  14. 12 CFR 163.47 - Pension plans.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... and Structure § 163.47 Pension plans. (a) General. No Federal savings association or service... employee pension plan is defined in section 3(2) of the Employee Retirement Income Security Act of 1974, as... stated in or determinable from the plan, and, for a defined benefit plan, shall also be based upon...

  15. Effect of Yttrium doping on structural and magnetic properties of Dysprosium

    NASA Astrophysics Data System (ADS)

    Jena, Rudra Prasad; Baidya, Arunmay; Lakhani, Archana

    2016-11-01

    A comparative structural and magneto transport study has been performed on the Dysprosium (Dy) and Yttrium (Y) doped Dysprosium (Dy-Y) alloys in order to study the effect of Y concentration, temperature and magnetic field on the magnetic states and transitions of Dy-Y alloys. The magnetic state of Dy and Dy-Y alloys having lower Y substitutions change from Paramagnetic (PM) to Helimagnetic (HM) state via second order phase transition and from Helimagnetic state to Ferromagnetic (FM) state via first order phase transition. Small change in lattice parameters, strain and micro-strain is observed with X-ray diffraction on replacement with Y ions. Neel temperature and Curie temperature both show a decreasing trend on diluting Dy with non-magnetic Y in small concentrations. PM to HM and HM to FM transitions in the lower substitutional alloys discussed in this manuscript show a direct transition from PM to FM state at fields above 1.5 T.

  16. Technique for direct measurement of magnetic entropy of solids: Results for dysprosium titanium oxide

    NASA Technical Reports Server (NTRS)

    Flood, D. J.

    1974-01-01

    A measurement technique was devised which permits direct observation of the magnetic entropy of solids as a function of applied magnetic field. Measurements were made of the magnetic entropy, in the temperature range 2 to 20 K, of polycrystalline samples of dysprosium titanium oxide (Dy2Ti2O7) to determine its suitability for use as the working substance of a magnetic refrigerator. Magnetization measurements were also made at 4.2 K and below to provide additional information on the nature of the compound. The measurements indicated that crystalline electric fields perturbed the ground state of the dysprosium ions, removed the 16-fold degeneracy predicted by Hund's rules, and left only a twofold degeneracy in its place. A positive, temperature independent contribution to the magnetization was observed in the saturation region, which indicated that the doublet ground-state wave function was perturbed by a nearby unpopulated upper energy level.

  17. Dysprosium-Catalyzed Growth of Single-Walled Carbon Nanotube Arrays on Substrates

    PubMed Central

    2010-01-01

    In this letter, we report that dysprosium is an effective catalyst for single-walled carbon nanotubes (SWNTs) growth via a chemical vapor deposition (CVD) process for the first time. Horizontally superlong well-oriented SWNT arrays on SiO2/Si wafer can be fabricated by EtOH-CVD under suitable conditions. The structure and properties are characterized by scanning electron microscopy, transition electron microscopy, Raman spectroscopy and atomic force microscopy. The results show that the SWNTs from dysprosium have better structural uniformity and better conductivity with fewer defects. This rare earth metal provides not only an alternative catalyst for SWNTs growth, but also a possible method to generate high percentage of superlong semiconducting SWNT arrays for various applications of nanoelectronic device. PMID:20672139

  18. Curious matrix effects: a computational, electron diffraction, and vibrational spectroscopic study of dysprosium triiodide.

    PubMed

    Varga, Zoltán; Groen, Cornelis Petrus; Kolonits, Mária; Hargittai, Magdolna

    2010-07-21

    The molecular and electronic structure of dysprosium triiodide, DyI(3), and its dimer, Dy(2)I(6), was determined by high level computations, gas-phase electron diffraction, and gas-phase infrared and matrix-isolation infrared and Raman spectroscopy. The free monomeric molecule is planar from all methods with an equilibrium bond length of 2.808(9) A; the thermal average bond length from electron diffraction is 2.828(6) A. The molecule forms complexes in the matrix-isolation experiments causing pyramidalisation of planar monomeric molecules. The likelihood of having both pyramidal and planar DyI(3) molecules in the matrix is discussed in order to explain certain features of the spectra. Our computations suggest that the dimer geometry depends on the occupation of the partially filled 4f orbitals. As this is the third molecule in the dysprosium trihalide series studied, trends in their electronic and molecular structures are presented and discussed.

  19. Low Temperature Magnetostrictive Strain Of Terfenol-D and Terbium Dysprosium

    NASA Astrophysics Data System (ADS)

    Graetz, Jason

    1998-03-01

    The goal of this project is to measure the magnetostrictive strain of Terfenol-D and Terbium Dysprosium at 300K and 77K. This involves the observation of the strain difference over a metamagnetic transition in Terfenol-D and a para- ferro-magnetic transition in Terbium Dysprosium. The experimental data is in agreement with general magnetostriction theory. This data is used in the construction of a prototype of a high-resolution magnetostrictive actuator. This device has been successfully tested at 300K with a minimum step size of 10nm. Low temperature devices of this nature have applicability to electron microscopy, Infrared cameras, and mirror positioning on low temperature space telescopes.

  20. Selective recognition of dysprosium(III) ions by enhanced chemiluminescence CdSe quantum dots.

    PubMed

    Hosseini, Morteza; Ganjali, Mohammad R; Vaezi, Zahra; Faridbod, Farnoush; Arabsorkhi, Batool; Sheikhha, Mohammad H

    2014-01-01

    The intensity of emitted light from CdSe quantum dots (QDs)-H2O2 is described as a novel chemiluminescence (CL) reaction for determination of dysprosium. This reaction is based on the catalytic effect of Dy(3+) ions, causing a significant increase in the light emission, as a result of the reaction of quantum dots (QDs) with hydrogen peroxide. In the optimum conditions, this method was satisfactorily described by linear calibration curve in the range of 8.3×10(-7)-5.0×10(-6)M, the detection limit of 6.0×10(-8)M, and the relative standard deviation for five determinations of 2.5×10(-6)M Dy(3+) 3.2%. The main experimental advantage of the proposed method is its selective to Dy(3+) ions compared with common coexisting cations, therefore, it was successfully applied for the determination of dysprosium ions in water samples.

  1. Repeat radiation synovectomy with dysprosium 165-ferric hydroxide macroaggregates in rheumatoid knees unresponsive to initial injection

    SciTech Connect

    Vella, M.; Zuckerman, J.D.; Shortkroff, S.; Venkatesan, P.; Sledge, C.B.

    1988-06-01

    Because of failure to fully respond to an initial intraarticular injection of dysprosium 165-ferric hydroxide macroaggregates, 17 patients with seropositive rheumatoid arthritis underwent repeat radiation synovectomy using this agent. Of the 13 patients who were evaluated 1 year later, 54% (7 knees) had good results, 31% (4 knees) had fair results, and 15% (2 knees) had poor results. The initial lack of significant benefit from radiation synovectomy did not appear to preclude a favorable response to a second injection.

  2. {Delta}I = 2 energy staggering in normal deformed dysprosium nuclei

    SciTech Connect

    Riley, M.A.; Brown, T.B.; Archer, D.E.

    1996-12-31

    Very high spin states (I{ge}50{Dirac_h}) have been observed in {sup 155,156,157}Dy. The long regular band sequences, free from sharp backbending effects, observed in these dysprosium nuclei offer the possibility of investigating the occurence of any {Delta}I = 2 staggering in normal deformed nuclei. Employing the same analysis techniques as used in superdeformed nuclei, certain bands do indeed demonstrate an apparent staggering and this is discussed.

  3. Synovectomy of the rheumatoid knee using intra-articular injection of dysprosium-165-ferric hydroxide macroaggregates

    SciTech Connect

    Sledge, C.B.; Zuckerman, J.D.; Shortkroff, S.; Zalutsky, M.R.; Venkatesan, P.; Snyder, M.A.; Barrett, W.P.

    1987-09-01

    One hundred and eleven patients who had seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with intra-articular injection of 270 millicuries of dysprosium-165 bound to ferric hydroxide macroaggregates. A two-year follow-up was available for fifty-nine of the treated knees. Thirty-nine had a good result; nine, a fair result; and eleven, a poor result. Of the twenty-five knees that had Stage-I radiographic changes, nineteen had a good result. Of the thirty-four knees that had Stage-II radiographic changes, twenty showed a good result. Systemic spread of the radioactivity from the injected joint was minimum. The mean whole-body dose was calculated to be 0.3 rad and that to the liver twenty-four hours after injection, 3.2 rads. The results indicated that dysprosium-165-ferric hydroxide macroaggregate is an effective agent for performing radiation synovectomy, particularly in knees that have Stage-I radiographic changes. Because of the minimum rate of systemic spread of the dysprosium-165, it offers a definite advantage over agents that previously have been used.

  4. Physico-chemical and NMR relaxometric characterization of gadolinium hydroxide and dysprosium oxide nanoparticles

    NASA Astrophysics Data System (ADS)

    Gossuin, Yves; Hocq, Aline; Vuong, Quoc Lam; Disch, Sabrina; Hermann, Raphaël P.; Gillis, Pierre

    2008-11-01

    Gadolinium hydroxide and dysprosium oxide nanoparticles, which constitute a new interesting class of magnetic nanoparticles, are characterized by different methods, using x-ray diffraction, magnetometry and NMR relaxometry at multiple fields. The rod-like particles are first shown to have a simple paramagnetic behavior, like the bulk compound, without any influence of the nanometric size of the particles. Because of their paramagnetic moment, these particles considerably shorten water relaxation times, especially the transverse relaxation time at high fields. The relaxation induced by gadolinium hydroxide particles is due to a proton exchange between the particle surface and bulk water, while the transverse relaxation caused by dysprosium oxide particles is governed by the diffusion of water protons around the magnetized particles. 1/T2 increases linearly with the magnetic field for gadolinium hydroxide particles while a quadratic increase is observed for dysprosium oxide nanoparticles. The relaxation results are compared with those from previous studies and interpreted using different theories for the relaxation induced by magnetic particles.

  5. The synthesis, structure, magnetic and luminescent properties of a new tetranuclear dysprosium (III) cluster

    SciTech Connect

    Chen, Yen-Han; Tsai, Yun-Fan; Lee, Gene-Hsian; Yang, En-Che

    2012-01-15

    The synthesis and characterization of [Dy{sub 4}(dhampH{sub 3}){sub 4}(NO{sub 3}){sub 2}](NO{sub 3}){sub 2} (1), a new tetranuclear dysprosium (III) complex, is described. The compound was characterized by its X-ray structure, magnetic properties as well as the luminescent spectra. The compound crystallizes in a P1-bar space group with a zig-zag linear form of geometry. The ac magnetic susceptibilities of the molecule indicate that it is a magnetic molecule with a slow magnetization relaxation. The molecule also exhibits an emission spectrum that was confirmed to be ligand based. These results indicate that this molecule has both a slow magnetization relaxation (that could be potentially a SMM) and luminescent properties. - Graphical Abstract: A new tetranuclear dysprosium (III) complex [Dy{sub 4}(dhampH{sub 3}){sub 4}(NO{sub 3}){sub 2}](NO{sub 3}){sub 2} is synthesized and reported in this paper. This molecule has luminescence and can potentially act as a SMM. Highlights: Black-Right-Pointing-Pointer A new designed ligand (dhampH{sub 5}) was syntheisized. Black-Right-Pointing-Pointer A new tetra-dysprosium cluster [Dy{sub 4}(dhampH{sub 3}){sub 4}(NO{sub 3}){sub 2}](NO{sub 3}){sub 2} was made. Black-Right-Pointing-Pointer Slow magnetization relaxation phenomenon was observed. Black-Right-Pointing-Pointer Ligand-based luminescence was observed.

  6. 25 CFR 163.37 - Forest management research.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the...

  7. 21 CFR 163.145 - Mixed dairy product chocolates.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods... ingredients for milk chocolate in § 163.130, except that: (1) The optional dairy ingredients for each of...

  8. 21 CFR 163.145 - Mixed dairy product chocolates.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods... ingredients for milk chocolate in § 163.130, except that: (1) The optional dairy ingredients for each of...

  9. 21 CFR 163.145 - Mixed dairy product chocolates.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods... ingredients for milk chocolate in § 163.130, except that: (1) The optional dairy ingredients for each of...

  10. 21 CFR 163.145 - Mixed dairy product chocolates.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods... ingredients for milk chocolate in § 163.130, except that: (1) The optional dairy ingredients for each of...

  11. 21 CFR 163.145 - Mixed dairy product chocolates.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods... ingredients for milk chocolate in § 163.130, except that: (1) The optional dairy ingredients for each of...

  12. 43 CFR 16.3 - Terms and conditions.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 43 Public Lands: Interior 1 2013-10-01 2013-10-01 false Terms and conditions. 16.3 Section 16.3 Public Lands: Interior Office of the Secretary of the Interior CONSERVATION OF HELIUM § 16.3 Terms and... recovering the helium component of natural gas unless permission to do so has been expressly granted by...

