Isolation of 163Ho from dysprosium target material by HPLC for neutrino mass measurements
Mocko, Veronika; Taylor, Wayne A.; Nortier, Francois M.; ...
2015-04-29
The rare earth isotope 163Ho is of interest for neutrino mass measurements. This report describes the isolation of 163Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, 163Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm –3 α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized bymore » MC-ICP-MS to determine the 163Ho/ 165Ho ratio, 163Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4E5 for Dy. As a result, the isolated Ho fraction contained 24.8 ±1.3 ng of 163Ho corresponding to holmium recovery of 72 ± 3%.« less
Isolation of 163Ho from dysprosium target material by HPLC for neutrino mass measurements
DOE Office of Scientific and Technical Information (OSTI.GOV)
Mocko, Veronika; Taylor, Wayne A.; Nortier, Francois M.
The rare earth isotope 163Ho is of interest for neutrino mass measurements. This report describes the isolation of 163Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, 163Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm –3 α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized bymore » MC-ICP-MS to determine the 163Ho/ 165Ho ratio, 163Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4E5 for Dy. As a result, the isolated Ho fraction contained 24.8 ±1.3 ng of 163Ho corresponding to holmium recovery of 72 ± 3%.« less
Limit on the temporal variation of the fine-structure constant using atomic dysprosium.
Cingöz, A; Lapierre, A; Nguyen, A-T; Leefer, N; Budker, D; Lamoreaux, S K; Torgerson, J R
2007-01-26
Over 8 months, we monitored transition frequencies between nearly degenerate, opposite-parity levels in two isotopes of atomic dysprosium (Dy). These frequencies are sensitive to variation of the fine-structure constant (alpha) due to relativistic corrections of opposite sign for the opposite-parity levels. In this unique system, in contrast to atomic-clock comparisons, the difference of the electronic energies of the opposite-parity levels can be monitored directly utilizing a rf electric-dipole transition between them. Our measurements show that the frequency variation of the 3.1-MHz transition in (163)Dy and the 235-MHz transition in (162)Dy are 9.0+/-6.7 Hz/yr and -0.6+/-6.5 Hz/yr, respectively. These results provide a rate of fractional variation of alpha of (-2.7+/-2.6) x 10(-15) yr(-1) (1 sigma) without assumptions on constancy of other fundamental constants, indicating absence of significant variation at the present level of sensitivity.
Dosimetric properties of dysprosium doped lithium borate glass irradiated by 6 MV photons
NASA Astrophysics Data System (ADS)
Ab Rasid, A.; Wagiran, H.; Hashim, S.; Ibrahim, Z.; Ali, H.
2015-07-01
Undoped and dysprosium doped lithium borate glass system with empirical formula (70-x) B2O3-30 Li2O-(x) Dy2O3 (x=0.1, 0.3, 0.5, 0.7, 1.0 mol%) were prepared using the melt-quenching technique. The dosimetric measurements were performed by irradiating the samples to 6 MV photon beam using linear accelerator (LINAC) over a dose range of 0.5-5.0 Gy. The glass series of dysprosium doped lithium borate glass produced the best thermoluminescence (TL) glow curve with the highest intensity peak from sample with 1.0 mol% Dy2O3 concentration. Minimum detectable dose was detected at 2.24 mGy, good linearity of regression coefficient, high reproducibility and high sensitivity compared to the undoped glass are from 1.0 mol% dysprosium doped lithium borate glass. The results indicated that the series of dysprosium doped lithium glasses have a great potential to be considered as a thermoluminescence dosimetry (TLD).
An electrostatic model for the determination of magnetic anisotropy in dysprosium complexes.
Chilton, Nicholas F; Collison, David; McInnes, Eric J L; Winpenny, Richard E P; Soncini, Alessandro
2013-01-01
Understanding the anisotropic electronic structure of lanthanide complexes is important in areas as diverse as magnetic resonance imaging, luminescent cell labelling and quantum computing. Here we present an intuitive strategy based on a simple electrostatic method, capable of predicting the magnetic anisotropy of dysprosium(III) complexes, even in low symmetry. The strategy relies only on knowing the X-ray structure of the complex and the well-established observation that, in the absence of high symmetry, the ground state of dysprosium(III) is a doublet quantized along the anisotropy axis with an angular momentum quantum number mJ=±(15)/2. The magnetic anisotropy axis of 14 low-symmetry monometallic dysprosium(III) complexes computed via high-level ab initio calculations are very well reproduced by our electrostatic model. Furthermore, we show that the magnetic anisotropy is equally well predicted in a selection of low-symmetry polymetallic complexes.
Dysprosium electrodeposition from a hexaalkylguanidinium-based ionic liquid
NASA Astrophysics Data System (ADS)
Berger, Claudia A.; Arkhipova, Maria; Maas, Gerhard; Jacob, Timo
2016-07-01
The rare-earth element dysprosium (Dy) is an important additive that increases the magnetocrystalline anisotropy of neodymium magnets and additionally prevents from demagnetizing at high temperatures. Therefore, it is one of the most important elements for high-tech industries and is mainly used in permanent magnetic applications, for example in electric vehicles, industrial motors and direct-drive wind turbines. In an effort to develop a more efficient electrochemical technique for depositing Dy on Nd-magnets in contrast to commonly used costly physical vapor deposition, we investigated the electrochemical behavior of dysprosium(iii) trifluoromethanesulfonate in a custom-made guanidinium-based room-temperature ionic liquid (RTIL). We first examined the electrodeposition of Dy on an Au(111) model electrode. The investigation was carried out by means of cyclic voltammetry (CV) and X-ray photoelectron spectroscopy (XPS). The initial stages of metal deposition were followed by in situ scanning tunneling microscopy (STM). CV measurements revealed a large cathodic reduction peak, which corresponds to the growth of monoatomic high islands, based on STM images taken during the initial stages of deposition. XPS identified these deposited islands as dysprosium. A similar reduction peak was also observed on an Nd-Fe-B substrate, and positively identified as deposited Dy using XPS. Finally, we varied the concentration of the Dy precursor, electrolyte flow and temperature during Dy deposition and demonstrated that each of these parameters could be used to increase the thickness of the Dy deposit, suggesting that these parameters could be tuned simultaneously in a temperature-controlled flow cell to enhance the thickness of the Dy layer.The rare-earth element dysprosium (Dy) is an important additive that increases the magnetocrystalline anisotropy of neodymium magnets and additionally prevents from demagnetizing at high temperatures. Therefore, it is one of the most important
Dysprosium electrodeposition from a hexaalkylguanidinium-based ionic liquid.
Berger, Claudia A; Arkhipova, Maria; Maas, Gerhard; Jacob, Timo
2016-08-07
The rare-earth element dysprosium (Dy) is an important additive that increases the magnetocrystalline anisotropy of neodymium magnets and additionally prevents from demagnetizing at high temperatures. Therefore, it is one of the most important elements for high-tech industries and is mainly used in permanent magnetic applications, for example in electric vehicles, industrial motors and direct-drive wind turbines. In an effort to develop a more efficient electrochemical technique for depositing Dy on Nd-magnets in contrast to commonly used costly physical vapor deposition, we investigated the electrochemical behavior of dysprosium(iii) trifluoromethanesulfonate in a custom-made guanidinium-based room-temperature ionic liquid (RTIL). We first examined the electrodeposition of Dy on an Au(111) model electrode. The investigation was carried out by means of cyclic voltammetry (CV) and X-ray photoelectron spectroscopy (XPS). The initial stages of metal deposition were followed by in situ scanning tunneling microscopy (STM). CV measurements revealed a large cathodic reduction peak, which corresponds to the growth of monoatomic high islands, based on STM images taken during the initial stages of deposition. XPS identified these deposited islands as dysprosium. A similar reduction peak was also observed on an Nd-Fe-B substrate, and positively identified as deposited Dy using XPS. Finally, we varied the concentration of the Dy precursor, electrolyte flow and temperature during Dy deposition and demonstrated that each of these parameters could be used to increase the thickness of the Dy deposit, suggesting that these parameters could be tuned simultaneously in a temperature-controlled flow cell to enhance the thickness of the Dy layer.
Relaxation dynamics of dysprosium(III) single molecule magnets.
Guo, Yun-Nan; Xu, Gong-Feng; Guo, Yang; Tang, Jinkui
2011-10-21
Over the past decade, lanthanide compounds have become of increasing interest in the field of Single Molecule Magnets (SMMs) due to the large inherent anisotropy of the metal ions. Heavy lanthanide metal systems, in particular those containing the dysprosium(III) ion, have been extensively employed to direct the formation of a series of SMMs. Although remarkable progress is being made regarding the synthesis and characterization of lanthanide-based SMMs, the understanding and control of the relaxation dynamics of strongly anisotropic systems represents a formidable challenge, since the dynamic behaviour of lanthanide-based SMMs is significantly more complex than that of transition metal systems. This perspective paper describes illustrative examples of pure dysprosium(III)-based SMMs, published during the past three years, showing new and fascinating phenomena in terms of magnetic relaxation, aiming at shedding light on the features relevant to modulating relaxation dynamics of polynuclear lanthanide SMMs. This journal is © The Royal Society of Chemistry 2011
Semiconductor composition containing iron, dysprosium, and terbium
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.
An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.
2015-01-01
by the graduate fellow’s faculty committee. C O R P O R A T I O N Dissertation Critical Rare Earths, National Security, and U.S.-China Interactions A...Portfolio Approach to Dysprosium Policy Design David L. An Dissertation Critical Rare Earths, National Security, and U.S.-China Interactions A...Permanent Magnet ................................................ xxiv Dysprosium, the Most Critical Rare Earth
Sandwich-type tetrakis(phthalocyaninato) dysprosium-cadmium quadruple-decker SMM.
Wang, Hailong; Qian, Kang; Wang, Kang; Bian, Yongzhong; Jiang, Jianzhuang; Gao, Song
2011-09-14
Homoleptic tetrakis[2,3,9,10,16,17,23,24-octa(butyloxy)phthalocyaninato] dysprosium-cadmium quadruple-decker complex 1 was isolated in relatively good yield of 43% from a simple one-pot reaction. This compound represents the first sandwich-type tetrakis(phthalocyaninato) rare earth-cadmium quadruple-decker SMM that has been structurally characterized. This journal is © The Royal Society of Chemistry 2011
Wang, Hailong; Liu, Chenxi; Liu, Tao; Zeng, Suyuan; Cao, Wei; Ma, Qi; Duan, Chunying; Dou, Jianmin; Jiang, Jianzhuang
2013-11-21
Reaction between Schiff-base ligand and half-sandwich complex M(Pc)(acac) led to the isolation of new sandwich-type mixed (phthalocyaninato)(Schiff-base) di-lanthanide compounds M2(Pc)2(L)H2O (M = Dy, Gd) (1, 2) [H2Pc = metal free phthalocyanine, Hacac = acetylacetone, H2L = N,N'-bis(3-methyloxysalicylidene)benzene-1,2-diamine] with the triple-decker molecular structure clearly revealed by single crystal X-ray diffraction analysis. For the comparative studies, sandwich triple-decker analogues with pure Schiff-base ligand M2(L)3H2O (M = Dy, Gd) (3, 4) were also prepared. Dynamic magnetic measurement result reveals the single-molecule magnet (SMM) nature of the di-dysprosium derivative 1, while the static magnetic investigation over both pure and the diamagnetic diluted samples of this compound discloses the interionic ferromagnetic coupling between the two dysprosium ions, which in turn effectively suppresses the QTM and enhances the energy barrier of this SMM. Nevertheless, comparative studies over the static magnetic properties of the di-dysprosium triple-decker complexes 1 and 3 indicate the stronger magnetic coupling between the two lanthanide ions in mixed (phthalocyaninato)(Schiff-base) species than in the pure Schiff-base triple-decker analogue, suggesting the special coordination sphere around the dysprosium ions in the former compound over the latter one on the more intense inter-ionic ferromagnetic coupling. As a very small step towards understanding the structure-property relationship, the present result will be surely helpful for the design and synthesis of the multinuclear lanthanide-based SMMs with good properties.
Resonance region measurements of dysprosium and rhenium
NASA Astrophysics Data System (ADS)
Leinweber, Gregory; Block, Robert C.; Epping, Brian E.; Barry, Devin P.; Rapp, Michael J.; Danon, Yaron; Donovan, Timothy J.; Landsberger, Sheldon; Burke, John A.; Bishop, Mary C.; Youmans, Amanda; Kim, Guinyun N.; Kang, yeong-rok; Lee, Man Woo; Drindak, Noel J.
2017-09-01
Neutron capture and transmission measurements have been performed, and resonance parameter analysis has been completed for dysprosium, Dy, and rhenium, Re. The 60 MeV electron accelerator at RPI Gaerttner LINAC Center produced neutrons in the thermal and epithermal energy regions for these measurements. Transmission measurements were made using 6Li glass scintillation detectors. The neutron capture measurements were made with a 16-segment NaI multiplicity detector. The detectors for all experiments were located at ≈25 m except for thermal transmission, which was done at ≈15 m. The dysprosium samples included one highly enriched 164Dy metal, 6 liquid solutions of enriched 164Dy, two natural Dy metals. The Re samples were natural metals. Their capture yield normalizations were corrected for their high gamma attenuation. The multi-level R-matrix Bayesian computer code SAMMY was used to extract the resonance parameters from the data. 164Dy resonance data were analyzed up to 550 eV, other Dy isotopes up to 17 eV, and Re resonance data up to 1 keV. Uncertainties due to resolution function, flight path, burst width, sample thickness, normalization, background, and zero time were estimated and propagated using SAMMY. An additional check of sample-to-sample consistency is presented as an estimate of uncertainty. The thermal total cross sections and neutron capture resonance integrals of 164Dy and Re were determined from the resonance parameters. The NJOY and INTER codes were used to process and integrate the cross sections. Plots of the data, fits, and calculations using ENDF/B-VII.1 resonance parameters are presented.
Selective recognition of dysprosium(III) ions by enhanced chemiluminescence CdSe quantum dots
NASA Astrophysics Data System (ADS)
Hosseini, Morteza; Ganjali, Mohammad R.; Vaezi, Zahra; Faridbod, Farnoush; Arabsorkhi, Batool; Sheikhha, Mohammad H.
2014-03-01
The intensity of emitted light from CdSe quantum dots (QDs)-H2O2 is described as a novel chemiluminescence (CL) reaction for determination of dysprosium. This reaction is based on the catalytic effect of Dy3+ ions, causing a significant increase in the light emission, as a result of the reaction of quantum dots (QDs) with hydrogen peroxide. In the optimum conditions, this method was satisfactorily described by linear calibration curve in the range of 8.3 × 10-7-5.0 × 10-6 M, the detection limit of 6.0 × 10-8 M, and the relative standard deviation for five determinations of 2.5 × 10-6 M Dy3+ 3.2%. The main experimental advantage of the proposed method is its selective to Dy3+ ions compared with common coexisting cations, therefore, it was successfully applied for the determination of dysprosium ions in water samples.
{Delta}I = 2 energy staggering in normal deformed dysprosium nuclei
DOE Office of Scientific and Technical Information (OSTI.GOV)
Riley, M.A.; Brown, T.B.; Archer, D.E.
1996-12-31
Very high spin states (I{ge}50{Dirac_h}) have been observed in {sup 155,156,157}Dy. The long regular band sequences, free from sharp backbending effects, observed in these dysprosium nuclei offer the possibility of investigating the occurence of any {Delta}I = 2 staggering in normal deformed nuclei. Employing the same analysis techniques as used in superdeformed nuclei, certain bands do indeed demonstrate an apparent staggering and this is discussed.
NASA Technical Reports Server (NTRS)
Flood, D. J.
1974-01-01
A measurement technique was devised which permits direct observation of the magnetic entropy of solids as a function of applied magnetic field. Measurements were made of the magnetic entropy, in the temperature range 2 to 20 K, of polycrystalline samples of dysprosium titanium oxide (Dy2Ti2O7) to determine its suitability for use as the working substance of a magnetic refrigerator. Magnetization measurements were also made at 4.2 K and below to provide additional information on the nature of the compound. The measurements indicated that crystalline electric fields perturbed the ground state of the dysprosium ions, removed the 16-fold degeneracy predicted by Hund's rules, and left only a twofold degeneracy in its place. A positive, temperature independent contribution to the magnetization was observed in the saturation region, which indicated that the doublet ground-state wave function was perturbed by a nearby unpopulated upper energy level.
25 CFR 163.15 - Advertisement of sales.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Advertisement of sales. 163.15 Section 163.15 Indians... Management and Operations § 163.15 Advertisement of sales. Except as provided in §§ 163.13, 163.14, 163.16, and 163.26 of this part, sales of forest products shall be made only after advertising. (a) The...
25 CFR 163.15 - Advertisement of sales.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Advertisement of sales. 163.15 Section 163.15 Indians... Management and Operations § 163.15 Advertisement of sales. Except as provided in §§ 163.13, 163.14, 163.16, and 163.26 of this part, sales of forest products shall be made only after advertising. (a) The...
25 CFR 163.15 - Advertisement of sales.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement of sales. 163.15 Section 163.15 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.15 Advertisement of sales. Except as provided in §§ 163.13, 163.14, 163.16, and 163.26 of this part, sales of forest...
Accurate Determination of the Dynamical Polarizability of Dysprosium
NASA Astrophysics Data System (ADS)
Ravensbergen, C.; Corre, V.; Soave, E.; Kreyer, M.; Tzanova, S.; Kirilov, E.; Grimm, R.