  13. 43 CFR 16.3 - Terms and conditions.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 43 Public Lands: Interior 1 2012-10-01 2011-10-01 true Terms and conditions. 16.3 Section 16.3 Public Lands: Interior Office of the Secretary of the Interior CONSERVATION OF HELIUM § 16.3 Terms and... recovering the helium component of natural gas unless permission to do so has been expressly granted by...

  14. 43 CFR 16.3 - Terms and conditions.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 43 Public Lands: Interior 1 2014-10-01 2014-10-01 false Terms and conditions. 16.3 Section 16.3 Public Lands: Interior Office of the Secretary of the Interior CONSERVATION OF HELIUM § 16.3 Terms and... recovering the helium component of natural gas unless permission to do so has been expressly granted by...

  15. 25 CFR 163.37 - Forest management research.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the...

  16. 46 CFR 163.003-7 - Independent laboratory.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 46 Shipping 6 2011-10-01 2011-10-01 false Independent laboratory. 163.003-7 Section 163.003-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval...

  17. 46 CFR 163.003-3 - ASTM standard.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 46 Shipping 6 2011-10-01 2011-10-01 false ASTM standard. 163.003-3 Section 163.003-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-3 ASTM standard. The following standard of...

  18. 46 CFR 163.003-7 - Independent laboratory.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Independent laboratory. 163.003-7 Section 163.003-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval...

  19. 46 CFR 163.003-3 - ASTM standard.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false ASTM standard. 163.003-3 Section 163.003-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-3 ASTM standard. The following standard of...

  20. 25 CFR 163.37 - Forest management research.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Forest management research. 163.37 Section 163.37 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.37 Forest management research. The Secretary, with the consent of...

  1. 25 CFR 163.35 - Indian forest land assistance account.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Indian forest land assistance account. 163.35 Section 163... REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the request of a tribe's authorized representatives, the Secretary may establish tribal-specific forest...

  2. 25 CFR 163.35 - Indian forest land assistance account.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Indian forest land assistance account. 163.35 Section 163... REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the request of a tribe's authorized representatives, the Secretary may establish tribal-specific forest...

  3. 25 CFR 163.37 - Forest management research.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Forest management research. 163.37 Section 163.37 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.37 Forest management research. The Secretary, with the consent of...

  4. 25 CFR 163.37 - Forest management research.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Forest management research. 163.37 Section 163.37 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.37 Forest management research. The Secretary, with the consent of...

  5. 25 CFR 163.22 - Payment for forest products.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Payment for forest products. 163.22 Section 163.22... Forest Management and Operations § 163.22 Payment for forest products. (a) The basis of volume determination for forest products sold shall be the Scribner Decimal C log rules, cubic volume,...

  6. 25 CFR 163.10 - Management of Indian forest land.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Management of Indian forest land. 163.10 Section 163.10... Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall undertake forest land management activities on Indian forest land, either directly or through...

  7. 25 CFR 163.22 - Payment for forest products.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Payment for forest products. 163.22 Section 163.22... Forest Management and Operations § 163.22 Payment for forest products. (a) The basis of volume determination for forest products sold shall be the Scribner Decimal C log rules, cubic volume,...

  8. 25 CFR 163.22 - Payment for forest products.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Payment for forest products. 163.22 Section 163.22 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.22 Payment for forest products. (a) The basis of volume determination...

  9. 25 CFR 163.10 - Management of Indian forest land.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Management of Indian forest land. 163.10 Section 163.10... Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall undertake forest land management activities on Indian forest land, either directly or through...

  10. 25 CFR 163.35 - Indian forest land assistance account.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Indian forest land assistance account. 163.35 Section 163... REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the request of a tribe's authorized representatives, the Secretary may establish tribal-specific forest...

  11. 25 CFR 163.10 - Management of Indian forest land.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Management of Indian forest land. 163.10 Section 163.10... Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall undertake forest land management activities on Indian forest land, either directly or through...

  12. 25 CFR 163.35 - Indian forest land assistance account.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Indian forest land assistance account. 163.35 Section 163... REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the request of a tribe's authorized representatives, the Secretary may establish tribal-specific forest...

  13. 25 CFR 163.10 - Management of Indian forest land.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Management of Indian forest land. 163.10 Section 163.10... Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall undertake forest land management activities on Indian forest land, either directly or through...

  14. 25 CFR 163.22 - Payment for forest products.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Payment for forest products. 163.22 Section 163.22... Forest Management and Operations § 163.22 Payment for forest products. (a) The basis of volume determination for forest products sold shall be the Scribner Decimal C log rules, cubic volume,...

  15. 25 CFR 163.10 - Management of Indian forest land.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Management of Indian forest land. 163.10 Section 163.10... Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall undertake forest land management activities on Indian forest land, either directly or through...

  16. 25 CFR 163.35 - Indian forest land assistance account.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Indian forest land assistance account. 163.35 Section 163... REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the request of a tribe's authorized representatives, the Secretary may establish tribal-specific forest...

  17. 46 CFR 163.002-7 - Independent laboratory.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 46 Shipping 6 2011-10-01 2011-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent...

  18. 46 CFR 163.003-7 - Independent laboratory.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 46 Shipping 6 2014-10-01 2014-10-01 false Independent laboratory. 163.003-7 Section 163.003-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval and production tests in this subpart must be conducted by or under the supervision of an independent...

  19. 46 CFR 163.003-7 - Independent laboratory.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 46 Shipping 6 2013-10-01 2013-10-01 false Independent laboratory. 163.003-7 Section 163.003-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval and production tests in this subpart must be conducted by or under the supervision of an independent...

  20. 46 CFR 163.002-7 - Independent laboratory.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 46 Shipping 6 2014-10-01 2014-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent...

  1. 46 CFR 163.002-7 - Independent laboratory.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 46 Shipping 6 2012-10-01 2012-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent...

  2. 46 CFR 163.002-7 - Independent laboratory.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent...

  3. 46 CFR 163.003-7 - Independent laboratory.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 46 Shipping 6 2012-10-01 2012-10-01 false Independent laboratory. 163.003-7 Section 163.003-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval and production tests in this subpart must be conducted by or under the supervision of an independent...

  4. 46 CFR 163.002-7 - Independent laboratory.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 46 Shipping 6 2013-10-01 2013-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent...

  5. 50 CFR 648.163 - Bluefish Accountability Measures (AMs).

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 50 Wildlife and Fisheries 12 2013-10-01 2013-10-01 false Bluefish Accountability Measures (AMs). 648.163 Section 648.163 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC... Management Measures for the Atlantic Bluefish Fishery § 648.163 Bluefish Accountability Measures (AMs)....

  6. 50 CFR 648.163 - Bluefish Accountability Measures (AMs).

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 50 Wildlife and Fisheries 12 2012-10-01 2012-10-01 false Bluefish Accountability Measures (AMs). 648.163 Section 648.163 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC... Management Measures for the Atlantic Bluefish Fishery § 648.163 Bluefish Accountability Measures (AMs)....

  7. 27 CFR 40.163 - Semimonthly tax return periods.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2012-04-01 2011-04-01 true Semimonthly tax return periods. 40.163 Section 40.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Payment of Taxes on Tobacco Products § 40.163 Semimonthly tax return periods. Except as otherwise...

  8. 25 CFR 163.31 - Insect and disease control.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The...

  9. 25 CFR 163.31 - Insect and disease control.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The...

  10. 25 CFR 163.31 - Insect and disease control.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The...

  11. 25 CFR 163.31 - Insect and disease control.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The...

  12. 25 CFR 163.31 - Insect and disease control.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The...

  13. 46 CFR 163.002-21 - Approval tests.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 46 Shipping 6 2014-10-01 2014-10-01 false Approval tests. 163.002-21 Section 163.002-21 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-21 Approval tests. (a) General. If a pilot hoist fails one of the tests in this section the cause of the failure must be identified and any needed...

  14. 25 CFR 163.14 - Sale of forest products.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Sale of forest products. 163.14 Section 163.14 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.14 Sale of forest products. (a) Consistent with the economic objectives...

  15. 25 CFR 163.25 - Forest management deductions.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Forest management deductions. 163.25 Section 163.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions...

  16. 25 CFR 163.14 - Sale of forest products.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Sale of forest products. 163.14 Section 163.14 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.14 Sale of forest products. (a) Consistent with the economic objectives...

  17. 25 CFR 163.25 - Forest management deductions.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Forest management deductions. 163.25 Section 163.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions...

  18. 25 CFR 163.14 - Sale of forest products.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Sale of forest products. 163.14 Section 163.14 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.14 Sale of forest products. (a) Consistent with the economic objectives...

  19. 25 CFR 163.14 - Sale of forest products.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Sale of forest products. 163.14 Section 163.14 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.14 Sale of forest products. (a) Consistent with the economic objectives...

  20. 25 CFR 163.25 - Forest management deductions.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Forest management deductions. 163.25 Section 163.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions...

  1. 25 CFR 163.14 - Sale of forest products.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Sale of forest products. 163.14 Section 163.14 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.14 Sale of forest products. (a) Consistent with the economic objectives...

  2. 25 CFR 163.25 - Forest management deductions.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Forest management deductions. 163.25 Section 163.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions...

  3. 25 CFR 163.24 - Duration of timber contracts.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Duration of timber contracts. 163.24 Section 163.24... Forest Management and Operations § 163.24 Duration of timber contracts. After the effective date of a... allowed for harvesting the estimated volume of timber purchased, shall be five years....

  4. 25 CFR 163.23 - Advance payment for timber products.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advance payment for timber products. 163.23 Section 163... REGULATIONS Forest Management and Operations § 163.23 Advance payment for timber products. (a) Unless..., contracts for the sale of timber from allotted, trust or restricted Indian forest land shall provide for...

  5. 25 CFR 163.24 - Duration of timber contracts.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Duration of timber contracts. 163.24 Section 163.24... Forest Management and Operations § 163.24 Duration of timber contracts. After the effective date of a... allowed for harvesting the estimated volume of timber purchased, shall be five years....

  6. 25 CFR 163.23 - Advance payment for timber products.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Advance payment for timber products. 163.23 Section 163... REGULATIONS Forest Management and Operations § 163.23 Advance payment for timber products. (a) Unless..., contracts for the sale of timber from allotted, trust or restricted Indian forest land shall provide for...

  7. 25 CFR 163.4 - Secretarial recognition of tribal laws.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Secretarial recognition of tribal laws. 163.4 Section 163.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.4 Secretarial recognition of tribal laws. Subject to the...

  8. 43 CFR 16.3 - Terms and conditions.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 43 Public Lands: Interior 1 2011-10-01 2011-10-01 false Terms and conditions. 16.3 Section 16.3 Public Lands: Interior Office of the Secretary of the Interior CONSERVATION OF HELIUM § 16.3 Terms and... recovering the helium component of natural gas unless permission to do so has been expressly granted by...

  9. 43 CFR 16.3 - Terms and conditions.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Terms and conditions. 16.3 Section 16.3 Public Lands: Interior Office of the Secretary of the Interior CONSERVATION OF HELIUM § 16.3 Terms and... recovering the helium component of natural gas unless permission to do so has been expressly granted by...

  10. 25 CFR 163.80 - Periodic assessment report.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Periodic assessment report. 163.80 Section 163.80 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.80 Periodic assessment report. The Secretary shall commission every ten years an...

  11. 25 CFR 163.18 - Acceptance and rejection of bids.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Acceptance and rejection of bids. 163.18 Section 163.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.18 Acceptance and rejection of bids. (a) The high bid received...

  12. 25 CFR 163.82 - Annual status report.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Annual status report. 163.82 Section 163.82 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.82 Annual status report. The Secretary shall, within 6 months of the end of each fiscal...

  13. 25 CFR 163.82 - Annual status report.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Annual status report. 163.82 Section 163.82 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.82 Annual status report. The Secretary shall, within 6 months of the end of each fiscal...

  14. 25 CFR 163.24 - Duration of timber contracts.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Duration of timber contracts. 163.24 Section 163.24 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.24 Duration of timber contracts. After the effective date of...

  15. 25 CFR 163.23 - Advance payment for timber products.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Advance payment for timber products. 163.23 Section 163.23 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.23 Advance payment for timber products. (a)...

  16. 25 CFR 163.36 - Tribal forestry program financial support.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Tribal forestry program financial support. 163.36 Section 163.36 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.36 Tribal forestry program financial support. (a)...

  17. 25 CFR 163.60 - Purpose and scope.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Purpose and scope. 163.60 Section 163.60 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.60 Purpose and scope. (a) The Secretary shall provide...

  18. 25 CFR 163.20 - Execution and approval of contracts.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Execution and approval of contracts. 163.20 Section 163.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.20 Execution and approval of contracts. (a) All...

  19. 25 CFR 163.4 - Secretarial recognition of tribal laws.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Secretarial recognition of tribal laws. 163.4 Section 163.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.4 Secretarial recognition of tribal laws. Subject to the...

  20. 25 CFR 163.18 - Acceptance and rejection of bids.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Acceptance and rejection of bids. 163.18 Section 163.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.18 Acceptance and rejection of bids. (a) The high bid received...

  1. 25 CFR 163.4 - Secretarial recognition of tribal laws.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Secretarial recognition of tribal laws. 163.4 Section 163.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.4 Secretarial recognition of tribal laws. Subject to the...

  2. 25 CFR 163.23 - Advance payment for timber products.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Advance payment for timber products. 163.23 Section 163.23 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.23 Advance payment for timber products. (a)...

  3. 25 CFR 163.60 - Purpose and scope.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Purpose and scope. 163.60 Section 163.60 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.60 Purpose and scope. (a) The Secretary shall provide...

  4. 25 CFR 163.80 - Periodic assessment report.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Periodic assessment report. 163.80 Section 163.80 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.80 Periodic assessment report. The Secretary shall commission every ten years an...

  5. 25 CFR 163.36 - Tribal forestry program financial support.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Tribal forestry program financial support. 163.36 Section 163.36 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.36 Tribal forestry program financial support. (a)...

  6. 25 CFR 163.18 - Acceptance and rejection of bids.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Acceptance and rejection of bids. 163.18 Section 163.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.18 Acceptance and rejection of bids. (a) The high bid received...

  7. 25 CFR 163.80 - Periodic assessment report.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Periodic assessment report. 163.80 Section 163.80 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.80 Periodic assessment report. The Secretary shall commission every ten years an...

  8. 25 CFR 163.82 - Annual status report.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Annual status report. 163.82 Section 163.82 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.82 Annual status report. The Secretary shall, within 6 months of the end of each fiscal...

  9. 25 CFR 163.82 - Annual status report.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Annual status report. 163.82 Section 163.82 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.82 Annual status report. The Secretary shall, within 6 months of the end of each fiscal...

  10. 25 CFR 163.18 - Acceptance and rejection of bids.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Acceptance and rejection of bids. 163.18 Section 163.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.18 Acceptance and rejection of bids. (a) The high bid received...

  11. 25 CFR 163.36 - Tribal forestry program financial support.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Tribal forestry program financial support. 163.36 Section 163.36 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.36 Tribal forestry program financial support. (a)...

  12. 25 CFR 163.4 - Secretarial recognition of tribal laws.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Secretarial recognition of tribal laws. 163.4 Section 163.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.4 Secretarial recognition of tribal laws. Subject to the...

  13. 25 CFR 163.36 - Tribal forestry program financial support.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Tribal forestry program financial support. 163.36 Section 163.36 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.36 Tribal forestry program financial support. (a)...

  14. 25 CFR 163.20 - Execution and approval of contracts.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Execution and approval of contracts. 163.20 Section 163.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.20 Execution and approval of contracts. (a) All contracts for...

  15. 25 CFR 163.24 - Duration of timber contracts.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Duration of timber contracts. 163.24 Section 163.24 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.24 Duration of timber contracts. After the effective date of...

  16. 25 CFR 163.20 - Execution and approval of contracts.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Execution and approval of contracts. 163.20 Section 163.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.20 Execution and approval of contracts. (a) All...

  17. 25 CFR 163.60 - Purpose and scope.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Purpose and scope. 163.60 Section 163.60 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.60 Purpose and scope. (a) The Secretary shall provide a...

  18. 25 CFR 163.4 - Secretarial recognition of tribal laws.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Secretarial recognition of tribal laws. 163.4 Section 163.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.4 Secretarial recognition of tribal laws. Subject to the...

  19. 25 CFR 163.60 - Purpose and scope.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Purpose and scope. 163.60 Section 163.60 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.60 Purpose and scope. (a) The Secretary shall provide...

  20. 25 CFR 163.20 - Execution and approval of contracts.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Execution and approval of contracts. 163.20 Section 163.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.20 Execution and approval of contracts. (a) All...

  1. 25 CFR 163.60 - Purpose and scope.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Purpose and scope. 163.60 Section 163.60 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.60 Purpose and scope. (a) The Secretary shall provide...

  2. 25 CFR 163.82 - Annual status report.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Annual status report. 163.82 Section 163.82 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.82 Annual status report. The Secretary shall, within 6 months of the end of each fiscal...

  3. 25 CFR 163.20 - Execution and approval of contracts.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Execution and approval of contracts. 163.20 Section 163.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.20 Execution and approval of contracts. (a) All...

  4. 25 CFR 163.80 - Periodic assessment report.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Periodic assessment report. 163.80 Section 163.80 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.80 Periodic assessment report. The Secretary shall commission every ten years an...

  5. 25 CFR 163.18 - Acceptance and rejection of bids.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Acceptance and rejection of bids. 163.18 Section 163.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.18 Acceptance and rejection of bids. (a) The high bid received...

  6. 25 CFR 163.24 - Duration of timber contracts.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Duration of timber contracts. 163.24 Section 163.24 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.24 Duration of timber contracts. After the effective date of...

  7. 25 CFR 163.23 - Advance payment for timber products.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Advance payment for timber products. 163.23 Section 163.23 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.23 Advance payment for timber products. (a) Unless...

  8. 25 CFR 163.80 - Periodic assessment report.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Periodic assessment report. 163.80 Section 163.80 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.80 Periodic assessment report. The Secretary shall commission every ten years an...

  9. 25 CFR 163.36 - Tribal forestry program financial support.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Tribal forestry program financial support. 163.36 Section 163.36 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.36 Tribal forestry program financial support. (a)...

  10. 38 CFR 17.163 - Posthospital outpatient dental treatment.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of...

  11. 38 CFR 17.163 - Posthospital outpatient dental treatment.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of...

  12. 38 CFR 17.163 - Posthospital outpatient dental treatment.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of...

  13. 38 CFR 17.163 - Posthospital outpatient dental treatment.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of...

  14. 38 CFR 17.163 - Posthospital outpatient dental treatment.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of...

  15. 19 CFR 163.4 - Record retention period.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Record retention period. 163.4 Section 163.4 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.4 Record retention period. (a) General. Except as...

  16. 19 CFR 163.4 - Record retention period.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Record retention period. 163.4 Section 163.4 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.4 Record retention period. (a) General. Except as...

  17. 19 CFR 163.4 - Record retention period.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 19 Customs Duties 2 2012-04-01 2012-04-01 false Record retention period. 163.4 Section 163.4 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.4 Record retention period. (a) General. Except as...

  18. 19 CFR 163.8 - Third-party recordkeeper summons.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 19 Customs Duties 2 2012-04-01 2012-04-01 false Third-party recordkeeper summons. 163.8 Section 163.8 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.8 Third-party recordkeeper summons. (a)...

  19. 19 CFR 163.2 - Persons required to maintain records.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Persons required to maintain records. 163.2 Section 163.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.2 Persons required to maintain records....

  20. 19 CFR 163.9 - Enforcement of summons.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Enforcement of summons. 163.9 Section 163.9 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.9 Enforcement of summons. Whenever a person does not comply with...

  1. 19 CFR 163.8 - Third-party recordkeeper summons.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Third-party recordkeeper summons. 163.8 Section 163.8 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.8 Third-party recordkeeper summons. (a)...

  2. 19 CFR 163.9 - Enforcement of summons.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 19 Customs Duties 2 2013-04-01 2013-04-01 false Enforcement of summons. 163.9 Section 163.9 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.9 Enforcement of summons. Whenever a person does not comply with...

  3. 19 CFR 163.2 - Persons required to maintain records.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 19 Customs Duties 2 2012-04-01 2012-04-01 false Persons required to maintain records. 163.2 Section 163.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.2 Persons required to maintain records....

  4. 19 CFR 163.4 - Record retention period.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Record retention period. 163.4 Section 163.4 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.4 Record retention period. (a) General. Except as...

  5. 19 CFR 163.2 - Persons required to maintain records.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Persons required to maintain records. 163.2 Section 163.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.2 Persons required to maintain records....

  6. 19 CFR 163.9 - Enforcement of summons.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 19 Customs Duties 2 2012-04-01 2012-04-01 false Enforcement of summons. 163.9 Section 163.9 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.9 Enforcement of summons. Whenever a person does not comply with...

  7. 19 CFR 163.8 - Third-party recordkeeper summons.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 2 2011-04-01 2011-04-01 false Third-party recordkeeper summons. 163.8 Section 163.8 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.8 Third-party recordkeeper summons. (a)...

  8. 19 CFR 163.9 - Enforcement of summons.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Enforcement of summons. 163.9 Section 163.9 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.9 Enforcement of summons. Whenever a person does not comply with...

  9. 25 CFR 163.25 - Forest management deductions.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Forest management deductions. 163.25 Section 163.25... Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions of 25 U.S.C. 413 and 25 U.S.C. 3105, a forest management deduction shall be withheld from the...

  10. 29 CFR 1915.163 - Ship's piping systems.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 29 Labor 7 2011-07-01 2011-07-01 false Ship's piping systems. 1915.163 Section 1915.163 Labor... (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.163 Ship's piping systems. (a) Before work is performed on a valve, fitting, or section...

  11. 29 CFR 1915.163 - Ship's piping systems.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 29 Labor 7 2012-07-01 2012-07-01 false Ship's piping systems. 1915.163 Section 1915.163 Labor... (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.163 Ship's piping systems. (a) Before work is performed on a valve, fitting, or section...

  12. 29 CFR 1915.163 - Ship's piping systems.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 29 Labor 7 2013-07-01 2013-07-01 false Ship's piping systems. 1915.163 Section 1915.163 Labor... (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.163 Ship's piping systems. (a) Before work is performed on a valve, fitting, or section...

  13. 29 CFR 1915.163 - Ship's piping systems.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's piping systems. 1915.163 Section 1915.163 Labor... (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.163 Ship's piping systems. (a) Before work is performed on a valve, fitting, or section...

  14. 29 CFR 1915.163 - Ship's piping systems.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 29 Labor 7 2014-07-01 2014-07-01 false Ship's piping systems. 1915.163 Section 1915.163 Labor... (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.163 Ship's piping systems. (a) Before work is performed on a valve, fitting, or section...

  15. Novel Thermal Effects at the First Order Magnetic Phase Transition in Erbium, and a Comparison with Dysprosium

    SciTech Connect

    Gschneidner, K.A. Jr.; Pecharsky, V.K.; Fort, D.

    1997-06-01

    In low temperature studies of ultrapure erbium (and dysprosium) we have discovered unusual thermal effects at the first order magnetic transformation of erbium ({congruent} 19K). These include (1)superheating (i.e., {ital the metal is colder after heat has been added to it than before the heat pulse }), (2)supercooling, and (3)the existence of metastable intermediate phases during this phase transformation in erbium (four on heating and two on cooling). In comparison, dysprosium exhibits both superheating and supercooling, but no intermediate metastable phases are observed. Furthermore, none of these effects are observed in less pure metals. {copyright} {ital 1997} {ital The American Physical Society}

  16. Far-infrared spectra of dysprosium doped yttrium aluminum garnet nanopowder

    NASA Astrophysics Data System (ADS)

    Trajić, J.; Rabasović, M. S.; Savić-Šević, S.; Ševic, D.; Babić, B.; Romčević, M.; Ristić-Djurović, J. L.; Paunović, N.; Križan, J.; Romčević, N.

    2016-07-01

    The solution combustion synthesis was used to prepare nanopowders of yttrium aluminum garnet (YAG) and YAG doped with dysprosium ions, Dy3+, (YAG:Dy). The morphology, specific surface area, texture, and optical properties of the prepared materials were studied by the means of scanning electron microscopy (SEM), nitrogen adsorption method, and far-infrared spectroscopy at room temperature in the spectral region between 80 and 600 cm-1. It was established that all the examined samples were microporous. The Maxwell-Garnet formula was used to model dielectric function of YAG and YAG:Dy nanopowders as mixtures of homogenous spherical inclusions in air.

  17. Therapeutic application of dysprosium-165-FHMA in the treatment of rheumatoid knee effusions

    SciTech Connect

    English, R.J.; Zalutsky, M.; Venkatesan, P.; Sledge, C.B.

    1986-03-01

    Radiation synovectomy utilizing a variety of radionuclides has proven to be an effective technique in the treatment of rheumatoid arthritis. The recent introduction of the short-lived radionuclide, Dysprosium-165 (/sup 165/Dy), as a replacement for the longer-lived radiocolloids has reduced nontarget dosimetry caused by leakage of the agent from the articular cavity. A review of the methods and status of radiation synovectomy, and the application of /sup 165/Dy-ferric hydroxide macroaggregates (FHMA) as an alternative therapeutic agent is described.

  18. FTIR and EPR spectroscopic investigation of calcium-silicate glasses with iron and dysprosium

    NASA Astrophysics Data System (ADS)

    Eniu, D.; Gruian, C.; Vanea, E.; Patcas, L.; Simon, V.

    2015-03-01

    The sol-gel derived 50SiO2ṡ30CaOṡ10Fe2O3ṡ10Dy2O3 system was subjected to heat treatments at 500, 800 and 1200 °C in order to obtain crystalline phases of interest for biomedical applications. The structural changes were investigated by Fourier transform infrared spectroscopy (FTIR) and electron paramagnetic resonance (EPR). Both FTIR and EPR results support the development of wollastonite, hematite and magnetite crystalline phases desirable for samples bioactivity and heating possibility for hyperthermia treatment. Dysprosium addition was considered for subsequent radioactivation of the samples that could extend their application to thermoradiotherapy.