2018-06-01
We report a measurement of the dynamical polarizability of dysprosium atoms in their electronic ground state at the optical wavelength of 1064 nm, which is of particular interest for laser trapping experiments. Our method is based on collective oscillations in an optical dipole trap, and reaches unprecedented accuracy and precision by comparison with an alkali atom (potassium) as a reference species. We obtain values of 184.4(2.4) and 1.7(6) a.u. for the scalar and tensor polarizability, respectively. Our experiments have reached a level that permits meaningful tests of current theoretical descriptions and provides valuable information for future experiments utilizing the intriguing properties of heavy lanthanide atoms.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 12 Banks and Banking 1 2014-01-01 2014-01-01 false Advertising. 163.27 Section 163.27 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SAVINGS ASSOCIATIONS-OPERATIONS Operation and Structure § 163.27 Advertising. No Federal savings association shall use advertising (which...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 12 Banks and Banking 1 2013-01-01 2013-01-01 false Advertising. 163.27 Section 163.27 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SAVINGS ASSOCIATIONS-OPERATIONS Operation and Structure § 163.27 Advertising. No Federal savings association shall use advertising (which...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 12 Banks and Banking 1 2012-01-01 2012-01-01 false Advertising. 163.27 Section 163.27 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SAVINGS ASSOCIATIONS-OPERATIONS Operation and Structure § 163.27 Advertising. No Federal savings association shall use advertising (which...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Policy. 16.3 Section 16.3 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE ADVISORY COMMITTEE MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee only...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
46 CFR 163.002-15 - Performance.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 14 Aeronautics and Space 4 2013-01-01 2013-01-01 false Record. 406.163 Section 406.163 Aeronautics... Transportation Adjudications § 406.163 Record. (a) Exclusive record. The transcript of all testimony in the..., applications, and requests, and responses thereto; and all rulings constitute the exclusive record for decision...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Record. 406.163 Section 406.163 Aeronautics... Transportation Adjudications § 406.163 Record. (a) Exclusive record. The transcript of all testimony in the..., applications, and requests, and responses thereto; and all rulings constitute the exclusive record for decision...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 14 Aeronautics and Space 4 2012-01-01 2012-01-01 false Record. 406.163 Section 406.163 Aeronautics... Transportation Adjudications § 406.163 Record. (a) Exclusive record. The transcript of all testimony in the..., applications, and requests, and responses thereto; and all rulings constitute the exclusive record for decision...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 14 Aeronautics and Space 3 2012-01-01 2012-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
Code of Federal Regulations, 2011 CFR
2011-01-01
... 14 Aeronautics and Space 3 2011-01-01 2011-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
Code of Federal Regulations, 2014 CFR
2014-01-01
... 16 Commercial Practices 1 2014-01-01 2014-01-01 false Policy. 16.3 Section 16.3 Commercial... MANAGEMENT § 16.3 Policy. (a) The Commission's policy shall be to: (1) Establish an advisory committee only... making policy decisions and determining action to be taken with respect to any matter considered by an...
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Trespass. 163.29 Section 163.29 Indians BUREAU OF INDIAN... Operations § 163.29 Trespass. (a) Trespassers will be liable for civil penalties and damages to the enforcement agency and the beneficial Indian owners, and will be subject to prosecution for acts of trespass...
Code of Federal Regulations, 2010 CFR
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
Systematic optimization of laser cooling of dysprosium
NASA Astrophysics Data System (ADS)
Mühlbauer, Florian; Petersen, Niels; Baumgärtner, Carina; Maske, Lena; Windpassinger, Patrick
2018-06-01
We report on an apparatus for cooling and trapping of neutral dysprosium. We characterize and optimize the performance of our Zeeman slower and 2D molasses cooling of the atomic beam by means of Doppler spectroscopy on a 136 kHz broad transition at 626 nm. Furthermore, we demonstrate the characterization and optimization procedure for the loading phase of a magneto-optical trap (MOT) by increasing the effective laser linewidth by sideband modulation. After optimization of the MOT compression phase, we cool and trap up to 10^9 atoms within 3 seconds in the MOT at temperatures of 9 μK and phase space densities of 1.7 \\cdot 10^{-5}, which constitutes an ideal starting point for loading the atoms into an optical dipole trap and for subsequent forced evaporative cooling.
Making two dysprosium atoms rotate —Einstein-de Haas effect revisited
NASA Astrophysics Data System (ADS)
Górecki, Wojciech; Rzążewski, Kazimierz
2016-10-01
We present a numerical study of the behaviour of two magnetic dipolar atoms trapped in a harmonic potential and exhibiting the standard Einstein-de Haas effect while subject to a time-dependent homogeneous magnetic field. Using a simplified description of the short-range interaction and the full expression for the dipole-dipole forces we show that under experimentally realisable conditions two dysprosium atoms may be pumped to a high (l > 20) value of the relative orbital angular momentum.
Feng, Lin; Zhou, Xin; Su, Long-Xiang; Feng, Dan; Jia, Yan-Hong; Xie, Li-Xin
2012-01-01
Objective We investigated serum soluble CD163 (sCD163) levels for use in the diagnosis, severity assessment, and prognosis of sepsis in the critical ill patients and compared sCD163 with other infection-related variables. Methods During july 2010 and April 2011, serum was obtained from 102 sepsis patients (days 1, 3, 5, 7, and 10 after admission to an ICU) and 30 systemic inflammatory response syndrome (SIRS) patients with no sepsis diagnosed. Serum levels of sCD163, procalcitonon (PCT), and C reactive protein (CRP) were determined respectively. Sequential organ failure assessment (SOFA) scores for sepsis patients were also recorded. Then evaluated their roles in sepsis. Results The sCD163 levels were 0.88(0.78–1.00)ug/mL for SIRS patients, 1.50(0.92–2.00)ug/mL for moderate sepsis patients, and 2.95(2.18–5.57)ug/mL for severe sepsis patients on day1. The areas under the ROC curves for sCD163, CRP, and PCT for the diagnosis of sepsis were, respectively, 0.856(95%CI: 0.791–0.921), 0.696(95%CI: 0.595–0.797), and 0.629(95%CI: 0.495–0.763), At the recommended cut-off 1.49 ug/mL for sCD163, the sensitivity is 74.0% with 93.3% specificity. Based on 28-day survivals, sCD163 levels in the surviving group stay constant, while they tended to gradually increase in the non-surviving group.The area under the ROC curve for sCD163 for sepsis prognosis was 0.706(95%CI 0.558–0.804). Levels of sCD163 with cut-off point >2.84 ug/mL have sensitivity of 55.8.0%, specificity 80.4%.Common risk factors for death and sCD163 were included in multivariate logistic regression analysis; the odds ratios (OR) for sCD163 and SOFA scores for sepsis prognosis were 1.173 and 1.396, respectively (P<0.05). Spearman rank correlation analysis showed that sCD163 was weakly, but positively correlated with CRP, PCT, and SOFA scores (0.2< r <0.4, P<0.0001), but not with leukocyte counts (r <0.2, P = 0.450). Conclusion Serum sCD163 is superior to PCT and CRP for the diagnosis of sepsis and
NASA Astrophysics Data System (ADS)
Salama, E.; Soliman, H. A.
2018-07-01
In this paper, thermoluminescence glow curves of gamma irradiated magnesium borate glass doped with dysprosium were studied. The number of interfering peaks and in turn the number of electron trap levels are determined using the Repeated Initial Rise (RIR) method. At different heating rates (β), the glow curves were deconvoluted into two interfering peaks based on the results of RIR method. Kinetic parameters such as trap depth, kinetic order (b) and frequency factor (s) for each electron trap level is determined using the Peak Shape (PS) method. The obtained results indicated that, the magnesium borate glass doped with dysprosium has two electron trap levels with the average depth energies of 0.63 and 0.79 eV respectively. These two traps have second order kinetic and are formed at low temperature region. The obtained results due to the glow curve analysis could be used to explain some observed properties such as, high thermal fading and light sensitivity for such thermoluminescence material. In this work, systematic procedures to determine the kinetic parameters of any thermoluminescence material are successfully introduced.
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
46 CFR 163.003-13 - Construction.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Construction. 163.003-13 Section 163.003-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-13 Construction. (a) General. Each pilot ladder...
25 CFR 163.72 - Supervisory relationship.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary, Indian...
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must be...
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Strength. 163.003-17 Section 163.003-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-17 Strength. (a) Each pilot ladder must be...
25 CFR 163.72 - Supervisory relationship.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Supervisory relationship. 163.72 Section 163.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.72 Supervisory relationship. In any agreement authorized by the Secretary, Indian...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 46 Shipping 6 2012-10-01 2012-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 6 2013-10-01 2013-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
46 CFR 163.003-15 - Performance.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
Conzone, Samuel D; Brown, Roger F; Day, Delbert E; Ehrhardt, Gary J
2002-05-01
Dysprosium lithium borate (DyLB) glass microspheres were investigated for use in the radiation synovectomy treatment of rheumatoid arthritis. In vitro testing focused on weight loss and cation dissolution from glass microspheres immersed in simulated synovial fluid (SSF) at 37 degrees C for up to 64 days. In vivo testing was performed by injecting glass microspheres into the stifle joints of Sprague-Dawley rats and monitoring the biodegradability of the microspheres and the tissue response within the joints. The DyLB microspheres reacted nonuniformly in SSF with the majority of lithium and boron being dissolved, whereas nearly all of the dysprosium (>99.7%) remained in the reacted microspheres. Because the DyLB glasses released negligible amounts of dysprosium while reacting with SSF, they are considered safe for radiation synovectomy from the standpoint of unwanted radiation release from the joint capsule. Furthermore, the DyLB microspheres fragmented, degraded, and reacted with body fluids while in the joints of rats without histologic evidence of joint damage. Copyright 2002 Wiley Periodicals, Inc. J Biomed Mater Res 60: 260--268, 2002; DOI 10.1002/jbm.10047
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2012 CFR
2012-01-01
... 7 Agriculture 15 2012-01-01 2012-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 15 2011-01-01 2011-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 7 Agriculture 15 2014-01-01 2014-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2013 CFR
2013-01-01
... 7 Agriculture 15 2013-01-01 2013-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
7 CFR 3015.163 - Real property.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Real property. 3015.163 Section 3015.163 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.163 Real property. Except as stated otherwise by Federal statutes, real property applicable to this subpart shall be subject to the following...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 10 Energy 4 2011-01-01 2011-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2012 CFR
2012-01-01
... 10 Energy 4 2012-01-01 2012-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 10 Energy 4 2014-01-01 2014-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2013 CFR
2013-01-01
... 10 Energy 4 2013-01-01 2013-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163... source of information. OFE may solicit or accept submissions from third persons relevant to the complaint...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.2 - Information collection.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Information collection. 163.2 Section 163.2 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS General Provisions § 163.2 Information collection. The information collection requirements contained in 25 CFR part...
10 CFR 501.163 - OFE evaluation.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS ADMINISTRATIVE PROCEDURES AND SANCTIONS Enforcement § 501.163 OFE evaluation. (a) The record shall consist of the complaint and any supporting documents and all...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
25 CFR 163.71 - Agreement funding.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Agreement funding. 163.71 Section 163.71 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Cooperative Agreements § 163.71 Agreement funding. In cooperative agreements, the Secretary is authorized to advance or...
Code of Federal Regulations, 2011 CFR
2011-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a... requirements for label declaration of ingredients for breakfast cocoa in § 163.112, except that the cacao fat...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 32 National Defense 1 2011-07-01 2011-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 32 National Defense 1 2013-07-01 2013-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
32 CFR 16.3 - Available sentences.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 32 National Defense 1 2012-07-01 2012-07-01 false Available sentences. 16.3 Section 16.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS SENTENCING § 16.3 Available sentences. (a) General. 32 CFR part 9 permits a military commission wide latitude in sentencing...
21 CFR 163.111 - Chocolate liquor.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Chocolate liquor. 163.111 Section 163.111 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor. (a) Description. (1) Chocolate liquor is the solid or semiplastic food prepared by finely grinding...
21 CFR 163.111 - Chocolate liquor.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Chocolate liquor. 163.111 Section 163.111 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor. (a) Description. (1) Chocolate liquor is the solid or semiplastic food prepared by finely grinding...
21 CFR 163.111 - Chocolate liquor.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Chocolate liquor. 163.111 Section 163.111 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor. (a) Description. (1) Chocolate liquor is the solid or semiplastic food prepared by finely grinding...
25 CFR 163.32 - Forest development.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest development. 163.32 Section 163.32 Indians BUREAU... Management and Operations § 163.32 Forest development. Forest development pertains to forest land management... development funds will be used to re-establish, maintain, and/or improve growth of commercial timber species...
25 CFR 163.34 - Environmental compliance.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Environmental compliance. 163.34 Section 163.34 Indians... Management and Operations § 163.34 Environmental compliance. Actions taken by the Secretary under the regulations in this part must comply with the National Environmental Policy Act of 1969, applicable Council on...
50 CFR 648.163 - Gear restrictions.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Gear restrictions. 648.163 Section 648.163... Bluefish Fishery § 648.163 Gear restrictions. If the Council determines through its annual review or framework adjustment process that gear restrictions are necessary to assure that the fishing mortality rate...
25 CFR 163.81 - Assessment guidelines.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Assessment guidelines. 163.81 Section 163.81 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.81 Assessment guidelines. Assessments shall be national in scope and shall include: (a) An...
Structure of dysprosium(111) dl-tartrate dimer in aqueous solution
DOE Office of Scientific and Technical Information (OSTI.GOV)
Chevela, V.V.; Vulfson, S.G.; Salnikov, Y.I.
1994-10-01
The paramagnetic birefringence method was supplemented by numerical simulation to determine the molar paramagnetic-birefringence constant of the dysprosium dl-tartrate dimer Dy{sub 2}(d-L)(l-L){sup 2-} (I), where d-L{sup 4-} and l-L{sup 4-} are the deprotonated d- and l-tartaric acid molecules, respectively. The structure of the ligand and hydration surroundings of I was modeled by molecular mechanic calculations (the Dashevskii-Pylamovatyi model). It is shown that adequate results can be obtained only if one takes into account the coordination of I to the Na{sup +} ion.
21 CFR 163.114 - Lowfat cocoa.
Code of Federal Regulations, 2010 CFR
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a) Description. Lowfat cocoa is the food that conforms to the definition and standard of identity, and is subject... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lowfat cocoa. 163.114 Section 163.114 Food and...
25 CFR 163.21 - Bonds required.
Code of Federal Regulations, 2011 CFR
2011-04-01
... and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with all sales of forest products, except they may or may not be required, as determined by the approving officer... part in § 163.13 or in timber cutting permits issued pursuant to § 163.26 of this part. (1) In sales in...
25 CFR 163.21 - Bonds required.
Code of Federal Regulations, 2010 CFR
2010-04-01
... and Operations § 163.21 Bonds required. (a) Performance bonds will be required in connection with all sales of forest products, except they may or may not be required, as determined by the approving officer... part in § 163.13 or in timber cutting permits issued pursuant to § 163.26 of this part. (1) In sales in...
25 CFR 163.26 - Forest product harvesting permits.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest product harvesting permits. 163.26 Section 163.26... Forest Management and Operations § 163.26 Forest product harvesting permits. (a) Except as provided in §§ 163.13 and 163.27 of this part, removal of forest products that are not under formal contract...
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing...
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true [Reserved] 408.163 Section 408.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Alaskan Hand-Butchered Salmon Processing...
Code of Federal Regulations, 2011 CFR
2011-07-01
... 36 Parks, Forests, and Public Property 2 2011-07-01 2011-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
Code of Federal Regulations, 2013 CFR
2013-07-01
... 36 Parks, Forests, and Public Property 2 2013-07-01 2013-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
Code of Federal Regulations, 2014 CFR
2014-07-01
... 36 Parks, Forests, and Public Property 2 2014-07-01 2014-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
Code of Federal Regulations, 2012 CFR
2012-07-01
... 36 Parks, Forests, and Public Property 2 2012-07-01 2012-07-01 false [Reserved] 223.163 Section 223.163 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER, SPECIAL FOREST PRODUCTS, AND FOREST BOTANICAL PRODUCTS Timber...
19 CFR 191.163 - Documentation.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Documentation. 191.163 Section 191.163 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform to Sample...
19 CFR 191.163 - Documentation.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 19 Customs Duties 2 2013-04-01 2013-04-01 false Documentation. 191.163 Section 191.163 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform to Sample...
Code of Federal Regulations, 2010 CFR
2010-04-01
... summons is prima facie evidence of the facts it states. (d) Transcript of testimony under oath. Testimony... 19 Customs Duties 2 2010-04-01 2010-04-01 false Summons. 163.7 Section 163.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED...
25 CFR 163.37 - Forest management research.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the basis...
25 CFR 163.37 - Forest management research.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the basis...
25 CFR 163.37 - Forest management research.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest management research. 163.37 Section 163.37 Indians... Management and Operations § 163.37 Forest management research. The Secretary, with the consent of the authorized Indian representatives' is authorized to perform forestry research activities to improve the basis...
46 CFR 163.003-7 - Independent laboratory.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Independent laboratory. 163.003-7 Section 163.003-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval and production tests in this subpart must be conducted by or under the supervision of an independent laboratory...
46 CFR 163.003-7 - Independent laboratory.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Independent laboratory. 163.003-7 Section 163.003-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-7 Independent laboratory. The approval and production tests in this subpart must be conducted by or under the supervision of an independent laboratory...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Omar, R. S., E-mail: ratnasuffhiyanni@gmail.com; Wagiran, H., E-mail: husin@utm.my; Saeed, M. A.
Thermoluminescence (TL) dosimetric properties of dysprosium doped calcium magnesium borate (CMB:Dy) glass are presented. This study is deemed to understand the application of calcium as the modifier in magnesium borate glass with the presence of dysprosium as the activator to be performed as TL dosimeter (TLD). The study provides fundamental knowledge of a glass system that may lead to perform new TL glass dosimetry application in future research. Calcium magnesium borate glass systems of (70-y) B{sub 2}O{sub 3} − 20 CaO – 10 MgO-(y) Dy{sub 2}O{sub 3} with 0.05 mol % ≤ y ≤ 0.7 mol % of dyprosium weremore » prepared by melt-quenching technique. The amorphous structure and TL properties of the prepared samples were determined using powder X-ray diffraction (XRD) and TL reader; model Harshaw 4500 respectively. The samples were irradiated to Co-60 gamma source at a dose of 50 Gy. Dosimetric properties such as annealing procedure, time temperature profile (TTP) setting, optimization of Dy{sub 2}O{sub 3} concentration of 0.5 mol % were determined for thermoluminescence dosimeter (TLD) reader used.« less
46 CFR 163.003-3 - ASTM standard.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false ASTM standard. 163.003-3 Section 163.003-3 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-3 ASTM standard. The following standard of the American Society for Testing and Materials (ASTM) is incorporated by reference into this subpart: ASTM D...