  19. Synthesis, crystal structure and magnetic properties of a novel heterobimetallic rhenium(IV)-dysprosium(III) chain.

    PubMed

    Pejo, Carolina; Guedes, Guilherme P; Novak, Miguel A; Speziali, Nivaldo L; Chiozzone, Raúl; Julve, Miguel; Lloret, Francesc; Vaz, Maria G F; González, Ricardo

    2015-06-01

    The use of the mononuclear rhenium(IV) precursor [ReBr5 (H2 pydc)](-) (H2 pydc=3,5-pyridinedicarboxylic acid) as a metalloligand towards dysprosium(III) afforded the first heterobimetallic Re(IV) -Dy(III) complex. Crystal structures and static and dynamic magnetic properties of both rhenium-containing species are reported herein. The 5d-4f compound shows an extended 1D structure and the AC magnetic measurements reveal frequency dependence at low temperature suggesting slow relaxation of the magnetization.

  20. Structure of dimeric dysprosium (III) d-tartrate of 2:2 composition in aqueous solution

    SciTech Connect

    Chevela, V.V.; Vul`fson, S.G.; Sal`nikov, Yu.I.

    1994-12-20

    The molar constant of paramagnetic birefringence of dimeric dysprosium d-tartrate Dy{sub 2}(d-L){sup 2{minus}}{sub 2} (d-L{sup 4{minus}} is a deprotonated molecule of tartaric acid) was determined experimentally and by mathematical simulation. The structures of the ligand and hydrate environment in Dy{sub 2}(d-L){sup 2{minus}}{sub 2} were simulated by the molecular mechanics method (Dashevskii-Plyamovatyi model). Results consistent with the experimental data can be obtained only when coordination of Na{sup +} is taken into account. 6 refs., 4 figs., 8 tabs.

  1. 21 CFR 163.5 - Methods of analysis.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies may be obtained from the AOAC... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Methods of analysis. 163.5 Section 163.5 Food and... CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content...

  2. 21 CFR 163.5 - Methods of analysis.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies may be obtained from the AOAC... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Methods of analysis. 163.5 Section 163.5 Food and... CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content...

  3. 21 CFR 163.5 - Methods of analysis.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies may be obtained from the AOAC... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Methods of analysis. 163.5 Section 163.5 Food and... CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content...

  4. Treatment of rheumatoid synovitis of the knee with intraarticular injection of dysprosium 165-ferric hydroxide macroaggregates

    SciTech Connect

    Sledge, C.B.; Zuckerman, J.D.; Zalutsky, M.R.; Atcher, R.W.; Shortkroff, S.; Lionberger, D.R.; Rose, H.A.; Hurson, B.J.; Lankenner, P.A. Jr.; Anderson, R.J.

    1986-02-01

    One hundred eight knees of 93 patients with seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with an intraarticular injection of 270 mCi of dysprosium 165 bound to ferric hydroxide macroaggregate. Leakage of radioactivity from the injected joint was minimal. Mean leakage to the venous blood 3 hours after injection was 0.11% of the injected dose; this corresponds to a mean whole body dose of 0.2 rads. Mean leakage to the liver 24 hours after injection was 0.64% of the injected dose; this corresponds to a mean liver dose of 3.2 rads. In 7 additional patients examined, there was negligible or near negligible activity found in the draining inguinal lymph nodes. One-year followup was possible for 74 knees (63 patients). Sixty-one percent of the knees had good results, 23% had fair results, and 16% had poor results. There was a direct correlation between the radiographic stage and response to treatment. In knees with stage I radiographic changes, 72% showed good results; 93% showed improvement. In knees with stage II changes, 59% showed good results; 81% showed improvement. These preliminary results indicate that dysprosium 165-ferric hydroxide macroaggregate is an effective agent for radiation synovectomy. The low leakage rates observed offer a definite advantage over agents previously used.

  5. Tuning Slow Magnetic Relaxation in a Two-Dimensional Dysprosium Layer Compound through Guest Molecules.

    PubMed

    Chen, Qi; Li, Jian; Meng, Yin-Shan; Sun, Hao-Ling; Zhang, Yi-Quan; Sun, Jun-Liang; Gao, Song

    2016-08-15

    A novel two-dimensional dysprosium(III) complex, [Dy(L)(CH3COO)]·0.5DMF·H2O·2CH3OH (1), has been successfully synthesized from a new pyridine-N-oxide (PNO)-containing ligand, namely, N'-(2-hydroxy-3-methoxybenzylidene)pyridine-N-oxidecarbohydrazide (H2L). Single-crystal X-ray diffraction studies reveal that complex 1 is composed of a dinuclear dysprosium subunit, which is further extended by the PNO part of the ligand to form a two-dimensional layer. Magnetic studies indicate that complex 1 shows well-defined temperature- and frequency-dependent signals under a zero direct-current (dc) field, typical of slow magnetic relaxation with an effective energy barrier Ueff of 33.6 K under a zero dc field. Interestingly, powder X-ray diffraction and thermogravimetric analysis reveal that compound 1 undergoes a reversible phase transition that is induced by the desorption and absorption of methanol and water molecules. Moreover, the desolvated sample [Dy(L)(CH3COO)]·0.5DMF (1a) also exhibits slow magnetic relaxation but with a higher anisotropic barrier of 42.0 K, indicating the tuning effect of solvent molecules on slow magnetic relaxation. PMID:27483199

  6. Influencing the properties of dysprosium single-molecule magnets with phosphorus donor ligands.

    PubMed

    Pugh, Thomas; Tuna, Floriana; Ungur, Liviu; Collison, David; McInnes, Eric J L; Chibotaru, Liviu F; Layfield, Richard A

    2015-01-01

    Single-molecule magnets are a type of coordination compound that can retain magnetic information at low temperatures. Single-molecule magnets based on lanthanides have accounted for many important advances, including systems with very large energy barriers to reversal of the magnetization, and a di-terbium complex that displays magnetic hysteresis up to 14 K and shows strong coercivity. Ligand design is crucial for the development of new single-molecule magnets: organometallic chemistry presents possibilities for using unconventional ligands, particularly those with soft donor groups. Here we report dysprosium single-molecule magnets with neutral and anionic phosphorus donor ligands, and show that their properties change dramatically when varying the ligand from phosphine to phosphide to phosphinidene. A phosphide-ligated, trimetallic dysprosium single-molecule magnet relaxes via the second-excited Kramers' doublet, and, when doped into a diamagnetic matrix at the single-ion level, produces a large energy barrier of 256 cm(-1) and magnetic hysteresis up to 4.4 K. PMID:26130418

  7. Tuning Slow Magnetic Relaxation in a Two-Dimensional Dysprosium Layer Compound through Guest Molecules.

    PubMed

    Chen, Qi; Li, Jian; Meng, Yin-Shan; Sun, Hao-Ling; Zhang, Yi-Quan; Sun, Jun-Liang; Gao, Song

    2016-08-15

    A novel two-dimensional dysprosium(III) complex, [Dy(L)(CH3COO)]·0.5DMF·H2O·2CH3OH (1), has been successfully synthesized from a new pyridine-N-oxide (PNO)-containing ligand, namely, N'-(2-hydroxy-3-methoxybenzylidene)pyridine-N-oxidecarbohydrazide (H2L). Single-crystal X-ray diffraction studies reveal that complex 1 is composed of a dinuclear dysprosium subunit, which is further extended by the PNO part of the ligand to form a two-dimensional layer. Magnetic studies indicate that complex 1 shows well-defined temperature- and frequency-dependent signals under a zero direct-current (dc) field, typical of slow magnetic relaxation with an effective energy barrier Ueff of 33.6 K under a zero dc field. Interestingly, powder X-ray diffraction and thermogravimetric analysis reveal that compound 1 undergoes a reversible phase transition that is induced by the desorption and absorption of methanol and water molecules. Moreover, the desolvated sample [Dy(L)(CH3COO)]·0.5DMF (1a) also exhibits slow magnetic relaxation but with a higher anisotropic barrier of 42.0 K, indicating the tuning effect of solvent molecules on slow magnetic relaxation.

  8. Influencing the properties of dysprosium single-molecule magnets with phosphorus donor ligands.

    PubMed

    Pugh, Thomas; Tuna, Floriana; Ungur, Liviu; Collison, David; McInnes, Eric J L; Chibotaru, Liviu F; Layfield, Richard A

    2015-07-01

    Single-molecule magnets are a type of coordination compound that can retain magnetic information at low temperatures. Single-molecule magnets based on lanthanides have accounted for many important advances, including systems with very large energy barriers to reversal of the magnetization, and a di-terbium complex that displays magnetic hysteresis up to 14 K and shows strong coercivity. Ligand design is crucial for the development of new single-molecule magnets: organometallic chemistry presents possibilities for using unconventional ligands, particularly those with soft donor groups. Here we report dysprosium single-molecule magnets with neutral and anionic phosphorus donor ligands, and show that their properties change dramatically when varying the ligand from phosphine to phosphide to phosphinidene. A phosphide-ligated, trimetallic dysprosium single-molecule magnet relaxes via the second-excited Kramers' doublet, and, when doped into a diamagnetic matrix at the single-ion level, produces a large energy barrier of 256 cm(-1) and magnetic hysteresis up to 4.4 K.

  9. Influencing the properties of dysprosium single-molecule magnets with phosphorus donor ligands

    PubMed Central

    Pugh, Thomas; Tuna, Floriana; Ungur, Liviu; Collison, David; McInnes, Eric J.L.; Chibotaru, Liviu F.; Layfield, Richard A.

    2015-01-01

    Single-molecule magnets are a type of coordination compound that can retain magnetic information at low temperatures. Single-molecule magnets based on lanthanides have accounted for many important advances, including systems with very large energy barriers to reversal of the magnetization, and a di-terbium complex that displays magnetic hysteresis up to 14 K and shows strong coercivity. Ligand design is crucial for the development of new single-molecule magnets: organometallic chemistry presents possibilities for using unconventional ligands, particularly those with soft donor groups. Here we report dysprosium single-molecule magnets with neutral and anionic phosphorus donor ligands, and show that their properties change dramatically when varying the ligand from phosphine to phosphide to phosphinidene. A phosphide-ligated, trimetallic dysprosium single-molecule magnet relaxes via the second-excited Kramers' doublet, and, when doped into a diamagnetic matrix at the single-ion level, produces a large energy barrier of 256 cm−1 and magnetic hysteresis up to 4.4 K. PMID:26130418

  10. A comparison of the effects of symmetry and magnetoanisotropy on paramagnetic relaxation in related dysprosium single ion magnets.

    PubMed

    Williams, Ursula J; Mahoney, Brian D; DeGregorio, Patrick T; Carroll, Patrick J; Nakamaru-Ogiso, Eiko; Kikkawa, James M; Schelter, Eric J

    2012-06-01

    Dysprosium complexes of the tmtaa(2-) ligand were synthesized and characterized by X-band EPR and magnetism studies. Both complexes demonstrate magnetoanisotropy and slow paramagnetic relaxation. Comparison of these compounds with the seminal phthalocyanine complex [Dy(Pc)(2)](-) shows the azaannulide complexes are more susceptible to relaxation through non-thermal pathways.

  11. Cyclic single-molecule magnets: from the odd-numbered heptanuclear to a dimer of heptanuclear dysprosium clusters.

    PubMed

    Tian, Haiquan; Bao, Song-Song; Zheng, Li-Min

    2016-02-01

    A heptanuclear and a dimer of heptanuclear dysprosium clusters (Dy7 and Dy14) have been successfully synthesized by ingenious coalescence of the single and double pyrazinyl hydrazone as well as phosphonate ligands. The complexes feature the largest odd-numbered cyclic lanthanide clusters reported thus far. Both exhibit single molecule magnet behaviors at low temperature. PMID:26728975

  12. Cyclic single-molecule magnets: from the odd-numbered heptanuclear to a dimer of heptanuclear dysprosium clusters.

    PubMed

    Tian, Haiquan; Bao, Song-Song; Zheng, Li-Min

    2016-02-01

    A heptanuclear and a dimer of heptanuclear dysprosium clusters (Dy7 and Dy14) have been successfully synthesized by ingenious coalescence of the single and double pyrazinyl hydrazone as well as phosphonate ligands. The complexes feature the largest odd-numbered cyclic lanthanide clusters reported thus far. Both exhibit single molecule magnet behaviors at low temperature.

  13. 12 CFR 16.3 - Registration statement and prospectus requirements.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 12 Banks and Banking 1 2011-01-01 2011-01-01 false Registration statement and prospectus requirements. 16.3 Section 16.3 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY... shall offer or sell, directly or indirectly, any bank issued security unless: (1) A...

  14. 10 CFR 52.163 - Administrative review of applications; hearings.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2011-01-01 2011-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND...

  15. 10 CFR 52.163 - Administrative review of applications; hearings.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2014-01-01 2014-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND...