46 CFR 163.002-7 - Independent laboratory.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent laboratory...
46 CFR 163.002-7 - Independent laboratory.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 6 2011-10-01 2011-10-01 false Independent laboratory. 163.002-7 Section 163.002-7...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-7 Independent laboratory. (a) The approval and production tests in this subpart must be conducted by, or under the supervision of, an independent laboratory...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Methods of analysis. 163.5 Section 163.5 Food and... CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in cacao products shall be determined by the following methods of analysis prescribed in “Official Methods...
25 CFR 163.25 - Forest management deductions.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest management deductions. 163.25 Section 163.25... Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions of 25 U.S.C. 413 and 25 U.S.C. 3105, a forest management deduction shall be withheld from the gross...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
21 CFR 163.5 - Methods of analysis.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Methods of analysis. 163.5 Section 163.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS General Provisions § 163.5 Methods of analysis. Shell and cacao fat content in...
25 CFR 163.25 - Forest management deductions.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest management deductions. 163.25 Section 163.25... Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions of 25 U.S.C. 413 and 25 U.S.C. 3105, a forest management deduction shall be withheld from the gross...
46 CFR 163.002-21 - Approval tests.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 6 2014-10-01 2014-10-01 false Approval tests. 163.002-21 Section 163.002-21 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-21 Approval tests. (a) General. If a pilot hoist fails one of the tests in this section the cause of the failure must be identified and any needed design...
Hu, Meizhong; Zhao, Haizhen; Zhang, Chong; Yu, Jiansheng; Lu, Zhaoxin
2013-11-27
Presumptive lactic acid bacteria (LAB) strains isolated from traditional Chinese fermented vegetables were screened for bacteriocin production. A novel bacteriocin-producing strain, Lactobacillus plantarum 163, was identified on the basis of its physiobiochemical characteristics and characterized by 16S rDNA sequencing. The novel bacteriocin, plantaricin 163, produced by Lb. plantarum 163 was purified by salt precipitation, gel filtration, and reverse-phase high-performance liquid chromatography (RP-HPLC). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis of plantaricin 163 revealed the molecular weight to be 3553.2 Da. The complete amino acid sequence showed VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK, and no similarity to known bacteriocins was found. Plantaricin 163 was highly thermostable (20 min, 121 °C), active in the presence of acidic pH (3-5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria. The results suggest that plantaricin 163 may be employed as a biopreservative in the food industry.
Shang, Hong; Zeng, Suyuan; Wang, Hailong; Dou, Jianmin; Jiang, Jianzhuang
2015-01-01
Two tetrakis(phthalocyaninato) dysprosium(III)-cadmium(II) single-molecule magnets (SMMs) with different extent of phthalocyanine peripheral substitution and therefore different coordination geometry for the Dy ions were revealed to exhibit different SMM behavior, providing an easy way to tuning and controlling the molecular structure and in turn the magnetic properties of tetrakis(tetrapyrrole) lanthanide SMMs through simple tetrapyrrole peripheral substitution. PMID:25744587
Two-species five-beam magneto-optical trap for erbium and dysprosium
NASA Astrophysics Data System (ADS)
Ilzhöfer, P.; Durastante, G.; Patscheider, A.; Trautmann, A.; Mark, M. J.; Ferlaino, F.
2018-02-01
We report on the first realization of a two-species magneto-optical trap (MOT) for the highly magnetic erbium and dysprosium atoms. The MOT operates on an intercombination line for the respective species. Owing to the narrow-line character of such a cooling transition and the action of gravity, we demonstrate a trap geometry employing only five beams in the orthogonal configuration. We observe that the mixture is cooled and trapped very efficiently, with up to 5 ×108 Er atoms and 109 Dy atoms at temperatures of about 10 μ K . Our results offer an ideal starting condition for the creation of a dipolar quantum mixture of highly magnetic atoms.
40 CFR 61.163 - Emission monitoring.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission monitoring. 61.163 Section 61.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Inorganic Arsenic...
40 CFR 61.163 - Emission monitoring.
Code of Federal Regulations, 2014 CFR
2014-07-01
....163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Inorganic Arsenic Emissions From Glass Manufacturing Plants § 61.163 Emission monitoring. (a) An owner or operator of a glass...
40 CFR 61.163 - Emission monitoring.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 8 2011-07-01 2011-07-01 false Emission monitoring. 61.163 Section 61.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Inorganic Arsenic...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2014 CFR
2014-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2013 CFR
2013-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2012 CFR
2012-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2010 CFR
2010-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
38 CFR 17.163 - Posthospital outpatient dental treatment.
Code of Federal Regulations, 2011 CFR
2011-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
46 CFR 163.002-3 - Applicable technical regulations.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Applicable technical regulations. 163.002-3 Section 163.002-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-3 Applicable technical regulations...
42 CFR 416.163 - General rules.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false General rules. 416.163 Section 416.163 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... beneficiaries by a participating ASC in connection with covered surgical procedures as determined by the...
42 CFR 416.163 - General rules.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 42 Public Health 3 2011-10-01 2011-10-01 false General rules. 416.163 Section 416.163 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... beneficiaries by a participating ASC in connection with covered surgical procedures as determined by the...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 49 Transportation 2 2013-10-01 2013-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 49 Transportation 2 2012-10-01 2012-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 49 Transportation 2 2014-10-01 2014-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
49 CFR 173.163 - Hydrogen fluoride.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 49 Transportation 2 2011-10-01 2011-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
46 CFR 163.002-27 - Production tests and examination.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 163.002-27 Section 163... examination. Each pilot hoist manufactured under Coast Guard approval must be tested as prescribed in § 163... laboratory must also conduct the visual examination described in § 163.002-21(b). The hoist may not be sold...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
14 CFR 145.163 - Training requirements.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Training requirements. 145.163 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Personnel § 145.163 Training requirements. (a) A certificated repair station must have an employee training program approved by the FAA that consists of initial...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.135 - Buttermilk chocolate.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
Emission beyond 4 μm and mid-infrared lasing in a dysprosium-doped indium fluoride (InF3) fiber.
Majewski, Matthew R; Woodward, Robert I; Carreé, Jean-Yves; Poulain, Samuel; Poulain, Marcel; Jackson, Stuart D
2018-04-15
Optical emission from rare-earth-doped fluoride fibers has thus far been limited to less than 4 μm. We extend emission beyond this limit by employing an indium fluoride (InF 3 ) glass fiber as the host, which exhibits an increased infrared transparency over commonly used zirconium fluoride (ZBLAN). Near-infrared pumping of a dysprosium-doped InF 3 fiber results in broad emission centered around 4.3 μm, representing the longest emission yet achieved from a fluoride fiber. The first laser emission in an InF 3 fiber is also demonstrated from the 3 μm dysprosium transition. Finally, a frequency domain excited state lifetime measurement comparison between fluoride hosts suggests that multiphonon effects are significantly reduced in indium fluoride fiber, paving the way to more efficient, longer wavelength lasers compared to ZBLAN fibers.
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2014-04-01 2014-04-01 false Method of tax payment. 25.163 Section 25.163 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY ALCOHOL BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
25 CFR 163.31 - Insect and disease control.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Insect and disease control. 163.31 Section 163.31 Indians... Management and Operations § 163.31 Insect and disease control. (a) The Secretary is authorized to protect and preserve Indian forest land from disease or insects (Sept. 20, 1922, Ch. 349, 42 Stat. 857). The Secretary...
32 CFR 935.163 - Unexploded ordnance material.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 32 National Defense 6 2013-07-01 2013-07-01 false Unexploded ordnance material. 935.163 Section 935.163 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND... immediately report its site to the Commander. ...
32 CFR 935.163 - Unexploded ordnance material.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 32 National Defense 6 2011-07-01 2011-07-01 false Unexploded ordnance material. 935.163 Section 935.163 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND... immediately report its site to the Commander. ...
Dysprosium complexes with mono-/di-carboxylate ligands—From simple dimers to 2D and 3D frameworks
DOE Office of Scientific and Technical Information (OSTI.GOV)
Zhang, Yingjie, E-mail: yzx@ansto.gov.au; Bhadbhade, Mohan; Scales, Nicholas
2014-11-15
Four dysprosium (Dy) single carboxylates, a formate, a propionate, a butyrate and an oxalate have been synthesized and structurally characterized. The structure of Dy(HCO{sub 2}){sub 3} (1) contains nine-fold coordinated Dy polyhedra in perfect tricapped trigonal prisms. They are linked through trigonal O atoms forming 1D pillars which are further linked together through tricapped O atoms into a 3D pillared metal organic framework. The network structure is stable up to 360 °C. The structure of [Dy{sub 2}(C{sub 2}O{sub 4}){sub 3}(H{sub 2}O){sub 6}]·2.5H{sub 2}O (2) contains nine-fold coordinated Dy polyhedra linking together through μ{sub 2}-bridging oxalate anions into a 2D hexagonalmore » layered structure. Both [Dy{sub 2}(Pr){sub 6}(H{sub 2}O){sub 4}]·(HPr){sub 0.5} (3) [Pr=(C{sub 2}H{sub 5}CO{sub 2}){sup −1}] and [Dy{sub 2}(Bu){sub 6}(H{sub 2}O){sub 4}] (4) [Bu=(C{sub 3}H{sub 7}CO{sub 2}){sup −1}] have similar di-nuclear structures. The Raman vibration modes of the complexes have been investigated. - Graphical abstract: Four dysprosium (Dy) complexes with formate, propionate, butyrate and oxalate ligands have been synthesized and characterized. The Dy formato complex has a 3D pillared metal organic framework and the structure is stable up to 360 °C whilst the complexes with longer alkyl chained mono-carboxylates possess similar di-nuclear structures. The Dy oxalato complex has a 2D hexagonal (honeycomb-type) structure. Their Raman vibration modes have been investigated. - Highlights: • New Dysprosium complexes with formate, propionate, butyrate and oxalate ligands. • Crystal structures range from dimers to two and three dimensional frameworks. • Vibrational modes have been investigated and correlated to the structures. • The complexes are thermal robust and stable to over 300 °C.« less
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Indian tribal forest enterprise operations. 163.13 Section 163.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations...
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Indian tribal forest enterprise operations. 163.13 Section 163.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations...
25 CFR 163.4 - Secretarial recognition of tribal laws.
Code of Federal Regulations, 2010 CFR
2010-04-01
... REGULATIONS General Provisions § 163.4 Secretarial recognition of tribal laws. Subject to the Secretary's trust responsibilities, and unless otherwise prohibited by Federal statutory law, the Secretary shall... 25 Indians 1 2010-04-01 2010-04-01 false Secretarial recognition of tribal laws. 163.4 Section 163...
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2010 CFR
2010-04-01
... FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations... 25 Indians 1 2010-04-01 2010-04-01 false Indian tribal forest enterprise operations. 163.13... accordance with § 163.22. However, the Secretary may issue special instructions for payment by methods other...
25 CFR 163.13 - Indian tribal forest enterprise operations.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Indian tribal forest enterprise operations. 163.13 Section 163.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.13 Indian tribal forest enterprise operations. Indian...
Theoretical study of some experimentally relevant states of dysprosium
DOE Office of Scientific and Technical Information (OSTI.GOV)
Dzuba, V. A.; Flambaum, V. V.
2010-05-15
Configuration interaction method is used to calculate transition amplitudes and other properties of the low states of dysprosium which are used in cooling and in the study of the time variation of the fine structure constant and violation of fundamental symmetries. The branching ratio for the cooling state to decay to states other than ground states is found to be smaller than 10{sup -4}. The matrix element of the weak interaction between degenerate states at E=19797.96 cm{sup -1} is about 4 Hz which is consistent with the experimental limit |H{sub W}|=|2.3{+-}2.9(stat.){+-}0.7(syst.)| Hz [A. T. Nguyen, D. Budker, D. DeMille, andmore » M. Zolotorev, Phys. Rev. A 56, 3453 (1997)] and points to feasibility of its experimental measurement. Applications include the search for physics beyond the standard model using the parity nonconservation (PNC) isotopic chain approach.« less
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
25 CFR 163.10 - Management of Indian forest land.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Management of Indian forest land. 163.10 Section 163.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
25 CFR 163.35 - Indian forest land assistance account.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Indian forest land assistance account. 163.35 Section 163.35 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.35 Indian forest land assistance account. (a) At the...
19 CFR 163.5 - Methods for storage of records.
Code of Federal Regulations, 2012 CFR
2012-04-01
... standard business practice for storage of records include, but are not limited to, machine readable data... 19 Customs Duties 2 2012-04-01 2012-04-01 false Methods for storage of records. 163.5 Section 163... THE TREASURY (CONTINUED) RECORDKEEPING § 163.5 Methods for storage of records. (a) Original records...
19 CFR 163.5 - Methods for storage of records.
Code of Federal Regulations, 2011 CFR
2011-04-01
... standard business practice for storage of records include, but are not limited to, machine readable data... 19 Customs Duties 2 2011-04-01 2011-04-01 false Methods for storage of records. 163.5 Section 163... THE TREASURY (CONTINUED) RECORDKEEPING § 163.5 Methods for storage of records. (a) Original records...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 28 Judicial Administration 1 2014-07-01 2014-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 28 Judicial Administration 1 2012-07-01 2012-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 28 Judicial Administration 1 2011-07-01 2011-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
28 CFR 35.163 - Information and signage.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 28 Judicial Administration 1 2013-07-01 2013-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
25 CFR 163.28 - Fire management measures.
Code of Federal Regulations, 2010 CFR
2010-04-01
... wildfire protection needs and extinguish forest or range fires on Indian land. No expenses for fighting a... 25 Indians 1 2010-04-01 2010-04-01 false Fire management measures. 163.28 Section 163.28 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest...
14 CFR 125.163 - Fire-extinguishing agents.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fire-extinguishing agents. 125.163 Section... Requirements § 125.163 Fire-extinguishing agents. Only methyl bromide, carbon dioxide, or another agent that... some other person using satisfactory recharging equipment. If carbon dioxide is used, it must not be...
25 CFR 163.16 - Forest product sales without advertisement.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest product sales without advertisement. 163.16 Section 163.16 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
21 CFR 163.140 - Skim milk chocolate.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
Serum soluble CD163 levels in patients with influenza-associated encephalopathy.
Hasegawa, Shunji; Matsushige, Takeshi; Inoue, Hirofumi; Takahara, Midori; Kajimoto, Madoka; Momonaka, Hiroshi; Ishida, Chiemi; Tanaka, Saya; Morishima, Tsuneo; Ichiyama, Takashi
2013-08-01
Influenza-associated encephalopathy (IE) is a serious complication during influenza viral infection. Common clinical symptoms of IE include seizures and progressive coma with high-grade fever. We previously reported that hypercytokinemia and monocyte/macrophage activation may play an important role in the pathogenesis of IE. CD163 is a scavenger receptor for hemoglobin-haptoglobin complexes and is expressed by monocytes/macrophages. Proteolytic cleavage of monocyte-bound CD163 by matrix metalloproteinases releases soluble CD163 (sCD163). However, there have been no reports regarding serum sCD163 levels in IE patients. We measured serum levels of sCD163 as a marker of monocyte/macrophage activation in IE patients with poor outcomes, those without neurological sequelae, influenza patients without IE, and control subjects. Serum sCD163 levels were significantly higher in IE patients with poor outcomes than in those without neurological sequelae. In particular, sCD163 levels in cases of death were significantly higher than those in other cases. Our results suggest that monocyte/macrophage activation is related to the pathogenesis of severe IE. Copyright © 2012 The Japanese Society of Child Neurology. Published by Elsevier B.V. All rights reserved.
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk chocolate and vegetable fat coating. 163.155 Section 163.155 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Milk chocolate and vegetable fat coating. 163.155 Section 163.155 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2012-04-01 2010-04-01 true Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2013-04-01 2013-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2011-04-01 2010-04-01 true Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
27 CFR 479.163 - Reuse of stamps prohibited.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2014-04-01 2014-04-01 false Reuse of stamps prohibited. 479.163 Section 479.163 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
7 CFR 457.163 - Nursery peak inventory endorsement.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery peak inventory endorsement. 457.163 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.163 Nursery peak inventory endorsement. Nursery Crop Insurance Peak Inventory Endorsement This endorsement is not continuous and must be...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that one or more...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that one or more...
5 CFR 550.163 - Relationship to other payments.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Relationship to other payments. 550.163 Section 550.163 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY... Relationship to other payments. (a) An employee receiving premium pay on an annual basis under § 550.141 may...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 163.145 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... ingredients for milk chocolate in § 163.130, except that: (1) The optional dairy ingredients for each of the...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
Expression of CD163 in the liver of patients with viral hepatitis.
Hiraoka, Atsushi; Horiike, Norio; Akbar, Sk Md Fazle; Michitaka, Kojiro; Matsuyama, Takami; Onji, Morikazu
2005-01-01
CD163 is a marker of activated macrophages, and increased levels of soluble CD163 have been detected in sera obtained from patients with hepatitis. The aim of this study was to detect the expression of CD163 in the liver from patients with viral hepatitis. Frozen sections of liver specimens were obtained from 5 patients with acute viral hepatitis (AH) and from 23 patients with chronic viral hepatitis (CH). The expression of CD163 in the liver was determined immunohistochemically using monoclonal antibody to human CD163. Double immunostaining was done to assess those cell types that express CD163 in the liver. The frequencies of CD163-positive cells were significantly higher both in the portal areas and in the hepatic lobules in the liver of patients with AH compared to those with CH (p < 0.05). Double immunostaining revealed that most of the CD163-positive cells were macrophages and Kupffer cells, because they expressed CD68. The expression of CD163 was very low in endothelial cells and liver stellate cells. This study shows that macrophages are activated in hepatitis liver.
Code of Federal Regulations, 2010 CFR
2010-07-01
... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT SIGNIFICANT NEW USES OF CHEMICAL SUBSTANCES Significant New Uses for Specific Chemical Substances § 721.9511 Silicic acid (H6SiO2O7), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
21 CFR 163.145 - Mixed dairy product chocolates.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
25 CFR 163.26 - Forest product harvesting permits.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Forest product harvesting permits. 163.26 Section 163.26 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS... be used by the Secretary in his or her discretion for planting or other work to offset damage to the...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 7 2012-07-01 2012-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 7 2013-07-01 2013-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 7 2014-07-01 2014-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
40 CFR 60.163 - Standard for sulfur dioxide.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 6 2011-07-01 2011-07-01 false Standard for sulfur dioxide. 60.163... Smelters § 60.163 Standard for sulfur dioxide. (a) On and after the date on which the performance test... converter any gases which contain sulfur dioxide in excess of 0.065 percent by volume, except as provided in...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 29 Labor 5 2013-07-01 2013-07-01 false Fixed extinguishing systems, water spray and foam. 1910.163 Section 1910.163 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Fire Protection Fixed Fire Suppression Equipment § 1910.163 Fixed...