  16. 10 CFR 52.163 - Administrative review of applications; hearings.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2010-01-01 2010-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND...

  17. 10 CFR 52.163 - Administrative review of applications; hearings.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2012-01-01 2012-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND...

  18. 10 CFR 52.163 - Administrative review of applications; hearings.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2013-01-01 2013-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND...

  19. 27 CFR 22.163 - Time for making entries.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2013-04-01 2013-04-01 false Time for making entries. 22.163 Section 22.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Time for making entries. Any person who conducts an operation which is required to be recorded...

  20. 27 CFR 22.163 - Time for making entries.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Time for making entries. 22.163 Section 22.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Time for making entries. Any person who conducts an operation which is required to be recorded...

  1. 27 CFR 22.163 - Time for making entries.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2014-04-01 2014-04-01 false Time for making entries. 22.163 Section 22.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Time for making entries. Any person who conducts an operation which is required to be recorded...

  2. 27 CFR 22.163 - Time for making entries.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2011-04-01 2011-04-01 false Time for making entries. 22.163 Section 22.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Time for making entries. Any person who conducts an operation which is required to be recorded...

  3. 27 CFR 22.163 - Time for making entries.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2012-04-01 2012-04-01 false Time for making entries. 22.163 Section 22.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Time for making entries. Any person who conducts an operation which is required to be recorded...

  4. 25 CFR 163.13 - Indian tribal forest enterprise operations.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Indian tribal forest enterprise operations. 163.13... FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations. Indian tribal forest enterprises may be initiated and organized with consent of the authorized...

  5. 25 CFR 163.16 - Forest product sales without advertisement.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Forest product sales without advertisement. 163.16 Section... REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without advertisement to Indians or non-Indians with the consent of...

  6. 25 CFR 163.13 - Indian tribal forest enterprise operations.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Indian tribal forest enterprise operations. 163.13 Section... REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations. Indian tribal forest enterprises may be initiated and organized with consent of the authorized...

  7. 25 CFR 163.13 - Indian tribal forest enterprise operations.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Indian tribal forest enterprise operations. 163.13... FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations. Indian tribal forest enterprises may be initiated and organized with consent of the authorized...

  8. 25 CFR 163.16 - Forest product sales without advertisement.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 1 2013-04-01 2013-04-01 false Forest product sales without advertisement. 163.16... FORESTRY REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without advertisement to Indians or non-Indians with...

  9. 25 CFR 163.13 - Indian tribal forest enterprise operations.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Indian tribal forest enterprise operations. 163.13... FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations. Indian tribal forest enterprises may be initiated and organized with consent of the authorized...

  10. 25 CFR 163.16 - Forest product sales without advertisement.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Forest product sales without advertisement. 163.16... FORESTRY REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without advertisement to Indians or non-Indians with...

  11. 25 CFR 163.16 - Forest product sales without advertisement.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Forest product sales without advertisement. 163.16... FORESTRY REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without advertisement to Indians or non-Indians with...

  12. 25 CFR 163.16 - Forest product sales without advertisement.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Forest product sales without advertisement. 163.16... FORESTRY REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without advertisement to Indians or non-Indians with...

  13. 25 CFR 163.13 - Indian tribal forest enterprise operations.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 1 2014-04-01 2014-04-01 false Indian tribal forest enterprise operations. 163.13... FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations. Indian tribal forest enterprises may be initiated and organized with consent of the authorized...

  14. 25 CFR 163.28 - Fire management measures.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... wildfire protection needs and extinguish forest or range fires on Indian land. No expenses for fighting a... reservations on which a fire occurs, unless there are in effect at the time different rates that have been... 25 Indians 1 2012-04-01 2011-04-01 true Fire management measures. 163.28 Section 163.28...

  15. 25 CFR 163.28 - Fire management measures.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... wildfire protection needs and extinguish forest or range fires on Indian land. No expenses for fighting a... reservations on which a fire occurs, unless there are in effect at the time different rates that have been... 25 Indians 1 2011-04-01 2011-04-01 false Fire management measures. 163.28 Section 163.28...

  16. 25 CFR 163.28 - Fire management measures.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... wildfire protection needs and extinguish forest or range fires on Indian land. No expenses for fighting a... reservations on which a fire occurs, unless there are in effect at the time different rates that have been... 25 Indians 1 2014-04-01 2014-04-01 false Fire management measures. 163.28 Section 163.28...

  17. 25 CFR 163.28 - Fire management measures.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... wildfire protection needs and extinguish forest or range fires on Indian land. No expenses for fighting a... reservations on which a fire occurs, unless there are in effect at the time different rates that have been... 25 Indians 1 2010-04-01 2010-04-01 false Fire management measures. 163.28 Section 163.28...

  18. 25 CFR 163.28 - Fire management measures.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... wildfire protection needs and extinguish forest or range fires on Indian land. No expenses for fighting a... reservations on which a fire occurs, unless there are in effect at the time different rates that have been... 25 Indians 1 2013-04-01 2013-04-01 false Fire management measures. 163.28 Section 163.28...

  19. 25 CFR 163.22 - Payment for forest products.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... Forest Management and Operations § 163.22 Payment for forest products. (a) The basis of volume... measurement, piece count, weight, or such other form of measurement as the Secretary may authorize for use... any amounts segregated as forest management deductions pursuant to § 163.25 of this part,...

  20. 29 CFR 1952.163 - Compliance staffing benchmarks.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Compliance staffing benchmarks. 1952.163 Section 1952.163... Compliance staffing benchmarks. Under the terms of the 1978 Court Order in AFL-CIO v. Marshall, compliance staffing levels (benchmarks) necessary for a “fully effective” enforcement program were required to...

  1. 21 CFR 163.140 - Skim milk chocolate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate...

  2. 21 CFR 163.140 - Skim milk chocolate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate...

  3. 21 CFR 163.140 - Skim milk chocolate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate...

  4. 21 CFR 163.140 - Skim milk chocolate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate...

  5. 21 CFR 163.140 - Skim milk chocolate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate...

  6. 46 CFR 163.002-9 - Approval procedure.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-9 Approval procedure. (a) General. A pilot hoist... testing. Each approval test must be conducted in accordance with § 163.002-21. (c) Approval of alternative designs. A pilot hoist that does not meet the materials, construction, or performance requirements of...

  7. 12 CFR 163.161 - Management and financial policies.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 12 Banks and Banking 1 2014-01-01 2014-01-01 false Management and financial policies. 163.161... ASSOCIATIONS-OPERATIONS Financial Management Policies § 163.161 Management and financial policies. (a)(1) For... service corporation must be well managed and operate safely and soundly. Each also must pursue...

  8. 12 CFR 163.161 - Management and financial policies.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 12 Banks and Banking 1 2013-01-01 2013-01-01 false Management and financial policies. 163.161... ASSOCIATIONS-OPERATIONS Financial Management Policies § 163.161 Management and financial policies. (a)(1) For... service corporation must be well managed and operate safely and soundly. Each also must pursue...

  9. 27 CFR 479.163 - Reuse of stamps prohibited.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2013-04-01 2013-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES,...

  10. 27 CFR 479.163 - Reuse of stamps prohibited.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2011-04-01 2010-04-01 true Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES,...

  11. 27 CFR 479.163 - Reuse of stamps prohibited.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2012-04-01 2010-04-01 true Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES,...

  12. 27 CFR 479.163 - Reuse of stamps prohibited.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2014-04-01 2014-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES,...

  13. 27 CFR 479.163 - Reuse of stamps prohibited.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES,...

  14. 40 CFR 60.163 - Standard for sulfur dioxide.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 7 2014-07-01 2014-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided...

  15. 40 CFR 60.163 - Standard for sulfur dioxide.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 6 2011-07-01 2011-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided...

  16. 40 CFR 60.163 - Standard for sulfur dioxide.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 7 2013-07-01 2013-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided...

  17. 40 CFR 60.163 - Standard for sulfur dioxide.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 7 2012-07-01 2012-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided...

  18. 34 CFR 668.163 - Maintaining and accounting for funds.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 34 Education 3 2012-07-01 2012-07-01 false Maintaining and accounting for funds. 668.163 Section... POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.163 Maintaining and accounting for funds. (a)(1) Bank or investment account. An institution must maintain title...

  19. 34 CFR 668.163 - Maintaining and accounting for funds.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 34 Education 3 2014-07-01 2014-07-01 false Maintaining and accounting for funds. 668.163 Section... POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.163 Maintaining and accounting for funds. (a)(1) Bank or investment account. An institution must maintain title...

  20. 34 CFR 668.163 - Maintaining and accounting for funds.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 34 Education 3 2013-07-01 2013-07-01 false Maintaining and accounting for funds. 668.163 Section... POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.163 Maintaining and accounting for funds. (a)(1) Bank or investment account. An institution must maintain title...

  1. 28 CFR 35.163 - Information and signage.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users...

  2. 25 CFR 163.70 - Purpose of agreements.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 1 2012-04-01 2011-04-01 true Purpose of agreements. 163.70 Section 163.70 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS... materials; and (3) Perform land and facility improvements, including forestry and other natural...

  3. 25 CFR 163.17 - Deposit with bid.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... appeal under 25 CFR part 2, the Secretary may hold such bid deposits in an escrow account pending... 25 Indians 1 2011-04-01 2011-04-01 false Deposit with bid. 163.17 Section 163.17 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest...

  4. 25 CFR 163.17 - Deposit with bid.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... appeal under 25 CFR part 2, the Secretary may hold such bid deposits in an escrow account pending... 25 Indians 1 2014-04-01 2014-04-01 false Deposit with bid. 163.17 Section 163.17 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest...

  5. 25 CFR 163.17 - Deposit with bid.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... appeal under 25 CFR part 2, the Secretary may hold such bid deposits in an escrow account pending... 25 Indians 1 2013-04-01 2013-04-01 false Deposit with bid. 163.17 Section 163.17 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest...

  6. 25 CFR 163.70 - Purpose of agreements.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Purpose of agreements. 163.70 Section 163.70 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS... materials; and (3) Perform land and facility improvements, including forestry and other natural...

  7. 25 CFR 163.17 - Deposit with bid.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... appeal under 25 CFR part 2, the Secretary may hold such bid deposits in an escrow account pending... 25 Indians 1 2012-04-01 2011-04-01 true Deposit with bid. 163.17 Section 163.17 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest...

  8. 25 CFR 163.17 - Deposit with bid.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... appeal under 25 CFR part 2, the Secretary may hold such bid deposits in an escrow account pending... 25 Indians 1 2010-04-01 2010-04-01 false Deposit with bid. 163.17 Section 163.17 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest...

  9. 25 CFR 163.70 - Purpose of agreements.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 1 2011-04-01 2011-04-01 false Purpose of agreements. 163.70 Section 163.70 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS... materials; and (3) Perform land and facility improvements, including forestry and other natural...

  10. 7 CFR 457.163 - Nursery peak inventory endorsement.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery peak inventory endorsement. 457.163 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.163 Nursery peak inventory endorsement. Nursery Crop Insurance Peak Inventory Endorsement This endorsement is not continuous and must...

  11. 29 CFR 1952.163 - Compliance staffing benchmarks.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 29 Labor 9 2011-07-01 2011-07-01 false Compliance staffing benchmarks. 1952.163 Section 1952.163... Compliance staffing benchmarks. Under the terms of the 1978 Court Order in AFL-CIO v. Marshall, compliance staffing levels (benchmarks) necessary for a “fully effective” enforcement program were required to...

  12. 29 CFR 1952.163 - Compliance staffing benchmarks.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 29 Labor 9 2014-07-01 2014-07-01 false Compliance staffing benchmarks. 1952.163 Section 1952.163... Compliance staffing benchmarks. Under the terms of the 1978 Court Order in AFL-CIO v. Marshall, compliance staffing levels (benchmarks) necessary for a “fully effective” enforcement program were required to...

  13. 29 CFR 1952.163 - Compliance staffing benchmarks.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 29 Labor 9 2012-07-01 2012-07-01 false Compliance staffing benchmarks. 1952.163 Section 1952.163... Compliance staffing benchmarks. Under the terms of the 1978 Court Order in AFL-CIO v. Marshall, compliance staffing levels (benchmarks) necessary for a “fully effective” enforcement program were required to...

  14. 27 CFR 46.163 - Meaning of terms.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2014-04-01 2014-04-01 false Meaning of terms. 46.163... CIGARETTE PAPERS AND TUBES Dealers in Tobacco Products § 46.163 Meaning of terms. When used in this subpart... following terms shall have the meaning ascribed in this section. Words in the plural form shall include...

  15. 27 CFR 46.163 - Meaning of terms.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2012-04-01 2011-04-01 true Meaning of terms. 46.163... CIGARETTE PAPERS AND TUBES Dealers in Tobacco Products § 46.163 Meaning of terms. When used in this subpart... following terms shall have the meaning ascribed in this section. Words in the plural form shall include...