Lim, Kwang Soo; Baldoví, José J; Jiang, ShangDa; Koo, Bong Ho; Kang, Dong Won; Lee, Woo Ram; Koh, Eui Kwan; Gaita-Ariño, Alejandro; Coronado, Eugenio; Slota, Michael; Bogani, Lapo; Hong, Chang Seop
2017-05-01
Controlling the coordination sphere of lanthanoid complexes is a challenging critical step toward controlling their relaxation properties. Here we present the synthesis of hexacoordinated dysprosium single-molecule magnets, where tripodal ligands achieve a near-perfect octahedral coordination. We perform a complete experimental and theoretical investigation of their magnetic properties, including a full single-crystal magnetic anisotropy analysis. The combination of electrostatic and crystal-field computational tools (SIMPRE and CONDON codes) allows us to explain the static behavior of these systems in detail.
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2013 CFR
2013-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2013-01-01 2013-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2011 CFR
2011-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2011-01-01 2011-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2012 CFR
2012-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2012-01-01 2012-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2014 CFR
2014-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2014-01-01 2014-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
10 CFR 52.163 - Administrative review of applications; hearings.
Code of Federal Regulations, 2010 CFR
2010-01-01
... constructing and/or operating the manufactured reactor or an evaluation of alternative energy sources. All... 10 Energy 2 2010-01-01 2010-01-01 false Administrative review of applications; hearings. 52.163 Section 52.163 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS, AND APPROVALS...
Poly[[[μ3-N′-(carboxymethyl)ethylenediamine-N,N,N′-triacetato]dysprosium(III)] trihydrate
Zhuang, Xiaomei; Long, Qingping; Wang, Jun
2010-01-01
In the title coordination polymer, {[Dy(C10H13N2O8)]·3H2O}n, the dysprosium(III) ion is coordinated by two N atoms and six O atoms from three different (carboxymethyl)ethylenediaminetriacetate ligands in a distorted square-antiprismatic geometry. The ligands connect the metal atoms, forming layers parallel to the ab plane. O—H⋯O hydrogen bonds further assemble adjacent layers into a three-dimensional supramolecular network. PMID:21588859
46 CFR 163.003-27 - Production tests and examination.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 163.003-27 Section 163... examination. (a) General. Each ladder produced under Coast Guard approval must be tested in accordance with... for effective monitoring throughout the production schedule. (e) Visual examination. The visual...
Magnetic ordering temperatures in rare earth metal dysprosium under ultrahigh pressures
DOE Office of Scientific and Technical Information (OSTI.GOV)
Samudrala, Gopi K.; Tsoi, Georgiy M.; Weir, Samuel T.
Magnetic ordering temperatures in heavy rare earth metal Dysprosium (Dy) have been studied using an ultrasensitive electrical transport measurement technique in a designer diamond anvil cell to extreme conditions of pressure to 69 GPa and temperature to 10 K. Previous studies using magnetic susceptibility measurements at high pressures were only able to track magnetic ordering temperature till 7 GPa in the hexagonal close packed ( hcp) phase of Dy. Our studies indicate that the magnetic ordering temperature shows an abrupt drop of 80 K at the hcp-Sm phase transition followed by a gradual decrease that continues till 17 GPa. Thismore » is followed by a rapid increase in the magnetic ordering temperatures in the double hexagonal close packed phase and finally leveling off in the distorted face centered cubic phase of Dy. Lastly, our studies reaffirm that 4f-shell remain localized in Dy and there is no loss of magnetic moment or 4f-shell delocalization for pressures up to 69 GPa.« less
Magnetic ordering temperatures in rare earth metal dysprosium under ultrahigh pressures
Samudrala, Gopi K.; Tsoi, Georgiy M.; Weir, Samuel T.; ...
2014-04-03
Magnetic ordering temperatures in heavy rare earth metal Dysprosium (Dy) have been studied using an ultrasensitive electrical transport measurement technique in a designer diamond anvil cell to extreme conditions of pressure to 69 GPa and temperature to 10 K. Previous studies using magnetic susceptibility measurements at high pressures were only able to track magnetic ordering temperature till 7 GPa in the hexagonal close packed ( hcp) phase of Dy. Our studies indicate that the magnetic ordering temperature shows an abrupt drop of 80 K at the hcp-Sm phase transition followed by a gradual decrease that continues till 17 GPa. Thismore » is followed by a rapid increase in the magnetic ordering temperatures in the double hexagonal close packed phase and finally leveling off in the distorted face centered cubic phase of Dy. Lastly, our studies reaffirm that 4f-shell remain localized in Dy and there is no loss of magnetic moment or 4f-shell delocalization for pressures up to 69 GPa.« less
CXCL4 downregulates the atheroprotective hemoglobin receptor CD163 in human macrophages.
Gleissner, Christian A; Shaked, Iftach; Erbel, Christian; Böckler, Dittmar; Katus, Hugo A; Ley, Klaus
2010-01-08
CXCL4 is a platelet-derived chemokine that promotes macrophage differentiation from monocytes. Deletion of the PF4 gene that encodes CXCL4 reduces atherosclerotic lesions in ApoE(-/-) mice. We sought to study effects of CXCL4 on macrophage differentiation with possible relevance for atherogenesis. Flow cytometry for expression of surface markers in macrophage colony-stimulating factor (M-CSF)- and CXCL4-induced macrophages demonstrated virtually complete absence of the hemoglobin scavenger receptor CD163 in CXCL4-induced macrophages. mRNA for CD163 was downregulated as early as 2 hours after CXCL4. CD163 protein reached a minimum after 3 days, which was not reversed by treatment of cells with M-CSF. The CXCL4 effect was entirely neutralized by heparin, which bound CXCL4 and prevented CXCL4 surface binding to monocytes. Pretreatment of cells with chlorate, which inhibits glycosaminoglycan synthesis, strongly inhibited CXCL4-dependent downregulation of CD163. Similar to recombinant CXCL4, releasate from human platelets also reduced CD163 expression. CXCL4-differentiated macrophages were unable to upregulate the atheroprotective enzyme heme oxygenase-1 at the RNA and protein level in response to hemoglobin-haptoglobin complexes. Immunofluorescence of human atherosclerotic plaques demonstrated presence of both CD68+CD163+ and CD68+CD163- macrophages. PF4 and CD163 gene expression within human atherosclerotic lesions were inversely correlated, supporting the in vivo relevance of CXCL4-induced downregulation of CD163. CXCL4 may promote atherogenesis by suppressing CD163 in macrophages, which are then unable to upregulate the atheroprotective enzyme heme oxygenase-1 in response to hemoglobin.
CXCL4 Downregulates the Atheroprotective Hemoglobin Receptor CD163 in Human Macrophages
Gleissner, Christian A.; Shaked, Iftach; Erbel, Christian; Böckler, Dittmar; Katus, Hugo A.; Ley, Klaus
2010-01-01
Rationale CXCL4 is a platelet-derived chemokine that promotes macrophage differentiation from monocytes. Deletion of the PF4 gene that encodes CXCL4 reduces atherosclerotic lesions in ApoE−/− mice. Objective We sought to study effects of CXCL4 on macrophage differentiation with possible relevance for atherogenesis. Methods and Results Flow cytometry for expression of surface markers in macrophage colony–stimulating factor (M-CSF)– and CXCL4-induced macrophages demonstrated virtually complete absence of the hemoglobin scavenger receptor CD163 in CXCL4-induced macrophages. mRNA for CD163 was downregulated as early as 2 hours after CXCL4. CD163 protein reached a minimum after 3 days, which was not reversed by treatment of cells with M-CSF. The CXCL4 effect was entirely neutralized by heparin, which bound CXCL4 and prevented CXCL4 surface binding to monocytes. Pretreatment of cells with chlorate, which inhibits glycosaminoglycan synthesis, strongly inhibited CXCL4-dependent downregulation of CD163. Similar to recombinant CXCL4, releasate from human platelets also reduced CD163 expression. CXCL4-differentiated macrophages were unable to upregulate the atheroprotective enzyme heme oxygenase-1 at the RNA and protein level in response to hemoglobin–haptoglobin complexes. Immunofluorescence of human atherosclerotic plaques demonstrated presence of both CD68+CD163+ and CD68+CD163− macrophages. PF4 and CD163 gene expression within human atherosclerotic lesions were inversely correlated, supporting the in vivo relevance of CXCL4-induced downregulation of CD163. Conclusions CXCL4 may promote atherogenesis by suppressing CD163 in macrophages, which are then unable to upregulate the atheroprotective enzyme heme oxygenase-1 in response to hemoglobin. PMID:19910578
21 CFR 522.163 - Betamethasone dipropionate and betamethasone sodium phosphate aqueous suspension.
Code of Federal Regulations, 2010 CFR
2010-04-01
... sodium phosphate aqueous suspension. 522.163 Section 522.163 Food and Drugs FOOD AND DRUG ADMINISTRATION... INJECTABLE DOSAGE FORM NEW ANIMAL DRUGS § 522.163 Betamethasone dipropionate and betamethasone sodium phosphate aqueous suspension. (a) Specifications. Betamethasone dipropionate and betamethasone sodium...
NASA Astrophysics Data System (ADS)
Hart, Matthew
This paper develops scenarios of future rare-earth-magnet metal (neodymium, dysprosium, terbium, and praseodymium) consumption in the permanent magnets used in wind turbines and hybrid electric vehicles. The scenarios start with naive base-case scenarios for growth in wind-turbine and hybrid-electric-vehicle sales over the period 2011 to 2020, using historical data for each good. These naive scenarios assume that future growth follows time trends in historical data and does not depend on any exogenous variable. Specifically, growth of each technological market follows historical time trends, and the amount of rare earths used per unit of technology remains fixed. The chosen reference year is 2010. Implied consumptions of the rare earth magnet metals are calculated from these scenarios. Assumptions are made for the material composition of permanent magnets, the market share of permanent-magnet wind turbines and vehicles, and magnet weight per unit of technology. Different scenarios estimate how changes in factors like the material composition of magnets, growth of the economy, and the price of a substitute could affect future consumption. Each scenario presents a different method for reducing rare earth consumption and could be interpreted as potential policy choices. In 2010, the consumption (metric tons, rare-earth-oxide equivalent) of each rare-earth-magnet metal was as follows. Total neodymium consumption in the world for both technologies was 995 tons; dysprosium consumption was 133 tons; terbium consumption was 50 tons; praseodymium consumption was zero tons. The base scenario for wind turbines shows there could be strong, exponential growth in the global wind turbine market. New U.S. sales of hybrid vehicles would decline (in line with the current economic recession) while non-U.S. sales increase through 2020. There would be an overall increase in the total amount of magnetic rare earths consumed in the world. Total consumption of each rare earth in the short
Watt-level dysprosium fiber laser at 315 μm with 73% slope efficiency
NASA Astrophysics Data System (ADS)
Woodward, R. I.; Majewski, M. R.; Bharathan, G.; Hudson, D. D.; Fuerbach, A.; Jackson, S. D.
2018-04-01
Rare-earth-doped fiber lasers are emerging as promising high-power mid-infrared sources for the 2.6-3.0 {\\mu}m and 3.3-3.8 {\\mu}m regions based on erbium and holmium ions. The intermediate wavelength range, however, remains vastly underserved, despite prospects for important manufacturing and defense applications. Here, we demonstrate the potential of dysprosium-doped fiber to solve this problem, with a simple in-band pumped grating-stabilized linear cavity generating up to 1.06 W at 3.15 {\\mu}m. A slope efficiency of 73% with respect to launched power (77% relative to absorbed power) is achieved: the highest value for any mid-infrared fiber laser to date, to the best of our knowledge. Opportunities for further power and efficiency scaling are also discussed.
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 49 Transportation 7 2014-10-01 2014-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 49 Transportation 7 2013-10-01 2013-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 49 Transportation 7 2012-10-01 2012-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
49 CFR 572.163 - Neck assembly and test procedure.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 49 Transportation 7 2011-10-01 2011-10-01 false Neck assembly and test procedure. 572.163 Section... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.163 Neck assembly and test procedure. The neck assembly is assembled and tested as specified in 49 CFR 572.123 (Subpart N). ...
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Silicic acid (H6SiO2O7), magnesium...), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as silicic acid (H6SiO2O7) magnesium...
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Silicic acid (H6SiO2O7), magnesium...), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as silicic acid (H6SiO2O7) magnesium...
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Silicic acid (H6SiO2O7), magnesium...), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as silicic acid (H6SiO2O7) magnesium...
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Silicic acid (H6SiO2O7), magnesium...), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as silicic acid (H6SiO2O7) magnesium...
26 CFR 1.163-9T - Personal interest (temporary).
Code of Federal Regulations, 2010 CFR
2010-04-01
... computing income or loss from a passive activity of the taxpayer, (iv) Any qualified residence interest (within the meaning of section 163(h)(3) and § 1.163-10T), and (v) Any interest payable under section 6601...-10T for rules concerning qualified residence interest. (c) Effective date—(1) In general. The...
Analysis of soft x-ray emission spectra of laser-produced dysprosium, erbium and thulium plasmas
NASA Astrophysics Data System (ADS)
Sheil, John; Dunne, Padraig; Higashiguchi, Takeshi; Kos, Domagoj; Long, Elaine; Miyazaki, Takanori; O'Reilly, Fergal; O'Sullivan, Gerard; Sheridan, Paul; Suzuki, Chihiro; Sokell, Emma; White, Elgiva; Kilbane, Deirdre
2017-03-01
Soft x-ray emission spectra of dysprosium, erbium and thulium ions created in laser-produced plasmas were recorded with a flat-field grazing-incidence spectrometer in the 2.5-8 nm spectral range. The ions were produced using an Nd:YAG laser of 7 ns pulse duration and the spectra were recorded at various power densities. The experimental spectra were interpreted with the aid of the Cowan suite of atomic structure codes and the flexible atomic code. At wavelengths above 5.5 nm the spectra are dominated by overlapping n = 4 - n = 4 unresolved transition arrays from adjacent ion stages. Below 6 nm, n = 4 - n = 5 transitions also give rise to a series of interesting overlapping spectral features.
49 CFR 37.163 - Keeping vehicle lifts in operative condition: Public entities.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 49 Transportation 1 2014-10-01 2014-10-01 false Keeping vehicle lifts in operative condition: Public entities. 37.163 Section 37.163 Transportation Office of the Secretary of Transportation TRANSPORTATION SERVICES FOR INDIVIDUALS WITH DISABILITIES (ADA) Provision of Service § 37.163 Keeping vehicle lifts in operative condition: Public entities. ...
49 CFR 37.163 - Keeping vehicle lifts in operative condition: Public entities.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 49 Transportation 1 2013-10-01 2013-10-01 false Keeping vehicle lifts in operative condition: Public entities. 37.163 Section 37.163 Transportation Office of the Secretary of Transportation TRANSPORTATION SERVICES FOR INDIVIDUALS WITH DISABILITIES (ADA) Provision of Service § 37.163 Keeping vehicle lifts in operative condition: Public entities. ...
21 CFR 163.114 - Lowfat cocoa.
Code of Federal Regulations, 2011 CFR
2011-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a... that the cacao fat content is less than 10 percent by weight, as determined by the method prescribed in...
Code of Federal Regulations, 2013 CFR
2013-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2011 CFR
2011-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2014 CFR
2014-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2012 CFR
2012-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
Code of Federal Regulations, 2010 CFR
2010-04-01
..., AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.163 Clorsulon. (a) Acceptable daily intake (ADI). The ADI for total...) Kidney (the target tissue). The tolerance for parent clorsulon (the marker residue) is 1.0 part per...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Annual funding needs assessment and rating. 163.62... FORESTRY REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 25 Indians 1 2013-04-01 2013-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 25 Indians 1 2014-04-01 2014-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 25 Indians 1 2011-04-01 2011-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2011 CFR
2011-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2011-04-01 2011-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2014 CFR
2014-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2014-04-01 2014-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2013 CFR
2013-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2013-04-01 2013-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2012 CFR
2012-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2012-04-01 2011-04-01 true How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 170.163 - How are Indian LTAP recipients selected?
Code of Federal Regulations, 2010 CFR
2010-04-01
... applicants and recommends award recipients. FHWA selects and notifies award recipients consistent with... 25 Indians 1 2010-04-01 2010-04-01 false How are Indian LTAP recipients selected? 170.163 Section... Program § 170.163 How are Indian LTAP recipients selected? (a) FHWA announces Indian LTAP grant...
25 CFR 163.62 - Annual funding needs assessment and rating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 25 Indians 1 2012-04-01 2011-04-01 true Annual funding needs assessment and rating. 163.62 Section... REGULATIONS Alaska Native Technical Assistance Program § 163.62 Annual funding needs assessment and rating. (a) Each year, the Secretary will request a technical assistance project needs assessment from ANCSA...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... specified dairy ingredient. (b) Optional ingredients. (1) Safe and suitable vegetable derived fats, oils...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... specified dairy ingredient. (b) Optional ingredients. (1) Safe and suitable vegetable derived fats, oils...
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... specified dairy ingredient. (b) Optional ingredients. (1) Safe and suitable vegetable derived fats, oils...
Code of Federal Regulations, 2010 CFR
2010-01-01
... PROCEDURES FOR PRODUCTS AND PARTS Production Certificates § 21.163 Privileges. (a) The holder of a production... Administrator may inspect the aircraft for conformity with the type design; or (2) In the case of other products... § 147.3 of this chapter, the holder of a production certificate for a primary category aircraft, or for...
Soluble CD163 is increased in patients with acute pancreatitis independent of disease severity.
Karrasch, Thomas; Brünnler, Tanja; Hamer, Okka W; Schmid, Karin; Voelk, Markus; Herfarth, Hans; Buechler, Christa
2015-10-01
Macrophages are crucially involved in the pathophysiology of acute pancreatitis. Soluble CD163 (sCD163) is specifically released from macrophages and systemic levels are increased in inflammatory diseases. Here, sCD163 was measured in serum of 50 patients with acute pancreatitis to find out possible associations with disease activity. Admission levels of systemic sCD163 were nearly three-fold higher in patients with acute pancreatitis compared to controls. In patients sCD163 did not correlate with C-reactive protein and leukocyte count as established markers of inflammation. Levels were not associated with disease severity assessed by the Schroeder score, Balthazar score, Acute Physiology, Age, and Chronic Health Evaluation (Apache) II score and peripancreatic necrosis score. Soluble CD163 was not related to complications of acute pancreatitis. These data show that serum sCD163 is increased in acute pancreatitis indicating activation of macrophages but is not associated with disease severity and outcome. Copyright © 2015 Elsevier Inc. All rights reserved.
Page, R.H.; Schaffers, K.I.; Payne, S.A.; Krupke, W.F.; Beach, R.J.
1997-12-02
Dysprosium-doped metal chloride materials offer laser properties advantageous for use as optical amplifiers in the 1.3 {micro}m telecommunications fiber optic network. The upper laser level is characterized by a millisecond lifetime, the host material possesses a moderately low refractive index, and the gain peak occurs near 1.31 {micro}m. Related halide materials, including bromides and iodides, are also useful. The Dy{sup 3+}-doped metal chlorides can be pumped with laser diodes and yield 1.3 {micro}m signal gain levels significantly beyond those currently available. 9 figs.
Page, Ralph H.; Schaffers, Kathleen I.; Payne, Stephen A.; Krupke, William F.; Beach, Raymond J.
1997-01-01
Dysprosium-doped metal chloride materials offer laser properties advantageous for use as optical amplifiers in the 1.3 .mu.m telecommunications fiber optic network. The upper laser level is characterized by a millisecond lifetime, the host material possesses a moderately low refractive index, and the gain peak occurs near 1.31 .mu.m. Related halide materials, including bromides and iodides, are also useful. The Dy.sup.3+ -doped metal chlorides can be pumped with laser diodes and yield 1.3 .mu.m signal gain levels significantly beyond those currently available.
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Milk chocolate and vegetable fat coating. 163.155... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...) Safe and suitable vegetable derived oils, fats, and stearins other than cacao fat. The oils, fats, and...
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Milk chocolate and vegetable fat coating. 163.155... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...) Safe and suitable vegetable derived oils, fats, and stearins other than cacao fat. The oils, fats, and...
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Milk chocolate and vegetable fat coating. 163.155... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat...) Safe and suitable vegetable derived oils, fats, and stearins other than cacao fat. The oils, fats, and...
NASA Astrophysics Data System (ADS)
Eliseev, S.; Blaum, K.; Block, M.; Chenmarev, S.; Dorrer, H.; Düllmann, Ch. E.; Enss, C.; Filianin, P. E.; Gastaldo, L.; Goncharov, M.; Köster, U.; Lautenschläger, F.; Novikov, Yu. N.; Rischka, A.; Schüssler, R. X.; Schweikhard, L.; Türler, A.
2015-08-01
The atomic mass difference of 163 and 163Dy has been directly measured with the Penning-trap mass spectrometer SHIPTRAP applying the novel phase-imaging ion-cyclotron-resonance technique. Our measurement has solved the long-standing problem of large discrepancies in the Q value of the electron capture in 163Ho determined by different techniques. Our measured mass difference shifts the current Q value of 2555(16) eV evaluated in the Atomic Mass Evaluation 2012 [G. Audi et al., Chin. Phys. C 36, 1157 (2012)] by more than 7 σ to 2833 (30stat)(15sys) eV /c2 . With the new mass difference it will be possible, e.g., to reach in the first phase of the ECHo experiment a statistical sensitivity to the neutrino mass below 10 eV, which will reduce its present upper limit by more than an order of magnitude.
46 CFR 163.003-11 - Materials.
Code of Federal Regulations, 2010 CFR
2010-10-01
... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each... defects affecting its strength or durability. (c) Wood preservative. After each wooden part is formed and...
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 2 2012-04-01 2012-04-01 false Sweet cocoa and vegetable fat coating. 163.150... § 163.150 Sweet cocoa and vegetable fat coating. (a) Description. Sweet cocoa and vegetable fat coating...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 2 2013-04-01 2013-04-01 false Sweet cocoa and vegetable fat coating. 163.150... § 163.150 Sweet cocoa and vegetable fat coating. (a) Description. Sweet cocoa and vegetable fat coating...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 2 2014-04-01 2014-04-01 false Sweet cocoa and vegetable fat coating. 163.150... § 163.150 Sweet cocoa and vegetable fat coating. (a) Description. Sweet cocoa and vegetable fat coating...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
20 CFR 655.163 - Certification fee.
Code of Federal Regulations, 2011 CFR
2011-04-01
... Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF FOREIGN WORKERS IN THE UNITED STATES Labor Certification Process for Temporary Agricultural Employment in the United States (H-2A Workers) Labor Certification Determinations § 655.163 Certification fee. A...
25 CFR 163.12 - Harvesting restrictions.
Code of Federal Regulations, 2014 CFR
2014-04-01
... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.12 Harvesting restrictions. (a) Harvesting timber on commercial forest land will not be permitted unless provisions for natural and/or artificial reforestation of acceptable tree...
Moeller, Jesper B; Nielsen, Marianne J; Reichhardt, Martin P; Schlosser, Anders; Sorensen, Grith L; Nielsen, Ole; Tornøe, Ida; Grønlund, Jørn; Nielsen, Maria E; Jørgensen, Jan S; Jensen, Ole N; Mollenhauer, Jan; Moestrup, Søren K; Holmskov, Uffe
2012-03-01
CD163-L1 belongs to the group B scavenger receptor cysteine-rich family of proteins, where the CD163-L1 gene arose by duplication of the gene encoding the hemoglobin scavenger receptor CD163 in late evolution. The current data demonstrate that CD163-L1 is highly expressed and colocalizes with CD163 on large subsets of macrophages, but in contrast to CD163 the expression is low or absent in monocytes and in alveolar macrophages, glia, and Kupffer cells. The expression of CD163-L1 increases when cultured monocytes are M-CSF stimulated to macrophages, and the expression is further increased by the acute-phase mediator IL-6 and the anti-inflammatory mediator IL-10 but is suppressed by the proinflammatory mediators IL-4, IL-13, TNF-α, and LPS/IFN-γ. Furthermore, we show that CD163-L1 is an endocytic receptor, which internalizes independently of cross-linking through a clathrin-mediated pathway. Two cytoplasmic splice variants of CD163-L1 are differentially expressed and have different subcellular distribution patterns. Despite its many similarities to CD163, CD163-L1 does not possess measurable affinity for CD163 ligands such as the haptoglobin-hemoglobin complex or various bacteria. In conclusion, CD163-L1 exhibits similarity to CD163 in terms of structure and regulated expression in cultured monocytes but shows clear differences compared with the known CD163 ligand preferences and expression pattern in the pool of tissue macrophages. We postulate that CD163-L1 functions as a scavenger receptor for one or several ligands that might have a role in resolution of inflammation.
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 2 2011-04-01 2011-04-01 false Cocoa with dioctyl sodium sulfosuccinate for manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2010 CFR
2010-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
25 CFR 163.40 - Indian and Alaska Native forestry education assistance.
Code of Federal Regulations, 2010 CFR
2010-04-01
.... 163.40 Section 163.40 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER..., professional Indians and Alaska Natives in the management of Indian and Alaska Native forest land. In keeping... forestry-related field which could include courses on indigenous culture; and (iii) To create an...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2012 CFR
2012-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2013 CFR
2013-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
Code of Federal Regulations, 2014 CFR
2014-04-01
...) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying with.... The name of the food additive is “cocoa with dioctyl sodium sulfosuccinate for manufacturing” to which... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...
Chow, Hiu Tung; Ng, Danny W-K
2017-04-12
Small RNAs are important regulators for a variety of biological processes, including leaf development, flowering-time, embryogenesis and defense responses. miR163 is a non-conserved miRNA and its locus has evolved recently through inverted duplication of its target genes to which they belong to the SABATH family of related small-molecule methyltransferases (MTs). In Arabidopsis thaliana, previous study demonstrated that miR163 accumulation was induced by alamethicin treatment, suggesting its roles in defense response pathways. Enhanced resistance against Pseudomonas syringae pv. tomato (Pst) was observed in the mir163 mutant, whereas transgenic lines overexpressing miR163 showed increase sensitivity to Pst, suggesting that miR163 is a negative regulator of defense response. Elevated level of miR163 and its targets in A. thaliana were observed upon Pst treatment, suggesting a modulating relationship between miR163 and its targets. In addition, miR163 and histone deacetylase were found to act cooperatively in mediating defense against Pst. Transgenic plants overexpressing miR163-resistant targets suggested their different contributions in defense. Results from this study revealed that the stress-inducible miR163 and its targets act in concert to modulate defense responses against bacterial pathogen in A. thaliana.
Optical properties of zinc borotellurite glass doped with trivalent dysprosium ion
NASA Astrophysics Data System (ADS)
Ami Hazlin, M. N.; Halimah, M. K.; Muhammad, F. D.; Faznny, M. F.
2017-04-01
The zinc borotellurite doped with dysprosium oxide glass samples with chemical formula {[(TeO2) 0 . 7(B2O3) 0 . 3 ] 0 . 7(ZnO) 0 . 3 } 1 - x(Dy2O3)x (where x=0.01, 0.02, 0.03, 0.04 and 0.05 M fraction) were prepared by using conventional melt quenching technique. The structural and optical properties of the proposed glass systems were characterized by using X-ray diffraction (XRD) spectroscopy, Fourier Transform Infrared (FTIR) spectroscopy, and UV-VIS spectroscopy. The amorphous nature of the glass systems is confirmed by using XRD technique. The infrared spectra of the glass systems indicate three obvious absorption bands which are assigned to BO3 and TeO4 vibrational groups. Based on the absorption spectra obtained, the direct and indirect optical band gaps, as well as the Urbach energy were calculated. It is observed that both the direct and indirect optical band gaps increase with the concentration of Dy3+ ions. On the other hand, the Urbach energy is observed to decrease as the concentration of Dy3+ ions increases.
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 10 Energy 1 2014-01-01 2014-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 10 Energy 1 2011-01-01 2011-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2013 CFR
2013-01-01
... 10 Energy 1 2013-01-01 2013-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
Code of Federal Regulations, 2012 CFR
2012-01-01
... 10 Energy 1 2012-01-01 2012-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a) Initial drug testing. (1) HHS-certified laboratories shall apply the following cutoff levels for initial...
NASA Astrophysics Data System (ADS)
Gastaldo, L.; Ranitzsch, P. C.-O.; von Seggern, F.; Porst, J.-P.; Schäfer, S.; Pies, C.; Kempf, S.; Wolf, T.; Fleischmann, A.; Enss, C.; Herlert, A.; Johnston, K.
2013-05-01
For the first time we have investigated the behavior of fully micro-fabricated low temperature metallic magnetic calorimeters (MMCs) after undergoing an ion-implantation process. This experiment had the aim to show the possibility to perform a high precision calorimetric measurement of the energy spectrum following the electron capture of 163Ho using MMCs having the radioactive 163Ho ions implanted in the absorber. The isotope 163Ho decays through electron capture to 163Dy and features the smallest known QEC value. This peculiarity makes 163Ho a very interesting candidate to investigate the value of the electron neutrino mass by the analysis of the energy spectrum. The implantation of 163Ho ions was performed at ISOLDE-CERN. The performance of a detector that underwent an ion-implantation process is compared to the one of a detector without implanted ions. The results show that the implantation dose of ions used in this experiment does not compromise the properties of the detector. Moreover the performance of the detector prototype having the 163Ho ions implanted in the absorber is already close to the requirements needed for an experiment with sub-eV sensitivity to the electron neutrino mass. Based on these results, an optimized detector design for future 163Ho experiments is presented.
Polfliet, Machteld M J; Fabriek, Babs O; Daniëls, Wouter P; Dijkstra, Christine D; van den Berg, Timo K
2006-01-01
The monoclonal antibody ED2 is widely used to define macrophages (mphi) in the rat. We have recently identified the ED2 antigen as the rat CD163 glycoprotein. CD163 is a member of the scavenger receptor cysteine-rich group B (SRCR-B) family and functions as a scavenger receptor for hemoglobin-haptoglobin complexes. Moreover, CD163 has also been indicated as a marker for alternatively activated mphi. In the current study, we identify rat CD163/ED2-antigen as a marker for mature tissue mphi. Rat CD163 is constitutively expressed on most subpopulations of mature tissue mphi, including splenic red pulp mphi, thymic cortical mphi, Kupffer cells in the liver, resident bone marrow mphi and central nervous system perivascular and meningeal mphi, but is apparently absent from monocytes. Rat CD163 expression can be promoted by glucocorticoids, and this can be further enhanced by IL4. Finally, engagement of rat CD163 on peritoneal mphi induces the production of pro-inflammatory mediators, including NO, IL-1beta, IL-6 and TNF-alpha. Collectively, our findings identify rat CD163 as a broadly expressed macrophage scavenger receptor that may play a role in the activation of mphi during hemolytic and/or inflammatory conditions.
25 CFR 163.19 - Contracts for the sale of forest products.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Contracts for the sale of forest products. 163.19 Section... REGULATIONS Forest Management and Operations § 163.19 Contracts for the sale of forest products. (a) In sales of forest products with an appraised stumpage value exceeding $15,000, the contract forms approved by...
Development of Holmium-163 electron-capture spectroscopy with transition-edge sensors
Croce, Mark Philip; Rabin, Michael W.; Mocko, Veronika; ...
2016-08-01
Calorimetric decay energy spectroscopy of electron-capture-decaying isotopes is a promising method to achieve the sensitivity required for electron neutrino mass measurement. The very low total nuclear decay energy (Q EC < 3 keV) and short half-life (4570 years) of 163Ho make it attractive for high-precision electron-capture spectroscopy (ECS) near the kinematic endpoint, where the neutrino momentum goes to zero. In the ECS approach, an electron-capture-decaying isotope is embedded inside a microcalorimeter designed to capture and measure the energy of all the decay radiation except that of the escaping neutrino. We have developed a complete process for proton irradiation-based isotope production,more » isolation, and purification of 163Ho. We have developed transition-edge sensors for this measurement and methods for incorporating 163Ho into high-resolution microcalorimeters, and have measured the electron-capture spectrum of 163Ho. Finally, we present our work in these areas and discuss the measured spectrum and its comparison to current theory.« less
Development of Holmium-163 electron-capture spectroscopy with transition-edge sensors
DOE Office of Scientific and Technical Information (OSTI.GOV)
Croce, Mark Philip; Rabin, Michael W.; Mocko, Veronika
Calorimetric decay energy spectroscopy of electron-capture-decaying isotopes is a promising method to achieve the sensitivity required for electron neutrino mass measurement. The very low total nuclear decay energy (Q EC < 3 keV) and short half-life (4570 years) of 163Ho make it attractive for high-precision electron-capture spectroscopy (ECS) near the kinematic endpoint, where the neutrino momentum goes to zero. In the ECS approach, an electron-capture-decaying isotope is embedded inside a microcalorimeter designed to capture and measure the energy of all the decay radiation except that of the escaping neutrino. We have developed a complete process for proton irradiation-based isotope production,more » isolation, and purification of 163Ho. We have developed transition-edge sensors for this measurement and methods for incorporating 163Ho into high-resolution microcalorimeters, and have measured the electron-capture spectrum of 163Ho. Finally, we present our work in these areas and discuss the measured spectrum and its comparison to current theory.« less
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2011 CFR
2011-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2012 CFR
2012-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2013 CFR
2013-04-01
..., DEPARTMENT OF THE TREASURY ALCOHOL LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2010 CFR
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
27 CFR 26.163 - General requirements.
Code of Federal Regulations, 2014 CFR
2014-04-01
..., DEPARTMENT OF THE TREASURY ALCOHOL LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Records and Reports of Liquors From Puerto Rico § 26.163 General requirements. Except as provided in § 26.164, every person, other than a tourist, bringing liquor into the United States from Puerto Rico shall keep records...
26 CFR 1.163-11T - Allocation of certain prepaid qualified mortgage insurance premiums (temporary).
Code of Federal Regulations, 2010 CFR
2010-04-01
... insurance premiums (temporary). 1.163-11T Section 1.163-11T Internal Revenue INTERNAL REVENUE SERVICE... insurance premiums (temporary). (a) Allocation—(1) In general. As provided in section 163(h)(3)(E), premiums... section applies whether the qualified mortgage insurance premiums are paid in cash or are financed...
26 CFR 1.163-11T - Allocation of certain prepaid qualified mortgage insurance premiums (temporary).
Code of Federal Regulations, 2011 CFR
2011-04-01
... insurance premiums (temporary). 1.163-11T Section 1.163-11T Internal Revenue INTERNAL REVENUE SERVICE... insurance premiums (temporary). (a) Allocation—(1) In general. As provided in section 163(h)(3)(E), premiums... section applies whether the qualified mortgage insurance premiums are paid in cash or are financed...
New limits on variation of the fine-structure constant using atomic dysprosium.
Leefer, N; Weber, C T M; Cingöz, A; Torgerson, J R; Budker, D
2013-08-09
We report on the spectroscopy of radio-frequency transitions between nearly degenerate, opposite-parity excited states in atomic dysprosium (Dy). Theoretical calculations predict that these states are very sensitive to variation of the fine-structure constant α owing to large relativistic corrections of opposite sign for the opposite-parity levels. The near degeneracy reduces the relative precision necessary to place constraints on variation of α, competitive with results obtained from the best atomic clocks in the world. Additionally, the existence of several abundant isotopes of Dy allows isotopic comparisons that suppress common-mode systematic errors. The frequencies of the 754-MHz transition in 164Dy and 235-MHz transition in 162Dy are measured over the span of two years. The linear variation of α is α·/α=(-5.8±6.9([1σ]))×10(-17) yr(-1), consistent with zero. The same data are used to constrain the dimensionless parameter kα characterizing a possible coupling of α to a changing gravitational potential. We find that kα=(-5.5±5.2([1σ]))×10(-7), essentially consistent with zero and the best constraint to date.