  16. 46 CFR 163.002-3 - Applicable technical regulations.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ...) Subpart 58.30 (Fluid Power and Control Systems). (2) Section 94.33-10 (Description of Fleet Angle). (3) Part 111 (Electrical System, General Requirements). (4) Subpart 163.003 (Pilot Ladder). (b) ... MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-3 Applicable technical...

  17. 14 CFR 121.163 - Aircraft proving tests.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 14 Aeronautics and Space 3 2013-01-01 2013-01-01 false Aircraft proving tests. 121.163 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Aircraft Requirements § 121.163 Aircraft proving...) Alterations to the aircraft or its components that materially affect flight characteristics. (e)...

  18. 14 CFR 121.163 - Aircraft proving tests.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft proving tests. 121.163 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Aircraft Requirements § 121.163 Aircraft proving...) Alterations to the aircraft or its components that materially affect flight characteristics. (e)...

  19. 14 CFR 121.163 - Aircraft proving tests.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 14 Aeronautics and Space 3 2014-01-01 2014-01-01 false Aircraft proving tests. 121.163 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Aircraft Requirements § 121.163 Aircraft proving...) Alterations to the aircraft or its components that materially affect flight characteristics. (e)...

  20. 14 CFR 121.163 - Aircraft proving tests.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 14 Aeronautics and Space 3 2012-01-01 2012-01-01 false Aircraft proving tests. 121.163 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Aircraft Requirements § 121.163 Aircraft proving...) Alterations to the aircraft or its components that materially affect flight characteristics. (e)...

  1. 14 CFR 121.163 - Aircraft proving tests.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 14 Aeronautics and Space 3 2011-01-01 2011-01-01 false Aircraft proving tests. 121.163 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Aircraft Requirements § 121.163 Aircraft proving...) Alterations to the aircraft or its components that materially affect flight characteristics. (e)...

  2. 12 CFR 163.33 - Directors, officers, and employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 12 Banks and Banking 1 2012-01-01 2012-01-01 false Directors, officers, and employees. 163.33... ASSOCIATIONS-OPERATIONS Operation and Structure § 163.33 Directors, officers, and employees. (a) Directors—(1) Requirements. The composition of the board of directors of a Federal savings association must be in...

  3. 12 CFR 163.33 - Directors, officers, and employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 12 Banks and Banking 1 2014-01-01 2014-01-01 false Directors, officers, and employees. 163.33... ASSOCIATIONS-OPERATIONS Operation and Structure § 163.33 Directors, officers, and employees. (a) Directors—(1) Requirements. The composition of the board of directors of a Federal savings association must be in...

  4. A naproxen complex of dysprosium intercalates into calf thymus DNA base pairs

    NASA Astrophysics Data System (ADS)

    Yang, Mengsi; Jin, Jianhua; Xu, Guiqing; Cui, Fengling; Luo, Hongxia

    2014-01-01

    The binding mode and mechanism of dysprosium-naproxen complex (Dy-NAP) with calf thymus deoxyribonucleic acid (ctDNA) were studied using UV-vis and fluorescence spectra in physiological buffer (pH 7.4). The results showed that more than one type of quenching process occurred and the binding mode between Dy-NAP with ctDNA might be intercalation. In addition, ionic strength, iodide quenching and fluorescence polarization experiments corroborated the intercalation binding mode between Dy-NAP and ctDNA. The calculated thermodynamic parameters ΔG, ΔH and ΔS at different temperature demonstrated that hydrophobic interaction force played a major role in the binding process.

  5. Dysprosium-carboxylate nanomeshes with tunable cavity size and assembly motif through ionic interactions.

    PubMed

    Cirera, B; Đorđević, L; Otero, R; Gallego, J M; Bonifazi, D; Miranda, R; Ecija, D

    2016-09-28

    We report the design of dysprosium directed metallo-supramolecular architectures on a pristine Cu(111) surface. By an appropriate selection of the ditopic molecular linkers equipped with terminal carboxylic groups (TPA, PDA and TDA species), we create reticular and mononuclear metal-organic nanomeshes of tunable internodal distance, which are stabilized by eight-fold DyO interactions. A thermal annealing treatment for the reticular Dy:TDA architecture gives rise to an unprecedented quasi-hexagonal nanostructure based on dinuclear Dy clusters, exhibiting a unique six-fold DyO bonding motif. All metallo-supramolecular architectures are stable at room temperature. Our results open new avenues for the engineering of supramolecular architectures on surfaces incorporating f-block elements forming thermally robust nanoarchitectures through ionic bonds. PMID:27560774

  6. Photophysical and electrochemical properties of a dysprosium-zinc tetra(4-sulfonatophenyl)porphyrin complex.

    PubMed

    Chen, Wen-Tong; Liu, Dong-Sheng; Xu, Ya-Ping; Luo, Qiu-Yan; Pei, Yun-Peng

    2016-02-01

    A dysprosium-zinc porphyrin, [DyZn(TPPS)H3O]n (1) (TPPS = tetra(4-sulfonatophenyl)porphyrin), was prepared through solvothermal reactions and structurally characterized by single-crystal X-ray diffraction analyses. Complex 1 features a three-dimensional (3-D) porous open framework that is thermally stable up to 400 °C. Complex 1 displays a void space of 215 Å(3), occupying 9.2% of the unit cell volume. The fluorescence spectra reveal that it shows an emission band in the red region. The fluorescence lifetime is 39 µsec and the quantum yield is 1.7%. The cyclic voltammetry (CV) measurement revealed one quasi-reversible wave with E1/2  = 0.30 V. PMID:26014749

  7. Magnetic ordering temperatures in rare earth metal dysprosium under ultrahigh pressures

    NASA Astrophysics Data System (ADS)

    Samudrala, Gopi K.; Tsoi, Georgiy M.; Weir, Samuel T.; Vohra, Yogesh K.

    2014-04-01

    Magnetic ordering temperatures in heavy rare earth metal dysprosium (Dy) have been studied using an ultrasensitive electrical transport measurement technique in a designer diamond anvil cell to a pressure of 69 GPa and a temperature of 10 K. Previous studies using magnetic susceptibility measurements at high pressures were able to track magnetic ordering temperature only till 7 GPa in the hexagonal close packed (hcp) phase of Dy. Our studies indicate that the magnetic ordering temperature shows an abrupt drop of 80 K at the hcp-Sm phase transition followed by a gradual decrease that continues till 17 GPa. This is followed by a rapid increase in the magnetic ordering temperatures in the double hcp phase and finally leveling off in the distorted face centered cubic phase of Dy. Our studies reaffirm that 4f-shell remains localized in Dy and there is no loss of magnetic moment or 4f-shell delocalization for pressures up to 69 GPa.

  8. Structural and electrical characteristics of dysprosium-doped barium stannate titanate ceramics

    SciTech Connect

    Wang, Shijie; Tan, Tai Aik; Lai, Man On; Lu, Li

    2010-03-15

    Effects of dysprosium (Dy) amphoteric doping on the structural, dielectric and electric properties of barium stannate titanate (BTS) ceramics have been studied. X-ray diffraction analyses reveal that all Dy-doped BTS ceramics exhibit cubic perovskite structure until to 1 mol%. Dy doping at the A site shows lower solubility than that at the B site. SEM surface morphologies display that the Dy B site doping is beneficial for the compact and homogeneous grain distribution. The dielectric constant and loss tangent are reduced with increase of the doping levels. Impedance spectroscopy investigation demonstrates that all samples are insulating at room temperature. Doping alters the full resistive regions of pure BTS ceramics to Doped BTS with insulating grain boundaries and semiconducting bulk regions, but the doping contents has little effect on changing the electric structures.

  9. Photophysical and electrochemical properties of a dysprosium-zinc tetra(4-sulfonatophenyl)porphyrin complex.

    PubMed

    Chen, Wen-Tong; Liu, Dong-Sheng; Xu, Ya-Ping; Luo, Qiu-Yan; Pei, Yun-Peng

    2016-02-01

    A dysprosium-zinc porphyrin, [DyZn(TPPS)H3O]n (1) (TPPS = tetra(4-sulfonatophenyl)porphyrin), was prepared through solvothermal reactions and structurally characterized by single-crystal X-ray diffraction analyses. Complex 1 features a three-dimensional (3-D) porous open framework that is thermally stable up to 400 °C. Complex 1 displays a void space of 215 Å(3), occupying 9.2% of the unit cell volume. The fluorescence spectra reveal that it shows an emission band in the red region. The fluorescence lifetime is 39 µsec and the quantum yield is 1.7%. The cyclic voltammetry (CV) measurement revealed one quasi-reversible wave with E1/2  = 0.30 V.

  10. Dysprosium-carboxylate nanomeshes with tunable cavity size and assembly motif through ionic interactions.

    PubMed

    Cirera, B; Đorđević, L; Otero, R; Gallego, J M; Bonifazi, D; Miranda, R; Ecija, D

    2016-09-28

    We report the design of dysprosium directed metallo-supramolecular architectures on a pristine Cu(111) surface. By an appropriate selection of the ditopic molecular linkers equipped with terminal carboxylic groups (TPA, PDA and TDA species), we create reticular and mononuclear metal-organic nanomeshes of tunable internodal distance, which are stabilized by eight-fold DyO interactions. A thermal annealing treatment for the reticular Dy:TDA architecture gives rise to an unprecedented quasi-hexagonal nanostructure based on dinuclear Dy clusters, exhibiting a unique six-fold DyO bonding motif. All metallo-supramolecular architectures are stable at room temperature. Our results open new avenues for the engineering of supramolecular architectures on surfaces incorporating f-block elements forming thermally robust nanoarchitectures through ionic bonds.

  11. Detail of heating coil for Machine Shop (Bldg. 163) ventilation ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Detail of heating coil for Machine Shop (Bldg. 163) ventilation system Note portion of fan visible behind coil - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM

  12. Structural, optical, thermal, mechanical and dielectric studies of Sulfamic acid single crystals: An influence of dysprosium (Dy3+) doping

    NASA Astrophysics Data System (ADS)

    Singh, Budhendra; Shkir, Mohd.; AlFaify, S.; Kaushal, Ajay; Nasani, Narendar; Bdikin, Igor; Shoukry, H.; Yahia, I. S.; Algarni, H.

    2016-09-01

    Sulfamic acid is a potential material that exhibits excellent optical properties. A good quality, pure and dysprosium (Dy3+) doped (2.5 and 5 mol %) Sulfamic acid (SA) single crystals were grown successfully by slow cooling method. Structural study revealed a slight change in its lattice parameters and volume, suggesting the successful incorporation of Dy3+ in crystal system. The existence of dysprosium in the system was also confirmed. Presence of various vibrational modes was confirmed. Optical transparency was found to have a significant effect with variation in the doping concentration. Furthermore, a marked enhancement in its mechanical parameters with doping was also identified by nanoindentation technique. Etching study was also performed on the grown crystals to study the etch-pit formation and growth mechanism. Effect of doping on the thermal stability was analysed. All the results were compared and discussed in detail to get insight of the effect of doping concentration on Sulfamic acid crystal.

  13. Fluorescence studies, DNA binding properties and antimicrobial activity of a dysprosium(III) complex containing 1,10-phenanthroline.

    PubMed

    Khorasani-Motlagh, Mozhgan; Noroozifar, Meissam; Moodi, Asieh; Niroomand, Sona

    2013-10-01

    Luminescence and binding properties of dysprosium(III) complex containing 1,10-phenanthroline (phen), [Dy(phen)2(OH2)3Cl]Cl2⋅H2O with DNA has been studied by electronic absorption, emission spectroscopy and viscosity measurement. The thermodynamic studies suggest that the interaction process to be endothermic and entropically driven, which indicates that the dysprosium(III) complex might interact with DNA by a non intercalation binding mode. Additionally, the competitive fluorescence study with ethidium bromide and also the effect of iodide ion and salt concentration on fluorescence of the complex-DNA system is investigated. Experimental results indicate that the Dy(III) complex strongly binds to DNA, presumably via groove binding mode. Furthermore, the complex shows a potent antibacterial activity and DNA cleavage ability.

  14. Atomic Mass and Nuclear Binding Energy for I-163 (Iodine)

    NASA Astrophysics Data System (ADS)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume A `Nuclei with Z = 1 - 54' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms'. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope I-163 (Iodine, atomic number Z = 53, mass number A = 163).

  15. Peripheral Substitution: An Easy Way to Tuning the Magnetic Behavior of Tetrakis(phthalocyaninato) Dysprosium(III) SMMs

    PubMed Central

    Shang, Hong; Zeng, Suyuan; Wang, Hailong; Dou, Jianmin; Jiang, Jianzhuang

    2015-01-01

    Two tetrakis(phthalocyaninato) dysprosium(III)-cadmium(II) single-molecule magnets (SMMs) with different extent of phthalocyanine peripheral substitution and therefore different coordination geometry for the Dy ions were revealed to exhibit different SMM behavior, providing an easy way to tuning and controlling the molecular structure and in turn the magnetic properties of tetrakis(tetrapyrrole) lanthanide SMMs through simple tetrapyrrole peripheral substitution. PMID:25744587

  16. Spectroscopy of the neutron-deficient isobars {sup 163}Re and {sup 163}W using tagging techniques

    SciTech Connect

    Joss, D. T.; Thomson, J.; Page, R. D.; Bianco, L.; Darby, I. G.; Grahn, T.; Pakarinen, J.; Paul, E. S.; Scholey, C.; Eeckhaudt, S.; Greenlees, P. T.; Jones, P. M.; Julin, R.; Juutinen, S.; Ketelhut, S.; Leino, M.; Leppaennen, A.-P.; Nyman, M.; Rahkila, P.; Sorri, J.