Mhareb, M H A; Hashim, S; Ghoshal, S K; Alajerami, Y S M; Saleh, M A; Razak, N A B; Azizan, S A B
2015-12-01
We report the impact of dysprosium (Dy(3+)) dopant and magnesium oxide (MgO) modifier on the thermoluminescent properties of lithium borate (LB) glass via two procedures. The thermoluminescence (TL) glow curves reveal a single prominent peak at 190 °C for 0.5 mol% of Dy(3+). An increase in MgO contents by 10 mol% enhances the TL intensity by a factor of 1.5 times without causing any shift in the maximum temperature. This enhancement is attributed to the occurrence of extra electron traps created via magnesium and the energy transfer to trivalent Dy(3+) ions. Good linearity in the range of 0.01-4 Gy with a linear correlation coefficient of 0.998, fading as low as 21% over a period of 3 months, excellent reproducibility without oven annealing and tissue equivalent effective atomic numbers ~8.71 are achieved. The trap parameters, including geometric factor (μg), activation energy (E) and frequency factor (s) associated with LMB:Dy are also determined. These favorable TL characteristics of prepared glasses may contribute towards the development of Li2O-MgO-B2O3 radiation dosimeters. Copyright © 2015 John Wiley & Sons, Ltd.
Plasma Soluble CD163 Level Independently Predicts All-Cause Mortality in HIV-1-Infected Individuals.
Knudsen, Troels Bygum; Ertner, Gideon; Petersen, Janne; Møller, Holger Jon; Moestrup, Søren K; Eugen-Olsen, Jesper; Kronborg, Gitte; Benfield, Thomas
2016-10-15
CD163, a monocyte- and macrophage-specific scavenger receptor, is shed as soluble CD163 (sCD163) during the proinflammatory response. Here, we assessed the association between plasma sCD163 levels and progression to AIDS and all-cause mortality among individuals infected with human immunodeficiency virus type 1 (HIV). Plasma sCD163 levels were measured in 933 HIV-infected individuals. Hazard ratios (HRs) with 95% confidence intervals (CIs) associated with mortality were computed by Cox proportional hazards regression. At baseline, 86% were receiving antiretroviral treatment, 73% had plasma a HIV RNA level of <50 copies/mL, and the median CD4(+) T-cell count was 503 cells/µL. During 10.5 years of follow-up, 167 (17.9%) died. Plasma sCD163 levels were higher in nonsurvivors than in survivors (4.92 mg/L [interquartile range {IQR}, 3.29-8.65 mg/L] vs 3.16 mg/L [IQR, 2.16-4.64 mg/L]; P = .0001). The cumulative incidence of death increased with increasing plasma sCD163 levels, corresponding to a 6% or 35% increased risk of death for each milligram per liter or quartile increase, respectively, in baseline plasma sCD163 level (adjusted HR, 1.06 [95% CI, 1.03-1.09] and 1.35 [95% CI, 1.13-1.63], respectively). Plasma sCD163 was an independent marker of all-cause mortality in a cohort of HIV-infected individuals, suggesting that monocyte/macrophage activation may play a role in HIV pathogenesis and be a target of intervention. © The Author 2016. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.
Bernot, Kevin; Luzon, Javier; Bogani, Lapo; Etienne, Mael; Sangregorio, Claudio; Shanmugam, Muralidharan; Caneschi, Andrea; Sessoli, Roberta; Gatteschi, Dante
2009-04-22
A mixed theoretical and experimental approach was used to determine the local magnetic anisotropy of the dysprosium(III) ion in a low-symmetry environment. The susceptibility tensor of the monomeric species having the formula [Dy(hfac)(3)(NIT-C(6)H(4)-OEt)(2)], which contains nitronyl nitroxide (NIT-R) radicals, was determined at various temperatures through angle-resolved magnetometry. These results are in agreement with ab initio calculations performed using the complete active space self-consistent field (CASSCF) method, validating the predictive power of this theoretical approach for complex systems containing rare-earth ions, even in low-symmetry environments. Susceptibility measurements performed with the applied field along the easy axis eventually permitted a detailed analysis of the temperature and field dependence of the magnetization, providing evidence that the Dy ion transmits an antiferromagnetic interaction between radicals but that the Dy-radical interaction is ferromagnetic.
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2014 CFR
2014-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2011 CFR
2011-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2013 CFR
2013-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
40 CFR 98.163 - Calculating GHG emissions.
Code of Federal Regulations, 2012 CFR
2012-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You must calculate and report the annual CO2 emissions from each hydrogen production process unit using the... associated with each fuel and feedstock used for hydrogen production by following paragraphs (b)(1) through...
Publications - GMC 163 | Alaska Division of Geological & Geophysical
DGGS GMC 163 Publication Details Title: Gas chromatograms from the following 7 North Slope wells Reference Unocal Geochemistry Group, 1990, Gas chromatograms from the following 7 North Slope wells: Aufeis
27 CFR 22.163 - Time for making entries.
Code of Federal Regulations, 2010 CFR
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Records of Transactions § 22.163..., the daily posting of records may be deferred to conform to the permittee's normal accounting cycle if...
Park, Hyun Ji; Lee, Sang Sook; You, Young Nim; Yoon, Dae Hwa; Kim, Beom-Gi; Ahn, Jun Cheul; Cho, Hye Sun
2013-01-01
The putative thylakoid lumen immunophilin, FKBP16-3, has not yet been characterized, although this protein is known to be regulated by thioredoxin and possesses a well-conserved CxxxC motif in photosynthetic organisms. Here, we characterized rice OsFKBP16-3 and examined the role of this gene in the regulation of abiotic stress in plants. FKBP16-3s are well conserved in eukaryotic photosynthetic organisms, including the presence of a unique disulfide-forming CxxxC motif in their N-terminal regions. OsFKBP16-3 was mainly expressed in rice leaf tissues and was upregulated by various abiotic stresses, including salt, drought, high light, hydrogen peroxide, heat and methyl viologen. The chloroplast localization of OsFKBP16-3-GFP was confirmed through the transient expression of OsFKBP16-3 in Nicotiana benthamiana leaves. Transgenic Arabidopsis and transgenic rice plants that constitutively expressed OsFKBP16-3 exhibited increased tolerance to salinity, drought and oxidative stresses, but showed no change in growth or phenotype, compared with vector control plants, when grown under non-stressed conditions. This is the first report to demonstrate the potential role of FKBP16-3 in the environmental stress response, which may be regulated by a redox relay process in the thylakoid lumen, suggesting that artificial regulation of FKBP16-3 expression is a candidate for stress-tolerant crop breeding. PMID:23485991
Bryant, Alex K; Moore, David J; Burdo, Tricia H; Lakritz, Jessica R; Gouaux, Ben; Soontornniyomkij, Virawudh; Achim, Cristian L; Masliah, Eliezer; Grant, Igor; Levine, Andrew J; Ellis, Ronald J
2017-04-24
Higher plasma soluble cluster of differentiation (CD)163 (sCD163), shed by monocytes and macrophages, correlates with neurocognitive impairment in HIV infection. We hypothesized that higher antemortem plasma or cerebrospinal fluid (CSF) sCD163 would be associated with greater postmortem neurodegeneration and/or microgliosis. Retrospective, postmortem observational study. We measured sCD163 levels in antemortem plasma (n = 54) and CSF (n = 32) samples from 74 HIV-seropositive participants (median 5 months before death) who donated their brains to research at autopsy. Postmortem, we quantified markers of synaptodendritic damage (microtubule-associated protein 2, synaptophysin), microgliosis [human leukocyte antigen DR (HLA-DR), ionized calcium-binding adaptor molecule 1], astrocytosis (glial fibrillary acidic protein), and impaired protein clearance (β-amyloid) in frontal cortex, hippocampus, putamen, and internal capsule. Multivariable least-squares regression was used to evaluate the association between plasma or CSF sCD163 and histological measures, correcting for multiple comparisons. Higher plasma sCD163 was associated with lower microtubule-associated protein 2 in frontal cortex [B = -0.23, 95% confidence interval (CI) -0.41 to -0.06, P = 0.04], putamen (B = 0.32, 95% CI -0.52 to -0.12, P = 0.02), and hippocampus (B = -0.23, 95% CI -0.35 to -0.10, P = 0.01), and with lower synaptophysin in hippocampus (B = -0.25, 95% CI -0.42 to -0.03, P = 0.02) but not putamen or frontal cortex (P > 0.05). Higher plasma sCD163 was associated with higher HLA-DR in putamen (B = 0.17, 95% CI 0.08 to 0.26, P = 0.008). CSF sCD163 was not associated with any histological measure (P > 0.05). Higher plasma sCD163 in life is associated with greater synaptodendritic damage and microglial activation in cortical and subcortical brain regions.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Seredin, P. V.; Gordienko, N. N.; Glotov, A. V.
2009-08-15
In structures with a porous buffer layer, residual internal stresses caused by a mismatch between the crystal-lattice parameters of the epitaxial GaInP alloy and the GaAs substrate are redistributed to the porous layer that acts as a buffer and is conducive to disappearance of internal stresses. Doping of the epitaxial layer with dysprosium exerts a similar effect on the internal stresses in the film-substrate structure.
24 CFR 16.3 - Procedures for inquiries.
Code of Federal Regulations, 2010 CFR
2010-04-01
... Development IMPLEMENTATION OF THE PRIVACY ACT OF 1974 § 16.3 Procedures for inquiries. (a) Any individual... the office of, or by mail addressed to, the appropriate Privacy Act Officer. Although oral requests... request and the letter itself should both clearly indicate that the subject is a “PRIVACY ACT INQUIRY”. If...
24 CFR 16.3 - Procedures for inquiries.
Code of Federal Regulations, 2011 CFR
2011-04-01
... Development IMPLEMENTATION OF THE PRIVACY ACT OF 1974 § 16.3 Procedures for inquiries. (a) Any individual... the office of, or by mail addressed to, the appropriate Privacy Act Officer. Although oral requests... request and the letter itself should both clearly indicate that the subject is a “PRIVACY ACT INQUIRY”. If...
7 CFR 930.163 - Deferment of restricted obligation.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 930.163 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE TART CHERRIES GROWN IN THE STATES OF MICHIGAN, NEW YORK, PENNSYLVANIA, OREGON, UTAH, WASHINGTON, AND WISCONSIN...
Inside HOLMES experiment: 163Ho metallic target production for the micro-calorimeter absorber
NASA Astrophysics Data System (ADS)
Pizzigoni, G.; Alpert, B.; Balata, M.; Bennett, D.; Biasotti, M.; Boragno, C.; Brofferio, C.; De Gerone, M.; Dressler, R.; Faverazani, M.; Ferri, E.; Folwer, J.; Gatti, F.; Giachero, A.; Heinitz, S.; Hilton, G.; Köster, U.; Lusignoli, M.; Maino, M.; Mates, J.; Nisi, S.; Nizzolo, R.; Nucciotti, A.; Pessina, G.; Puiu, A.; Ragazzi, S.; Reintsema, C.; Ribeiro Gomes, M.; Shmidt, D.; Schumann, D.; Sisti, M.; Swetz, D.; Terranova, F.; Ullom, J.; Day, P. K.
2016-07-01
The main goal in the HOLMES experiment is the neutrino mass measurement using an array of 1000 micro-calorimeters with standard metallic absorber. A good isotope for such measurement is the 163Ho, those isotopes embedded in the metallic absorber will be 1011-1013. Since 163Ho is not available in nature, a dedicated process must be set up to produce the amount needed for this neutrino mass experiment. The process with the highest born-up cross-section is the neutron irradiation of Er2O3 enriched in 162Er: 162Er(n,γ)163Er →163Ho+νe, where the decay is an EC with half-life of about 75 min and the (n,γ) is about 20 barns for thermal neutron. After the neutron irradiation in the oxide powder there are several radioactive isotopes which are potentially disturbing because of the background that they cause below 5 keV. The chemical separation of holmium from the irradiation enriched Er2O3 powder is therefore mandatory and will be performed by means of ion exchange chromatography. On the end of those processes the oxide powder enriched in 162Er will have the 163Ho isotope number required. The holmium chemical state influences the end point of the EC spectrum, in order to avoid such effect it is necessary to embed in the absorber only the metallic isotope. Reduction and distillation technique allowed us to obtain a pure metallic holmium, starting from natural oxide holmium. This technique will be applied on the irradiated oxide powder to obtain the metallic 163Ho, ready to be embedded in the micro-calorimeter absorber.
do Prado Gomes Pedreira, Renato; de Carli, Marina Lara; Beijo, Luiz Alberto; Nonogaki, Suely; Pereira, Alessandro Antônio Costa; Junior, Noé Vital Ribeiro; Sperandio, Felipe Fornias; Hanemann, João Adolfo Costa
2016-10-01
Multinucleated giant cells (MGC) are considered to be a hallmark of granulomatous inflammation; thus, they may play an essential role in the host response against pathogens, particularly Paracoccidioides brasiliensis. This study characterizes the MGC found in oral paracoccidioidomycosis and assesses the correlation of MGC with the amount of fungi within oral tissues. Twenty-six cases were included. They were classified as loose or dense granulomas, and the total MGC, including foreign-body and Langhans giant cells, besides the total and intracellular fungi, were taken into consideration. CD163 immunoexpression was performed, and CD163+ multinucleated giant cells were also quantified. Dense granulomas revealed more foreign-body type and total giant cells than loose granulomas (P < 0.05). Total giant cells showed a positive linear correlation with the CD163+ cells (P = 0.003; r = 0.56) and intracellular fungi quantification (P = 0.045; r = 0.40). Oral paracoccidioidomycosis lesions contain MGC that mainly belong to a CD163+ phenotype, also showing both Langhans and foreign-body arrangements. Additionally, the higher the presence of MGC, the higher the amount of phagocytized fungi.
20 CFR 1002.163 - What types of health plans are covered by USERRA?
Code of Federal Regulations, 2010 CFR
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What types of health plans are covered by USERRA? 1002.163 Section 1002.163 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS... by USERRA? (a) USERRA defines a health plan to include an insurance policy or contract, medical or...
Collisional perturbation of radio-frequency E1 transitions in an atomic beam of dysprosium
DOE Office of Scientific and Technical Information (OSTI.GOV)
Cingoez, A.; Lapierre, Alain; Nguyen, A.-T.
2005-12-15
We have studied collisional perturbations of radio-frequency (rf) electric-dipole (E1) transitions between the nearly degenerate opposite-parity levels in atomic dysprosium (Dy) in the presence of 10 to 80 {mu}Torr of H{sub 2}, N{sub 2}, He, Ar, Ne, Kr, and Xe. Collisional broadening and shift of the resonance, as well as the attenuation of the signal amplitude are observed to be proportional to the foreign-gas density with the exception of H{sub 2} and Ne, for which no shifts were observed. Corresponding rates and cross sections are presented. In addition, rates and cross sections for O{sub 2} are extracted from measurements usingmore » air as foreign gas. The primary motivation for this study is the need for accurate determination of the shift rates, which are needed in a laboratory search for the temporal variation of the fine-structure constant [A. T. Nguyen, D. Budker, S. K. Lamoreaux, and J. R. Torgerson, Phys. Rev. A 69, 22105 (2004)].« less
Uchiyama, Shoichiro; Sasaki, Takaaki; Ishihara, Ryo; Fujiwara, Kunio; Sugo, Takanobu; Umeno, Daisuke; Saito, Kyoichi
2018-01-19
An efficient method for rare metal recovery from environmental water and urban mines is in high demand. Toward rapid and high-resolution rare metal ion separation, a novel bis(2-ethylhexyl) phosphate (HDEHP)-impregnated graft-type particle as a filler for a chromatography column is proposed. To achieve rapid and high-resolution separation, a convection-flow-aided elution mode is required. The combination of 35 μm non-porous particles and a polymer-brush-rich particle structure minimizes the distance from metal ion binding sites to the convection flow in the column, resulting in minimized diffusional mass transfer resistance and the convection-flow-aided elution mode. The HDEHP-impregnated graft-type non-porous-particle-packed cartridge developed in this study exhibited a higher separation performance for model rare metals, neodymium (III) and dysprosium (III) ions, and a narrower peak at a higher linear velocity, than those of previous HDEHP-impregnated fiber-packed and commercially available Lewatit ® VP OC 1026-packed cartridges. Copyright © 2017 Elsevier B.V. All rights reserved.
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2010 CFR
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on Form 5000.24, as provided in §§ 25...
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2012 CFR
2012-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§ 25...
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2013 CFR
2013-04-01
..., DEPARTMENT OF THE TREASURY ALCOHOL BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§ 25...
27 CFR 25.163 - Method of tax payment.
Code of Federal Regulations, 2011 CFR
2011-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Preparation and Remittance of Tax Returns § 25.163 Method of tax payment. A brewer shall pay the tax on beer by return on TTB F 5000.24, as provided in §§ 25...
Dultz, G; Gerber, L; Farnik, H; Berger, A; Vermehren, J; Pleli, T; Zeuzem, S; Piiper, A; Kronenberger, B; Waidmann, O
2015-04-01
Soluble CD163 (sCD163), a marker for macrophage activation, was found to be associated with the severity of liver cirrhosis. The aim of the current study was to investigate whether serum sCD163 levels correlate with liver inflammation and fibrosis in patients with chronic hepatitis B virus (HBV) infection. In a retrospective cohort study, serum sCD163 levels were assessed by ELISA together with clinical and laboratory data in 186 patients with chronic HBV infection and 15 healthy controls. The relation between parameters for liver fibrosis and necroinflammation and sCD163 levels was analysed. Additionally, sCD163 was quantified in a subset of follow-up serum samples after initiation of antiviral treatment. sCD163 levels differed among phases of chronic HBV infection (P < 0.0001), and sCD163 concentrations were associated with inflammatory activity and fibrosis in the liver. sCD163 levels ≥ 1961 ng/l had a high specificity in the identification of subjects with substantial fibrosis (F ≥ 2). sCD163 concentrations decreased significantly after initiation of antiviral treatment. The correlation of sCD163 levels with necroinflammation and fibrosis and the sCD163 decline under treatment indicates that macrophage activation plays a role in HBV-related liver pathogenesis. © 2014 John Wiley & Sons Ltd.
Paramagnetic dysprosium-doped zinc oxide thin films grown by pulsed-laser deposition
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lo, Fang-Yuh, E-mail: fangyuhlo@ntnu.edu.tw; Ting, Yi-Chieh; Chou, Kai-Chieh
2015-06-07
Dysprosium(Dy)-doped zinc oxide (Dy:ZnO) thin films were fabricated on c-oriented sapphire substrate by pulsed-laser deposition with doping concentration ranging from 1 to 10 at. %. X-ray diffraction (XRD), Raman-scattering, optical transmission spectroscopy, and spectroscopic ellipsometry revealed incorporation of Dy into ZnO host matrix without secondary phase. Solubility limit of Dy in ZnO under our deposition condition was between 5 and 10 at. % according to XRD and Raman-scattering characteristics. Optical transmission spectroscopy and spectroscopic ellipsometry also showed increase in both transmittance in ultraviolet regime and band gap of Dy:ZnO with increasing Dy density. Zinc vacancies and zinc interstitials were identified by photoluminescencemore » spectroscopy as the defects accompanied with Dy incorporation. Magnetic investigations with a superconducting quantum interference device showed paramagnetism without long-range order for all Dy:ZnO thin films, and a hint of antiferromagnetic alignment of Dy impurities was observed at highest doping concentration—indicating the overall contribution of zinc vacancies and zinc interstitials to magnetic interaction was either neutral or toward antiferromagnetic. From our investigations, Dy:ZnO thin films could be useful for spin alignment and magneto-optical applications.« less
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2012 CFR
2012-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2014 CFR
2014-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2013 CFR
2013-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
7 CFR 16.3 - Responsibilities of participating organizations.
Code of Federal Regulations, 2011 CFR
2011-01-01
... program beneficiary or prospective program beneficiary on the basis of religion or religious belief. (b) Organizations that receive direct USDA assistance under any USDA program may not engage in inherently religious... Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
WD60/FAP163 is a dynein intermediate chain required for retrograde intraflagellar transport in cilia
Patel-King, Ramila S.; Gilberti, Renée M.; Hom, Erik F. Y.; King, Stephen M.
2013-01-01
Retrograde intraflagellar transport (IFT) is required for assembly of cilia. We identify a Chlamydomonas flagellar protein (flagellar-associated protein 163 [FAP163]) as being closely related to the D1bIC(FAP133) intermediate chain (IC) of the dynein that powers this movement. Biochemical analysis revealed that FAP163 is present in the flagellar matrix and is actively trafficked by IFT. Furthermore, FAP163 copurified with D1bIC(FAP133) and the LC8 dynein light chain, indicating that it is an integral component of the retrograde IFT dynein. To assess the functional role of FAP163, we generated an RNA interference knockdown of the orthologous protein (WD60) in planaria. The Smed-wd60(RNAi) animals had a severe ciliary assembly defect that dramatically compromised whole-organism motility. Most cilia were present as short stubs that had accumulated large quantities of IFT particle–like material between the doublet microtubules and the membrane. The few remaining approximately full-length cilia had a chaotic beat with a frequency reduced from 24 to ∼10 Hz. Thus WD60/FAP163 is a dynein IC that is absolutely required for retrograde IFT and ciliary assembly. PMID:23864713
25 CFR 163.22 - Payment for forest products.
Code of Federal Regulations, 2010 CFR
2010-04-01
...) Terms and conditions for payment of forest products under lump sum (predetermined volume) sales shall be... Forest Management and Operations § 163.22 Payment for forest products. (a) The basis of volume determination for forest products sold shall be the Scribner Decimal C log rules, cubic volume, lineal...
Sánchez Lafarga, Ana Karen; Pacheco Moisés, Fermín P; Gurinov, Andrey; Ortiz, Genaro Gabriel; Carbajal Arízaga, Gregorio Guadalupe
2015-03-01
The development of probes for biomedical applications demands materials with low toxicity levels besides fluorescence or magnetic properties to be detected by confocal microscopes or MRI resonators. Several drug delivery systems or other biomedical materials prepared with hydroxyapatite have been proposed, however, toxicity effects might arise when the size of particles is nanometric. In this study, hydroxyapatite functionalized with glucuronic or folic acids presented lower oxidative stress, measured from lipoperoxides and nitric oxide indicators in rats than pure hydroxyapatite. In separated experiments, hydroxyapatite was doped with dysprosium cations by coprecipitation producing a single crystal phase with fluorescent properties easily visualized by confocal microscopy when excited at 488nm. These particles also presented the ability to modify the proton relaxation time in T1 maps collected by magnetic resonance imaging. These modified hydroxyapatite nanoparticles could be candidates to design bimodal probes with low toxicity. Copyright © 2014 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Hope, Kevin M.; Samudrala, Gopi K.; Vohra, Yogesh K.
2017-01-01
The atomic volume of rare earth metal dysprosium (Dy) has been measured up to high pressures of 35 GPa and low temperatures between 200 and 7 K in a diamond anvil cell using angle dispersive X-ray diffraction at a synchrotron source. The hexagonal close-packed (hcp), alpha-Samarium (α-Sm), and double hexagonal close-packed (dhcp) phases are observed to be stable in Dy under high-pressure and low-temperature conditions achieved in our experiments. Dy is known to undergo magnetic ordering below 176 K at ambient pressure with magnetic ordering Néel temperature (TN) that changes rapidly with increasing pressure. Our experimental measurement shows that Dy has near-zero thermal expansion in the magnetically ordered state and normal thermal expansion in the paramagnetic state for all the three known high pressure phases (hcp, α-Sm, and dhcp) to 35 GPa. This near-zero thermal expansion behavior in Dy is observed below the magnetic ordering temperature TN at all pressures up to 35 GPa.
Fjeldborg, Karen; Pedersen, Steen B; Møller, Holger J; Rask, Peter; Danielsen, Allan Vestergaard; Stødkilde-Jørgensen, Hans; Richelsen, Bjørn
2015-01-01
Soluble CD163 (sCD163) is a new marker of obesity-related metabolic complications. sCD163 and CD163 mRNA were investigated in relation to the fat distribution at baseline and 12 months after Roux-en-Y gastric bypass (RYGB). Thirty-one obese subjects (BMI: 42.3 ± 4.7 kg/m(2)) were enrolled. Subcutaneous (SAT) and visceral adipose tissue (VAT) volume were determined by MRI, intrahepatic lipid content (IHL) by MR-spectroscopy, and body composition by DXA. Fasting blood samples and adipose tissue samples were obtained, and ELISA and RT-PCR were performed. RYGB-induced weight loss (36 ± 11 kg) was accompanied by a significant reduction in sCD163 (2.1 ± 0.8 mg/l vs. 1.7 ± 0.7 mg/l), SAT, VAT, and IHL (all, P < 0.001). At baseline, sCD163 was associated with VAT (r = 0.40, P < 0.05) but not with SAT or IHL. Moreover, CD163 mRNA was significantly upregulated in VAT compared with SAT at baseline (P < 0.05) and significantly downregulated in SAT after RYGB (P < 0.001). ΔsCD163 was significantly associated with ΔIHL after RYGB compared with baseline (r = 0.40, P < 0.05). RYGB-induced weight loss results in a reduction of sCD163 and CD163 mRNA. The association between ΔsCD163 and ΔIHL may reflect a reduction in sCD163-producing Kupffer cells in the liver. Moreover, sCD163 may be a marker of "unhealthy" fat distribution in obese subjects. © 2014 The Obesity Society.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Gomez-Millan, Jaime; Goldblatt, Erin M.; Gryaznov, Sergei M.
Purpose: Telomerase is expressed in 80-90% of tumor cells, but is absent in most somatic cells. The absence of telomerase activity results in progressive telomere shortening, leading to cellular senescence or death through deoxyribonucleic acid (DNA) damage signals. In addition, a role for telomerase in DNA damage repair has also been suggested. A specific telomerase inhibitor, GRN163L that is complementary to the template region of the telomerase ribonucleic acid component (hTR). We hypothesized that exposure to GRN163L, either through immediate inhibition of telomerase activity or through eventual telomere shortening and dysfunction, may enhance radiation sensitivity. Our goal was to testmore » whether the treatment with GRN163L enhances sensitivity to irradiation (IR) in MDA-MB-231 breast cancer cells. Methods and Materials: The MDA-MB-231 breast cancer cells were treated with or without GRN163L for 2-42 days. Inhibition of telomerase activity and shortening of telomeres were confirmed. Cells were then irradiated and clonogenic assays were performed to show cell survival differences. In vivo studies using MDA-MB-231 xenografts were performed to corroborate the in vitro results. Results: We show that cells with shortened telomeres due to GRN163L enhance the effect on IR reducing survival by an additional 30% (p < 0.01). These results are confirmed in vivo, with a significant decrease in tumor growth in mice exposed to GRN163L. Conclusions: We found that GRN163L is a promising adjuvant treatment in combination with radiation therapy that may improve the therapeutic index by enhancing the radiation sensitivity. These studies prompt further investigation as to whether this combination can be applied to other cancers and the clinic.« less
Exploration of dysprosium: the most critical element for Japan
NASA Astrophysics Data System (ADS)
Watanabe, Y.
2012-04-01
Dysprosium (Dy), one of the heavy rare earth elements, is used mainly as an additive for NdFeB permanent magnets which are installed in various modern industrial products such as voice coil motors in computers, factory automation machinery, hybrid and electric vehicles, home electronics, and wind turbine, to improve heat resistance of the magnets. Dy has been produced about 2,000t per year from the ores from ion adsorption type deposits in southern China. However, the produced amount of Dy was significantly reduced in 2011 in China due to reservation of heavy rare earth resources and protection of natural environment, resulting in soaring of Dy price in the world. In order to respond the increasing demand of Dy, unconventional supply sources are inevitably developed, in addition to heavy rare earth enriched ion adsorption type deposits outside China. Heavy rare earth elements including Dy are dominantly hosted in xenotime, fergusonite, zircon, eudialyte, keiviite, kainosite, iimoriite, etc. Concentration of xenotime is found in placer deposits in Malaysia and India, hydrothermal deposits associated with unconformity-type uranium mineralization (Athabasca basin in Canada, Western Australia), iron-oxide fluorite mineralization (South Africa) and Sn-bearing alkaline granite (Brazil). Zircon and fergusontie concentration is found as igneous and hydrothermal products in peralkaline syenite, alkaline granite and pegmatite (e.g., Nechalacho in Canada). Eudialyte concentration is found in some peralkaline syenite bodies in Greenland, Canada, Sweden and Russia. Among these sources, large Dy resources are estimated in the deposits hosted in peralkaline rocks (Nechalacho: 79,000t, Kvanefjeld: 49,000t, Norra Karr: 15,700t, etc.) compared to the present demand of Dy. Thus, Dy will be supplied from the deposits associated with peralkaline and alkaline deposits in future instead of ion adsorption type deposits in southern China.
Alvarado-Vazquez, Perla Abigail; Bernal, Laura; Paige, Candler A; Grosick, Rachel L; Moracho Vilrriales, Carolina; Ferreira, David Wilson; Ulecia-Morón, Cristina; Romero-Sandoval, E Alfonso
2017-08-01
M1 macrophages release proinflammatory factors during inflammation. They transit to an M2 phenotype and release anti-inflammatory factors to resolve inflammation. An imbalance in the transition from M1 to M2 phenotype in macrophages contributes to the development of persistent inflammation. CD163, a member of the scavenger receptor cysteine-rich family, is an M2 macrophage marker. The functional role of CD163 during the resolution of inflammation is not completely known. We postulate that CD163 contributes to the transition from M1 to M2 phenotype in macrophages. We induced CD163 gene in THP-1 and primary human macrophages using polyethylenimine nanoparticles grafted with a mannose ligand (Man-PEI). This nanoparticle specifically targets cells of monocytic origin via mannose receptors. Cells were challenged with a single or a double stimulation of lipopolysaccharide (LPS). A CD163 or empty plasmid was complexed with Man-PEI nanoparticles for cell transfections. Quantitative RT-PCR, immunocytochemistry, and ELISAs were used for molecular assessments. CD163-overexpressing macrophages displayed reduced levels of tumor necrosis factor-alpha (TNF)-α and monocytes chemoattractant protein (MCP)-1 after a single stimulation with LPS. Following a double stimulation paradigm, CD163-overexpressing macrophages showed an increase of interleukin (IL)-10 and IL-1ra and a reduction of MCP-1. This anti-inflammatory phenotype was partially blocked by an anti-CD163 antibody (effects on IL-10 and IL-1ra). A decrease in the release of TNF-α, IL-1β, and IL-6 was observed in CD163-overexpressing human primary macrophages. The release of IL-6 was blocked by an anti-CD163 antibody in the CD163-overexpressing group. Our data show that the induction of the CD163 gene in human macrophages under inflammatory conditions produces changes in cytokine secretion in favor of an anti-inflammatory phenotype. Targeting macrophages to induce CD163 using cell-directed nanotechnology is an attractive
Oblique view looking northeast at Machine Shop (Bldg. 163) from ...
Oblique view looking northeast at Machine Shop (Bldg. 163) from Second Street - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Federal Register 2010, 2011, 2012, 2013, 2014
2013-03-08
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-80-2012] Foreign-Trade Zone 163--Ponce, Puerto Rico; Authorization of Production Activity; Zimmer Manufacturing BV (Medical Devices); Ponce, Puerto... Subzone 163A, in Ponce, Puerto Rico. The notification was processed in accordance with the regulations of...
49 CFR 1.63 - Delegations to Assistant to the Secretary and Director of Public Affairs.
Code of Federal Regulations, 2010 CFR
2010-10-01
... Director of Public Affairs. 1.63 Section 1.63 Transportation Office of the Secretary of Transportation... and Director of Public Affairs. The Assistant to the Secretary and Director of Public Affairs is delegated authority to: (a) [Reserved] (b) Monitor the overall public information program and review and...
Craig, D G; Lee, P; Pryde, E A; Hayes, P C; Simpson, K J
2013-12-01
Macrophage activation is implicated in the pathogenesis of the systemic inflammatory response syndrome (SIRS) following paracetamol (acetaminophen) overdose (POD). Neopterin is synthesised from macrophages and reflects the intensity of monocyte/macrophage activation. Soluble CD163 (sCD163) is a marker of alternatively activated M2 macrophages. To examine neopterin and sCD163 levels in a cohort of acute liver injury patients. Consecutive patients (n = 41, (18 (43.9%) male) with acute liver injury were enrolled. Neopterin and sCD163 levels were measured by ELISA. A total of 24/33 (72.7%) POD patients developed hepatic encephalopathy (HE), and therefore acute liver failure. Both neopterin and sCD163 levels were significantly higher in PODs compared with chronic liver disease (neopterin P < 0.001, sCD163 P = 0.038) and healthy (both P < 0.001) controls. Admission neopterin levels were significantly higher in PODs: with HE (P = 0.001); with the SIRS (P = 0.005); who required renal replacement therapy (P = 0.003); who died or required liver transplantation (P = 0.006; AUROC 78.6% (95% CI 62.2-94.9%). Serum sCD163 levels were significantly higher in those PODs with the SIRS (P = 0.033) on admission, and were higher in those PODs who died or required OLT (P = 0.024). Both admission neopterin and sCD163 levels in PODs correlated with organ failure scores but not with serum ALT. There was no significant correlation between neopterin and sCD163 values. Both serum neopterin and sCD163 levels are significantly elevated following paracetamol overdose, and reflect the degree of macrophage activation in this condition. Serum neopterin in particular may have value as an early proxy marker of macrophage activation following paracetamol overdose. © 2013 John Wiley & Sons Ltd.
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2014 CFR
2014-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2013 CFR
2013-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2010 CFR
2010-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2012 CFR
2012-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
27 CFR 31.163 - Requirements when a wholesale dealer in liquors maintains a retail department.
Code of Federal Regulations, 2011 CFR
2011-04-01
... wholesale dealer in liquors maintains a retail department. 31.163 Section 31.163 Alcohol, Tobacco Products... wholesale dealer in liquors maintains a retail department. (a) Constructive receipt and sale. When a... spirits, and the retail sales of distilled spirits normally represent 90 percent or more of the volume of...
West elevation of Machine Shop (Bldg. 163) north bay. Boiler ...
West elevation of Machine Shop (Bldg. 163) north bay. Boiler Shop (Bldg. 152) is at left - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Code of Federal Regulations, 2010 CFR
2010-04-01
... conditions not contained in the model compact? 1000.163 Section 1000.163 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF... Funding Agreements Negotiating A Self-Governance Compact § 1000.163 Can a Tribe/Consortium negotiate other...
Looking northeast from roof of Machine Shop (Bldg. 163) at ...
Looking northeast from roof of Machine Shop (Bldg. 163) at transfer table pit and Boiler Shop (Bldg. 152) - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Detail of heating coil for Machine Shop (Bldg. 163) ventilation ...
Detail of heating coil for Machine Shop (Bldg. 163) ventilation system Note portion of fan visible behind coil - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Zhang, Li; Zhang, Peng; Zhao, Lang; Wu, Jianfeng; Guo, Mei; Tang, Jinkui
2016-06-28
An unprecedented octanuclear dysprosium(iii) cluster with the formula [Dy8L6(μ3-OH)4(μ2-CH3O)2(CH3OH)6(H2O)2]·6H2O·10CH3OH·2CH3CN () based on a nonlinearly tritopic aroylhydrazone ligand H3L has been isolated, realizing the successful linking of pairwise interesting triangular Dy3 SMMs. It is noteworthy that two enantiomers (Λ and Δ configurations) individually behaving as a coordination-induced chirality presented in the Dy3 helicate are connected in the meso Dy8 cluster. Remarkably, alternating-current magnetic susceptibility measurements revealed that the Dy8 cluster shows typical SMM behavior inherited from its Dy3 helical precursor. It is one of the rare polynuclear Lnn SMMs (n > 7) under zero dc field.
Looking north at east end of Machine Shop (Bldg. 163). ...
Looking north at east end of Machine Shop (Bldg. 163). Note overhead crane rail extension and pit between rails - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Looking south from roof of Machine Shop (Bldg. 163) at ...
Looking south from roof of Machine Shop (Bldg. 163) at 120-foot turntable and site of 35-stall roundhouse - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Code of Federal Regulations, 2013 CFR
2013-07-01
... achievable (BAT). 429.163 Section 429.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... application of the best available technology economically achievable (BAT). Except as provided in 40 CFR 125... best available technology economically achievable (BAT): There shall be no discharge of process...
Code of Federal Regulations, 2014 CFR
2014-07-01
... achievable (BAT). 429.163 Section 429.163 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... application of the best available technology economically achievable (BAT). Except as provided in 40 CFR 125... best available technology economically achievable (BAT): There shall be no discharge of process...