    2008-11-11

    Selective tagging techniques have been used to establish new band structures in the transitional isobars {sup 163}Re and {sup 163}W. These nuclei were produced in the {sup 106}Cd({sup 60}Ni, xp yn {gamma}) reaction at a bombarding energy of 270 MeV. Prompt {gamma} rays were detected at the target position using the JUROGAM spectrometer while recoiling ions were separated by the RITU separator and implanted into the GREAT spectrometer. At low spin, the yrast band of {sup 163}Re is shown to be a strongly coupled collective band based on a proton h{sub 11/2} configuration. In {sup 163}W, the decay path of the 13/2{sup +} isomeric state to the ground state has been identified and negative parity structures based on the ground state established.

  17. Purification and characterization of plantaricin 163, a novel bacteriocin produced by Lactobacillus plantarum 163 isolated from traditional Chinese fermented vegetables.

    PubMed

    Hu, Meizhong; Zhao, Haizhen; Zhang, Chong; Yu, Jiansheng; Lu, Zhaoxin

    2013-11-27

    Presumptive lactic acid bacteria (LAB) strains isolated from traditional Chinese fermented vegetables were screened for bacteriocin production. A novel bacteriocin-producing strain, Lactobacillus plantarum 163, was identified on the basis of its physiobiochemical characteristics and characterized by 16S rDNA sequencing. The novel bacteriocin, plantaricin 163, produced by Lb. plantarum 163 was purified by salt precipitation, gel filtration, and reverse-phase high-performance liquid chromatography (RP-HPLC). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis of plantaricin 163 revealed the molecular weight to be 3553.2 Da. The complete amino acid sequence showed VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK, and no similarity to known bacteriocins was found. Plantaricin 163 was highly thermostable (20 min, 121 °C), active in the presence of acidic pH (3-5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria. The results suggest that plantaricin 163 may be employed as a biopreservative in the food industry.

  18. Evaluating United States and world consumption of neodymium, dysprosium, terbium, and praseodymium in final products

    NASA Astrophysics Data System (ADS)

    Hart, Matthew

    This paper develops scenarios of future rare-earth-magnet metal (neodymium, dysprosium, terbium, and praseodymium) consumption in the permanent magnets used in wind turbines and hybrid electric vehicles. The scenarios start with naive base-case scenarios for growth in wind-turbine and hybrid-electric-vehicle sales over the period 2011 to 2020, using historical data for each good. These naive scenarios assume that future growth follows time trends in historical data and does not depend on any exogenous variable. Specifically, growth of each technological market follows historical time trends, and the amount of rare earths used per unit of technology remains fixed. The chosen reference year is 2010. Implied consumptions of the rare earth magnet metals are calculated from these scenarios. Assumptions are made for the material composition of permanent magnets, the market share of permanent-magnet wind turbines and vehicles, and magnet weight per unit of technology. Different scenarios estimate how changes in factors like the material composition of magnets, growth of the economy, and the price of a substitute could affect future consumption. Each scenario presents a different method for reducing rare earth consumption and could be interpreted as potential policy choices. In 2010, the consumption (metric tons, rare-earth-oxide equivalent) of each rare-earth-magnet metal was as follows. Total neodymium consumption in the world for both technologies was 995 tons; dysprosium consumption was 133 tons; terbium consumption was 50 tons; praseodymium consumption was zero tons. The base scenario for wind turbines shows there could be strong, exponential growth in the global wind turbine market. New U.S. sales of hybrid vehicles would decline (in line with the current economic recession) while non-U.S. sales increase through 2020. There would be an overall increase in the total amount of magnetic rare earths consumed in the world. Total consumption of each rare earth in the short

  19. Paramagnetic dysprosium-doped zinc oxide thin films grown by pulsed-laser deposition

    SciTech Connect

    Lo, Fang-Yuh Ting, Yi-Chieh; Chou, Kai-Chieh; Hsieh, Tsung-Chun; Ye, Cin-Wei; Hsu, Yung-Yuan; Liu, Hsiang-Lin; Chern, Ming-Yau

    2015-06-07

    Dysprosium(Dy)-doped zinc oxide (Dy:ZnO) thin films were fabricated on c-oriented sapphire substrate by pulsed-laser deposition with doping concentration ranging from 1 to 10 at. %. X-ray diffraction (XRD), Raman-scattering, optical transmission spectroscopy, and spectroscopic ellipsometry revealed incorporation of Dy into ZnO host matrix without secondary phase. Solubility limit of Dy in ZnO under our deposition condition was between 5 and 10 at. % according to XRD and Raman-scattering characteristics. Optical transmission spectroscopy and spectroscopic ellipsometry also showed increase in both transmittance in ultraviolet regime and band gap of Dy:ZnO with increasing Dy density. Zinc vacancies and zinc interstitials were identified by photoluminescence spectroscopy as the defects accompanied with Dy incorporation. Magnetic investigations with a superconducting quantum interference device showed paramagnetism without long-range order for all Dy:ZnO thin films, and a hint of antiferromagnetic alignment of Dy impurities was observed at highest doping concentration—indicating the overall contribution of zinc vacancies and zinc interstitials to magnetic interaction was either neutral or toward antiferromagnetic. From our investigations, Dy:ZnO thin films could be useful for spin alignment and magneto-optical applications.

  20. Spectral and physicochemical characterization of dysprosium-based multifunctional ionic liquid crystals.

    PubMed

    Lu, Chengfei; Das, Susmita; Siraj, Noureen; Magut, Paul K S; Li, Min; Warner, Isiah M

    2015-05-21

    We report on the synthesis and characterization of multifunctional ionic liquid crystals (melting points below 100 °C) which possess chirality and fluorescent behavior as well as mesomorphic and magnetic properties. In this regard, (1R,2S)-(-)-N-methylephedrine ((-)MeEph), containing a chiral center, is linked with variable alkyl chain lengths (e.g., 14, 16, and 18 carbons) to yield liquid crystalline properties in the cations of these compounds. A complex counteranion consisting of trivalent dysprosium (Dy(3+)) and thiocyanate ligand (SCN(-)) is employed, where Dy(3+) provides fluorescent and magnetic properties. Examination of differential scanning calorimetry (DSC) and hot-stage polarizing optical microscopy (POM) data confirmed liquid crystalline characteristics in these materials. We further report on phase transitions from solid to liquid crystal states, followed by isotropic liquid states with increasing temperature. These compounds exhibited two characteristic emission peaks in acetonitrile solution and the solid state when excited at λex = 366 nm, which are attributed to transitions from (4)F9/2 to (6)H15/2 and (4)F9/2 to (6)H13/2. The emission intensities of these compounds were found to be very sensitive to the phase.

  1. Toxicity of dysprosium nano particles with glucose and sodium chloride on E. Coli

    NASA Astrophysics Data System (ADS)

    Anaya, N. M.; Solomon, F.; Oyanedel-Craver, V.

    2013-12-01

    Application of rare earth elements (REEs) such as, dysprosium nanoparticles (nDy), to the biomedical field are increasing due to their paramagnetic properties. Current applications of nDy in the biomedical field are in MRI screening and anti-cancer therapy. Environmental impacts of nDy released into the environment are unknown or poorly understood and are a concern due to the lack of appropriate recycling systems. The objective of this toxicological study is to assess the impacts of nDy at relevant environmental concentrations on Escherichia coli. A range of glucose concentrations were used to evaluate the impact under different aerobic metabolic stages when the bacteria are exposed to the nanoparticles. Two traditional techniques used to evaluate the physiological response of E. coli at different environmental conditions were dual staining with fluorescent dyes (Live/Dead BacLight viability kit) and respirometric assays. A high-through put array-based methodology was implemented to provide additional toxicity testing. Preliminary toxicology results for both traditional techniques showed a positive trend between nDy and carbon source concentrations. High concentrations of nDy (>5mg/L) in environments with high glucose concentration (>210mg/L) are more toxic to E. coli than environments with low glucose concentrations. On the other hand, Live/Dead experiments showed higher toxicity effect in comparison to the respirometric tests using the same exposure conditions, suggesting that even at high membrane disruption the bacteria can still performed some metabolic activity.

  2. New limits on variation of the fine-structure constant using atomic dysprosium.

    PubMed

    Leefer, N; Weber, C T M; Cingöz, A; Torgerson, J R; Budker, D

    2013-08-01

    We report on the spectroscopy of radio-frequency transitions between nearly degenerate, opposite-parity excited states in atomic dysprosium (Dy). Theoretical calculations predict that these states are very sensitive to variation of the fine-structure constant α owing to large relativistic corrections of opposite sign for the opposite-parity levels. The near degeneracy reduces the relative precision necessary to place constraints on variation of α, competitive with results obtained from the best atomic clocks in the world. Additionally, the existence of several abundant isotopes of Dy allows isotopic comparisons that suppress common-mode systematic errors. The frequencies of the 754-MHz transition in 164Dy and 235-MHz transition in 162Dy are measured over the span of two years. The linear variation of α is α·/α=(-5.8±6.9([1σ]))×10(-17)  yr(-1), consistent with zero. The same data are used to constrain the dimensionless parameter kα characterizing a possible coupling of α to a changing gravitational potential. We find that kα=(-5.5±5.2([1σ]))×10(-7), essentially consistent with zero and the best constraint to date.

  3. Magnetic ordering temperatures in rare earth metal dysprosium under ultrahigh pressures

    DOE PAGES

    Samudrala, Gopi K.; Tsoi, Georgiy M.; Weir, Samuel T.; Vohra, Yogesh K.

    2014-04-03

    Magnetic ordering temperatures in heavy rare earth metal Dysprosium (Dy) have been studied using an ultrasensitive electrical transport measurement technique in a designer diamond anvil cell to extreme conditions of pressure to 69 GPa and temperature to 10 K. Previous studies using magnetic susceptibility measurements at high pressures were only able to track magnetic ordering temperature till 7 GPa in the hexagonal close packed (hcp) phase of Dy. Our studies indicate that the magnetic ordering temperature shows an abrupt drop of 80 K at the hcp-Sm phase transition followed by a gradual decrease that continues till 17 GPa. This ismore » followed by a rapid increase in the magnetic ordering temperatures in the double hexagonal close packed phase and finally leveling off in the distorted face centered cubic phase of Dy. Lastly, our studies reaffirm that 4f-shell remain localized in Dy and there is no loss of magnetic moment or 4f-shell delocalization for pressures up to 69 GPa.« less

  4. A New Fungal Isolate, Penidiella sp. Strain T9, Accumulates the Rare Earth Element Dysprosium

    PubMed Central

    Horiike, Takumi

    2015-01-01

    With an aim to develop a highly efficient method for the recovery of rare earth elements (REEs) by using microorganisms, we attempted to isolate dysprosium (Dy)-accumulating microorganisms that grow under acidic conditions from environmental samples containing high concentrations of heavy metals. One acidophilic strain, T9, which was isolated from an abandoned mine, decreased the concentration of Dy in medium that contained 100 mg/liter Dy to 53 mg/liter Dy after 3 days of cultivation at pH 2.5. The Dy content in the cell pellet of the T9 strain was 910 μg/mg of dry cells. The T9 strain also accumulated other REEs. Based on the results of 28S-D1/D2 rRNA gene sequencing and morphological characterization, we designated this fungal strain Penidiella sp. T9. Bioaccumulation of Dy was observed on the cell surface of the T9 strain by elemental mapping using scanning electron microscopy-energy dispersive X-ray spectroscopy. Our results indicate that Penidiella sp. T9 has the potential to recover REEs such as Dy from mine drainage and industrial liquid waste under acidic conditions. PMID:25710372

  5. Magnetic ordering temperatures in rare earth metal dysprosium under ultrahigh pressures

    SciTech Connect

    Samudrala, Gopi K.; Tsoi, Georgiy M.; Weir, Samuel T.; Vohra, Yogesh K.

    2014-04-03

    Magnetic ordering temperatures in heavy rare earth metal Dysprosium (Dy) have been studied using an ultrasensitive electrical transport measurement technique in a designer diamond anvil cell to extreme conditions of pressure to 69 GPa and temperature to 10 K. Previous studies using magnetic susceptibility measurements at high pressures were only able to track magnetic ordering temperature till 7 GPa in the hexagonal close packed (hcp) phase of Dy. Our studies indicate that the magnetic ordering temperature shows an abrupt drop of 80 K at the hcp-Sm phase transition followed by a gradual decrease that continues till 17 GPa. This is followed by a rapid increase in the magnetic ordering temperatures in the double hexagonal close packed phase and finally leveling off in the distorted face centered cubic phase of Dy. Lastly, our studies reaffirm that 4f-shell remain localized in Dy and there is no loss of magnetic moment or 4f-shell delocalization for pressures up to 69 GPa.

  6. New limits on variation of the fine-structure constant using atomic dysprosium.

    PubMed

    Leefer, N; Weber, C T M; Cingöz, A; Torgerson, J R; Budker, D

    2013-08-01

    We report on the spectroscopy of radio-frequency transitions between nearly degenerate, opposite-parity excited states in atomic dysprosium (Dy). Theoretical calculations predict that these states are very sensitive to variation of the fine-structure constant α owing to large relativistic corrections of opposite sign for the opposite-parity levels. The near degeneracy reduces the relative precision necessary to place constraints on variation of α, competitive with results obtained from the best atomic clocks in the world. Additionally, the existence of several abundant isotopes of Dy allows isotopic comparisons that suppress common-mode systematic errors. The frequencies of the 754-MHz transition in 164Dy and 235-MHz transition in 162Dy are measured over the span of two years. The linear variation of α is α·/α=(-5.8±6.9([1σ]))×10(-17)  yr(-1), consistent with zero. The same data are used to constrain the dimensionless parameter kα characterizing a possible coupling of α to a changing gravitational potential. We find that kα=(-5.5±5.2([1σ]))×10(-7), essentially consistent with zero and the best constraint to date. PMID:23971546

  7. Thermoluminescence properties of lithium magnesium borate glasses system doped with dysprosium oxide.

    PubMed

    Mhareb, M H A; Hashim, S; Ghoshal, S K; Alajerami, Y S M; Saleh, M A; Razak, N A B; Azizan, S A B

    2015-12-01

    We report the impact of dysprosium (Dy(3+)) dopant and magnesium oxide (MgO) modifier on the thermoluminescent properties of lithium borate (LB) glass via two procedures. The thermoluminescence (TL) glow curves reveal a single prominent peak at 190 °C for 0.5 mol% of Dy(3+). An increase in MgO contents by 10 mol% enhances the TL intensity by a factor of 1.5 times without causing any shift in the maximum temperature. This enhancement is attributed to the occurrence of extra electron traps created via magnesium and the energy transfer to trivalent Dy(3+) ions. Good linearity in the range of 0.01-4 Gy with a linear correlation coefficient of 0.998, fading as low as 21% over a period of 3 months, excellent reproducibility without oven annealing and tissue equivalent effective atomic numbers ~8.71 are achieved. The trap parameters, including geometric factor (μg), activation energy (E) and frequency factor (s) associated with LMB:Dy are also determined. These favorable TL characteristics of prepared glasses may contribute towards the development of Li2O-MgO-B2O3 radiation dosimeters.

  8. A new fungal isolate, Penidiella sp. strain T9, accumulates the rare earth element dysprosium.

    PubMed

    Horiike, Takumi; Yamashita, Mitsuo

    2015-05-01

    With an aim to develop a highly efficient method for the recovery of rare earth elements (REEs) by using microorganisms, we attempted to isolate dysprosium (Dy)-accumulating microorganisms that grow under acidic conditions from environmental samples containing high concentrations of heavy metals. One acidophilic strain, T9, which was isolated from an abandoned mine, decreased the concentration of Dy in medium that contained 100 mg/liter Dy to 53 mg/liter Dy after 3 days of cultivation at pH 2.5. The Dy content in the cell pellet of the T9 strain was 910 μg/mg of dry cells. The T9 strain also accumulated other REEs. Based on the results of 28S-D1/D2 rRNA gene sequencing and morphological characterization, we designated this fungal strain Penidiella sp. T9. Bioaccumulation of Dy was observed on the cell surface of the T9 strain by elemental mapping using scanning electron microscopy-energy dispersive X-ray spectroscopy. Our results indicate that Penidiella sp. T9 has the potential to recover REEs such as Dy from mine drainage and industrial liquid waste under acidic conditions.

  9. Thermoluminescence properties of lithium magnesium borate glasses system doped with dysprosium oxide.

    PubMed

    Mhareb, M H A; Hashim, S; Ghoshal, S K; Alajerami, Y S M; Saleh, M A; Razak, N A B; Azizan, S A B

    2015-12-01

    We report the impact of dysprosium (Dy(3+)) dopant and magnesium oxide (MgO) modifier on the thermoluminescent properties of lithium borate (LB) glass via two procedures. The thermoluminescence (TL) glow curves reveal a single prominent peak at 190 °C for 0.5 mol% of Dy(3+). An increase in MgO contents by 10 mol% enhances the TL intensity by a factor of 1.5 times without causing any shift in the maximum temperature. This enhancement is attributed to the occurrence of extra electron traps created via magnesium and the energy transfer to trivalent Dy(3+) ions. Good linearity in the range of 0.01-4 Gy with a linear correlation coefficient of 0.998, fading as low as 21% over a period of 3 months, excellent reproducibility without oven annealing and tissue equivalent effective atomic numbers ~8.71 are achieved. The trap parameters, including geometric factor (μg), activation energy (E) and frequency factor (s) associated with LMB:Dy are also determined. These favorable TL characteristics of prepared glasses may contribute towards the development of Li2O-MgO-B2O3 radiation dosimeters. PMID:25828828

  10. 18 CFR 367.1630 - Account 163, Stores expense undistributed.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 18 Conservation of Power and Water Resources 1 2014-04-01 2014-04-01 false Account 163, Stores expense undistributed. 367.1630 Section 367.1630 Conservation of Power and Water Resources FEDERAL ENERGY... applicable to fuel costs should be included in account 152, Fuel stock expenses undistributed (§...

  11. 18 CFR 367.1630 - Account 163, Stores expense undistributed.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 18 Conservation of Power and Water Resources 1 2013-04-01 2013-04-01 false Account 163, Stores expense undistributed. 367.1630 Section 367.1630 Conservation of Power and Water Resources FEDERAL ENERGY... applicable to fuel costs should be included in account 152, Fuel stock expenses undistributed (§...

  12. Looking west at Machine Shop (Bldg. 163) south bay interior. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Looking west at Machine Shop (Bldg. 163) south bay interior. Note the Shaw 15-ton bridge crane. This portion of the building housed machine tools and locomotive component repair functions that supported the erecting shop operations - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM

  13. 34 CFR 668.163 - Maintaining and accounting for funds.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 668.163 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF..., ACG, National SMART Grant, TEACH Grant, FSEOG, and FWS program funds in an interest-bearing bank... not have to maintain Direct Loan, Federal Pell Grant, ACG, National SMART Grant, TEACH Grant,...

  14. 27 CFR 25.163 - Method of tax payment.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§...

  15. 27 CFR 25.163 - Method of tax payment.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ..., DEPARTMENT OF THE TREASURY ALCOHOL BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§...

  16. 27 CFR 25.163 - Method of tax payment.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§...

  17. 27 CFR 25.163 - Method of tax payment.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ..., DEPARTMENT OF THE TREASURY ALCOHOL BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§...

  18. 40 CFR 80.163 - Detergent certification options.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 16 2011-07-01 2011-07-01 false Detergent certification options. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.163 Detergent certification options. To be used to satisfy the detergency requirements under § 80.161(a), a detergent additive must...

  19. 40 CFR 80.163 - Detergent certification options.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 17 2013-07-01 2013-07-01 false Detergent certification options. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.163 Detergent certification options. To be used to satisfy the detergency requirements under § 80.161(a), a detergent additive must...

  20. 40 CFR 80.163 - Detergent certification options.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 17 2014-07-01 2014-07-01 false Detergent certification options. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.163 Detergent certification options. To be used to satisfy the detergency requirements under § 80.161(a), a detergent additive must...

  1. 40 CFR 80.163 - Detergent certification options.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 17 2012-07-01 2012-07-01 false Detergent certification options. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.163 Detergent certification options. To be used to satisfy the detergency requirements under § 80.161(a), a detergent additive must...

  2. 18 CFR 367.1630 - Account 163, Stores expense undistributed.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 18 Conservation of Power and Water Resources 1 2011-04-01 2011-04-01 false Account 163, Stores expense undistributed. 367.1630 Section 367.1630 Conservation of Power and Water Resources FEDERAL ENERGY..., transportation companies or others in compensation of the losses. (9) Postage, printing, stationery and...

  3. 17 CFR 256.163 - Stores expense undistributed.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... orders. All expenses of a service company's centralized procurement activities shall be cleared through... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.163 Stores expense...

  4. 17 CFR 256.163 - Stores expense undistributed.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... orders. All expenses of a service company's centralized procurement activities shall be cleared through... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.163 Stores expense...

  5. 21 CFR 163.5 - Methods of analysis.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... heading “Fat in Cacao Products—Soxhlet Extraction Method—Final Action, 1973,” pp. 770-771. ... CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in... in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies may be obtained from the...

  6. 14 CFR 125.163 - Fire-extinguishing agents.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... Requirements § 125.163 Fire-extinguishing agents. Only methyl bromide, carbon dioxide, or another agent that.... If methyl bromide or any other toxic extinguishing agent is used, provisions must be made to prevent... ground or in flight when there is a defect in the extinguishing system. If a methyl bromide system...

  7. 14 CFR 125.163 - Fire-extinguishing agents.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... Requirements § 125.163 Fire-extinguishing agents. Only methyl bromide, carbon dioxide, or another agent that.... If methyl bromide or any other toxic extinguishing agent is used, provisions must be made to prevent... ground or in flight when there is a defect in the extinguishing system. If a methyl bromide system...

  8. 14 CFR 125.163 - Fire-extinguishing agents.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... Requirements § 125.163 Fire-extinguishing agents. Only methyl bromide, carbon dioxide, or another agent that.... If methyl bromide or any other toxic extinguishing agent is used, provisions must be made to prevent... ground or in flight when there is a defect in the extinguishing system. If a methyl bromide system...

  9. 14 CFR 125.163 - Fire-extinguishing agents.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Requirements § 125.163 Fire-extinguishing agents. Only methyl bromide, carbon dioxide, or another agent that.... If methyl bromide or any other toxic extinguishing agent is used, provisions must be made to prevent... ground or in flight when there is a defect in the extinguishing system. If a methyl bromide system...

  10. 14 CFR 125.163 - Fire-extinguishing agents.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... Requirements § 125.163 Fire-extinguishing agents. Only methyl bromide, carbon dioxide, or another agent that.... If methyl bromide or any other toxic extinguishing agent is used, provisions must be made to prevent... ground or in flight when there is a defect in the extinguishing system. If a methyl bromide system...

  11. 27 CFR 25.163 - Method of tax payment.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on Form 5000.24, as provided in §§...

  12. 46 CFR 163.003-21 - Approval tests.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-21 Approval tests. (a) General. Each approval test must be conducted on a ladder of the longest length for which approval has been requested. If the ladder fails one of the tests, the cause of the failure must be identified and any needed design...

  13. 46 CFR 163.003-27 - Production tests and examination.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-27 Production tests and examination. (a) General. Each ladder produced under Coast Guard approval must be tested in accordance with... Coast Guard approval number and each assembled ladder that fails testing may not be sold as Coast...

  14. 46 CFR 163.003-27 - Production tests and examination.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-27 Production tests and examination. (a) General. Each ladder produced under Coast Guard approval must be tested in accordance with... Coast Guard approval number and each assembled ladder that fails testing may not be sold as Coast...

  15. 46 CFR 163.003-9 - Approval procedure.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-9 Approval procedure. (a) General. A pilot ladder... alternatives. A pilot ladder that does not meet the materials, construction, or performance requirements of... this subpart are not appropriate for the alternative ladder configuration....

  16. 46 CFR 163.003-9 - Approval procedure.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-9 Approval procedure. (a) General. A pilot ladder... alternatives. A pilot ladder that does not meet the materials, construction, or performance requirements of... this subpart are not appropriate for the alternative ladder configuration....

  17. 28 CFR 16.3 - Requirements for making requests.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Requirements for making requests. 16.3... making requests. (a) How made and addressed. You may make a request for records of the Department of...'s World Wide Web site, and is available in paper form as well—helpful in making your request....

  18. 28 CFR 16.3 - Requirements for making requests.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 28 Judicial Administration 1 2014-07-01 2014-07-01 false Requirements for making requests. 16.3... making requests. (a) How made and addressed. You may make a request for records of the Department of...'s World Wide Web site, and is available in paper form as well—helpful in making your request....

  19. 28 CFR 16.3 - Requirements for making requests.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 28 Judicial Administration 1 2013-07-01 2013-07-01 false Requirements for making requests. 16.3... making requests. (a) How made and addressed. You may make a request for records of the Department of...'s World Wide Web site, and is available in paper form as well—helpful in making your request....

  20. 28 CFR 16.3 - Requirements for making requests.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 28 Judicial Administration 1 2011-07-01 2011-07-01 false Requirements for making requests. 16.3... making requests. (a) How made and addressed. You may make a request for records of the Department of...'s World Wide Web site, and is available in paper form as well—helpful in making your request....