18 CFR 367.1630 - Account 163, Stores expense undistributed.
Code of Federal Regulations, 2010 CFR
2010-04-01
... damages. (7) Insurance on materials and supplies and on stores equipment. (8) Losses due to breakage... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 163, Stores expense undistributed. 367.1630 Section 367.1630 Conservation of Power and Water Resources FEDERAL ENERGY...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Hope, Kevin M.; Samudrala, Gopi K.; Vohra, Yogesh K.
The atomic volume of rare earth metal Dysprosium (Dy) has been measured up to high pressures of 35 GPa and low temperatures between 200 K and 7 K in a diamond anvil cell using angle dispersive x-ray diffraction at a synchrotron source. The hexagonal close-packed (hcp), alpha-Samarium (α-Sm), and double hexagonal close packed (dhcp) phases are observed to be stable in Dy under high-pressure and low-temperature conditions achieved in our experiments. Dy is known to undergo magnetic ordering below 176 K at ambient pressure with magnetic ordering Néel temperature (T N) that changes rapidly with increasing pressure. Our experimental measurementmore » shows that Dy has near-zero thermal expansion in the magnetically ordered state and normal thermal expansion in the paramagnetic state for all the three known high pressure phases (hcp, α-Sm, and dhcp) to 35 GPa. This near-zero thermal expansion behavior in Dy is observed below the magnetic ordering temperature T N at all pressures up to 35 GPa.« less
Hope, Kevin M.; Samudrala, Gopi K.; Vohra, Yogesh K.
2017-01-01
The atomic volume of rare earth metal Dysprosium (Dy) has been measured up to high pressures of 35 GPa and low temperatures between 200 K and 7 K in a diamond anvil cell using angle dispersive x-ray diffraction at a synchrotron source. The hexagonal close-packed (hcp), alpha-Samarium (α-Sm), and double hexagonal close packed (dhcp) phases are observed to be stable in Dy under high-pressure and low-temperature conditions achieved in our experiments. Dy is known to undergo magnetic ordering below 176 K at ambient pressure with magnetic ordering Néel temperature (T N) that changes rapidly with increasing pressure. Our experimental measurementmore » shows that Dy has near-zero thermal expansion in the magnetically ordered state and normal thermal expansion in the paramagnetic state for all the three known high pressure phases (hcp, α-Sm, and dhcp) to 35 GPa. This near-zero thermal expansion behavior in Dy is observed below the magnetic ordering temperature T N at all pressures up to 35 GPa.« less
Looking northeast at Machine Shop (Bldg. 163) south wall. Note ...
Looking northeast at Machine Shop (Bldg. 163) south wall. Note bridge crane at right and crane rail attached to building - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Grønbaek, H; Sandahl, T D; Mortensen, C; Vilstrup, H; Møller, H J; Møller, S
2012-07-01
Activation of Kupffer cells may be involved in the pathogenesis of portal hypertension by release of vasoconstrictive substances and fibrosis due to co-activation of hepatic stellate cells. To study soluble plasma (s) CD163, a specific marker of activated macrophages, as a biomarker for portal hypertension in patients with liver cirrhosis. We measured sCD163 concentration and the hepatic venous pressure gradient (HVPG) by liver vein catheterisation in 81 cirrhosis patients (Child-Pugh CP-A: n = 26, CP-B: n = 29, CP-C: n = 26) and 22 healthy subjects. We also measured their cardiac output (CO), cardiac index and systemic vascular resistance (SVR). Liver status was examined by Child-Pugh and MELD-score. In cirrhosis, sCD163 concentration was nearly three times higher than in controls (4.7 ± 2.5 vs. 1.6 ± 0.5 mg/L, P < 0.001). sCD163 was also higher, as measured in steps by CP-score (P < 0.001). The HVPG rose steeply to an asymptote of 22 mmHg with sCD163 up to about 5 mg/L and not to higher values with higher sCD163. In a multivariate analysis, sCD163 was the only independent predictor of the HVPG but did not predict any of the systemic circulatory findings. sCD163 > 3.95 mg/L (upper normal limit) predicted HVPG ≥ 10 mmHg with a positive predictive value of 0.99. Circulating sCD163 originating from activated Kupffer cells is increased in cirrhosis with increasing Child-Pugh score and with increasing HVPG, and it is an independent predictor for HVPG. These findings support a primary role of macrophage activation in portal hypertension, and may indicate a target for biological intervention. © 2012 Blackwell Publishing Ltd.
Detail of Machine Shop (Bldg. 163) south wall and crane ...
Detail of Machine Shop (Bldg. 163) south wall and crane rail. The overlapped tracks in foreground were used to store wheelsets - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Code of Federal Regulations, 2010 CFR
2010-07-01
... economically achievable (BAT). 415.163 Section 415.163 Protection of Environment ENVIRONMENTAL PROTECTION... achievable (BAT). (a) Except as provided in 40 CFR 125.30 through 125.32, any existing point source subject... technology economically achievable (BAT): There shall be no discharge of process wastewater pollutants to...
Code of Federal Regulations, 2011 CFR
2011-07-01
... economically achievable (BAT). 415.163 Section 415.163 Protection of Environment ENVIRONMENTAL PROTECTION... achievable (BAT). (a) Except as provided in 40 CFR 125.30 through 125.32, any existing point source subject... technology economically achievable (BAT): There shall be no discharge of process wastewater pollutants to...
Code of Federal Regulations, 2012 CFR
2012-07-01
... economically achievable (BAT). 415.163 Section 415.163 Protection of Environment ENVIRONMENTAL PROTECTION... achievable (BAT). (a) Except as provided in 40 CFR 125.30 through 125.32, any existing point source subject... technology economically achievable (BAT): There shall be no discharge of process wastewater pollutants to...
Kozjak-Pavlovic, Vera; Prell, Florian; Thiede, Bernd; Götz, Monika; Wosiek, Dominik; Ott, Christine; Rudel, Thomas
2014-02-20
Oxidative phosphorylation (OXPHOS) in mitochondria takes place at the inner membrane, which folds into numerous cristae. The stability of cristae depends, among other things, on the mitochondrial intermembrane space bridging complex. Its components include inner mitochondrial membrane protein mitofilin and outer membrane protein Sam50. We identified a conserved, uncharacterized protein, C1orf163 [SEL1 repeat containing 1 protein (SELRC1)], as one of the proteins significantly reduced after the knockdown of Sam50 and mitofilin. We show that C1orf163 is a mitochondrial soluble intermembrane space protein. Sam50 depletion affects moderately the import and assembly of C1orf163 into two protein complexes of approximately 60kDa and 150kDa. We observe that the knockdown of C1orf163 leads to reduction of levels of proteins belonging to the OXPHOS complexes. The activity of complexes I and IV is reduced in C1orf163-depleted cells, and we observe the strongest defects in the assembly of complex IV. Therefore, we propose C1orf163 to be a novel factor important for the assembly of respiratory chain complexes in human mitochondria and suggest to name it RESA1 (for RESpiratory chain Assembly 1). Copyright © 2013 Elsevier Ltd. All rights reserved.
Looking west at Machine Shop (Bldg. 163) north bay interior. ...
Looking west at Machine Shop (Bldg. 163) north bay interior. Note the Shaw 15-ton bridge crane and pits between the rails of several tracks - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
CD-163 correlated with symptoms (pain or discomfort) of prostatic inflammation.
Yamamichi, Fukashi; Shigemura, Katsumi; Arakawa, Soichi; Tanaka, Kazushi; Fujisawa, Masato
2015-01-01
The purpose of this study is to identify significant immune-system related for symptom of patients with prostatic inflammation in order to investigate the etiology of prostatic inflammation which may relate to potentially chronic prostatitis (CP). We investigated the expression of immune system-related biomarkers such as Interleukin (IL) -6 (humoral immunity), CD-3 (T-lymphocyte), and CD-163 (macrophage) in prostate biopsy (PBx) specimens from patients with prostatic inflammation (without cancer) which had been neither clinically diagnosed benign prostatic hyperplasia nor chronic prostatitis. We examined the correlation between these markers' expressions and the symptom scores using the National Institutes of Health-Chronic Prostatitis Symptom Index (NIH-CPSI), International Prostate Symptom Score (IPSS)/quality of life (QOL) which are the index for lower urinary tract symptoms (LUTS). Our results showed CD-163 (macrophage) reflected pain or discomfort on NIH-CPSI scores (P=0.0389 and r=0.3307) in the patients with prostatic inflammation; however, the control patients had no significant correlation between symptom scores and those immune-related markers' expression. These results suggest that pain or discomfort related to macrophages in the relationship between immune-system and the symptom of prostatic inflammation. In conclusion, CD-163, related to immune-system (macrophage), correlated with symptoms (pain or discomfort) of prostatic inflammation and might represent a significant immune-system related biomarker for pain or LUTS score in potentially CP.
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2012 CFR
2012-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2014 CFR
2014-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2011 CFR
2011-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2013 CFR
2013-04-01
... REGULATIONS Forestry Education, Education Assistance, Recruitment and Training § 163.42 Obligated service and breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... 90 days of the date all program education requirements have been completed. If such employment is not...
Dysprosium complexes with mono-/di-carboxylate ligands-From simple dimers to 2D and 3D frameworks
NASA Astrophysics Data System (ADS)
Zhang, Yingjie; Bhadbhade, Mohan; Scales, Nicholas; Karatchevtseva, Inna; Price, Jason R.; Lu, Kim; Lumpkin, Gregory R.
2014-11-01
Four dysprosium (Dy) single carboxylates, a formate, a propionate, a butyrate and an oxalate have been synthesized and structurally characterized. The structure of Dy(HCO2)3 (1) contains nine-fold coordinated Dy polyhedra in perfect tricapped trigonal prisms. They are linked through trigonal O atoms forming 1D pillars which are further linked together through tricapped O atoms into a 3D pillared metal organic framework. The network structure is stable up to 360 °C. The structure of [Dy2(C2O4)3(H2O)6]·2.5H2O (2) contains nine-fold coordinated Dy polyhedra linking together through μ2-bridging oxalate anions into a 2D hexagonal layered structure. Both [Dy2(Pr)6(H2O)4]·(HPr)0.5 (3) [Pr=(C2H5CO2)-1] and [Dy2(Bu)6(H2O)4] (4) [Bu=(C3H7CO2)-1] have similar di-nuclear structures. The Raman vibration modes of the complexes have been investigated.
Looking north through Machine Shop (Bldg. 163) Track 409 Doors ...
Looking north through Machine Shop (Bldg. 163) Track 409 Doors at transfer table, with Boiler Shop (Bldg. 152) at left and C.W.E. Shop No. 2 (Bldg. 47) at right - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
The environment and star formation of H II region Sh2-163: a multi-wavelength study
NASA Astrophysics Data System (ADS)
Yu, Naiping; Wang, Jun-Jie; Li, Nan
2014-12-01
To investigate the environment of H II region Sh2-163 and search for evidence of triggered star formation in this region, we performed a multi-wavelength study of this H II region. Most of our data were taken from large-scale surveys: 2MASS, CGPS, MSX and SCUBA. We also made CO molecular line observations, using the 13.7-m telescope. The ionized region of Sh2-163 is detected by both the optical and radio continuum observations. Sh2-163 is partially bordered by an arc-like photodissociation region (PDR), which is coincident with the strongest optical and radio emissions, indicating interactions between the H II region and the surrounding interstellar medium. Two molecular clouds were discovered on the border of the PDR. The morphology of these two clouds suggests they are compressed by the expansion of Sh2-163. In cloud A, we found two molecular clumps. And it seems star formation in clump A2 is much more active than in clump A1. In cloud B, we found new outflow activities and massive star(s) are forming inside. Using 2MASS photometry, we tried to search for embedded young stellar object (YSO) candidates in this region. The very good agreement between CO emission, infrared shell and YSOs suggest that it is probably a star formation region triggered by the expansion of Sh2-163. We also found the most likely massive protostar related to IRAS 23314+6033.
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2012 CFR
2012-10-01
... 42 Public Health 2 2012-10-01 2012-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 42 Public Health 2 2011-10-01 2011-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 42 Public Health 2 2013-10-01 2013-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
42 CFR 411.163 - Coordination of benefits: Dual entitlement situations.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 42 Public Health 2 2014-10-01 2014-10-01 false Coordination of benefits: Dual entitlement... Health Plans § 411.163 Coordination of benefits: Dual entitlement situations. (a) Basic rule. Coordination of benefits is governed by this section if an individual is eligible for or entitled to Medicare...
25 CFR 163.42 - Obligated service and breach of contract.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Obligated service and breach of contract. 163.42 Section... breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... request for waiver. (b) Breach of contract. Any individual who has participated in and accepted financial...
14 CFR 61.163 - Aeronautical experience: Powered-lift category rating.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aeronautical experience: Powered-lift... Transport Pilots § 61.163 Aeronautical experience: Powered-lift category rating. (a) A person who is applying for an airline transport pilot certificate with a powered-lift category rating must have at least...
14 CFR 61.163 - Aeronautical experience: Powered-lift category rating.
Code of Federal Regulations, 2011 CFR
2011-01-01
... 14 Aeronautics and Space 2 2011-01-01 2011-01-01 false Aeronautical experience: Powered-lift... Transport Pilots § 61.163 Aeronautical experience: Powered-lift category rating. (a) A person who is applying for an airline transport pilot certificate with a powered-lift category rating must have at least...
Machine Shop (Bldg. 163) north bay, east end interior, with ...
Machine Shop (Bldg. 163) north bay, east end interior, with a 250-ton Shaw bridge crane on the upper rails and two smaller P&H bridge cranes on the lower rails - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Boiler Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Fu, Xinmiao; Chang, Zengyi
2004-04-02
Small heat shock proteins (sHsps) usually exist as oligomers that undergo dynamic oligomeric dissociation/re-association, with the dissociated oligomers as active forms to bind substrate proteins under heat shock conditions. In this study, however, we found that Hsp16.3, one sHsp from Mycobacterium tuberculosis, is able to sensitively modulate its chaperone-like activity in a range of physiological temperatures (from 25 to 37.5 degrees C) while its native oligomeric size is still maintained. Further analysis demonstrated that Hsp16.3 exposes higher hydrophobic surfaces upon temperatures increasing and that a large soluble complex between Hsp16.3 and substrate is formed only in the condition of heating temperature up to 35 and 37.5 degrees C. Structural analysis by fluorescence anisotropy showed that Hsp16.3 nonameric structure becomes more dynamic and variable at elevated temperatures. Moreover, subunit exchange between Hsp16.3 oligomers was found to occur faster upon temperatures increasing as revealed by fluorescence energy resonance transfer. These observations indicate that Hsp16.3 is able to modulate its chaperone activity by adjusting the dynamics of oligomeric dissociation/re-association process while maintaining its static oligomeric size unchangeable. A kinetic model is therefore proposed to explain the mechanism of sHsps-binding substrate proteins through oligomeric dissociation. The present study also implied that Hsp16.3 is at least capable of binding non-native proteins in vivo while expressing in the host organism that survives at 37 degrees C.
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2012 CFR
2012-07-01
....160. This section does not apply to automatic sprinkler systems which are covered under § 1910.159. (b...] Other Fire Protection Systems ... 29 Labor 5 2012-07-01 2012-07-01 false Fixed extinguishing systems, water spray and foam. 1910.163...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2014 CFR
2014-07-01
....160. This section does not apply to automatic sprinkler systems which are covered under § 1910.159. (b...] Other Fire Protection Systems ... 29 Labor 5 2014-07-01 2014-07-01 false Fixed extinguishing systems, water spray and foam. 1910.163...
1970-01-01
dlcarbide (Cr5C2) Heptachromium tricarbide (CrTCj) Chromium chlorides: CrCl2 CrClj Chromium dichloride (CrC^) Chromium trichloride (CrC...methane (see Propane) Dysprosia (see Dysprosium oxide) Dysprosium Dysprosium trichloride hexahydrate (DyClj-6HjO) Dysprosium oxide (DyjOj...Dysprosium sesquioxide (see Dysprosium oxide) Didysprosium trioxide (see Dysprosium oxide) Erbia (see Erbium oxide) Erbium Erbium trichloride
Looking west at Machine Shop (Bldg. 163) south bay interior. ...
Looking west at Machine Shop (Bldg. 163) south bay interior. Note the Shaw 15-ton bridge crane. This portion of the building housed machine tools and locomotive component repair functions that supported the erecting shop operations - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2010 CFR
2010-04-01
... preparation of the product, cocoa or a mixture of cocoa and chocolate liquor is used in such quantity that the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet cocoa and vegetable fat coating. 163.150... (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products...
42 CFR 410.163 - Payment for services furnished to kidney donors.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Payment for services furnished to kidney donors... Benefits § 410.163 Payment for services furnished to kidney donors. Notwithstanding any other provisions of... an individual who donates a kidney for transplant surgery. ...
42 CFR 410.163 - Payment for services furnished to kidney donors.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 42 Public Health 2 2011-10-01 2011-10-01 false Payment for services furnished to kidney donors... Benefits § 410.163 Payment for services furnished to kidney donors. Notwithstanding any other provisions of... an individual who donates a kidney for transplant surgery. ...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2010 CFR
2010-07-01
... Section 1910.163 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Fire Protection Fixed Fire... extinguishing agent, installed to meet a particular OSHA standard. These systems shall also comply with § 1910...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
Code of Federal Regulations, 2011 CFR
2011-07-01
... Section 1910.163 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Fire Protection Fixed Fire... extinguishing agent, installed to meet a particular OSHA standard. These systems shall also comply with § 1910...
Rubio-Navarro, Alfonso; Carril, Mónica; Padro, Daniel; Guerrero-Hue, Melanie; Tarín, Carlos; Samaniego, Rafael; Cannata, Pablo; Cano, Ainhoa; Villalobos, Juan Manuel Amaro; Sevillano, Ángel Manuel; Yuste, Claudia; Gutiérrez, Eduardo; Praga, Manuel; Egido, Jesús; Moreno, Juan Antonio
2016-01-01
Macrophages play an important role in rhabdomyolysis-acute kidney injury (AKI), although the molecular mechanisms involved in macrophage differentiation are poorly understood. We analyzed the expression and regulation of CD163, a membrane receptor mainly expressed by anti-inflammatory M2 macrophages, in rhabdomyolysis-AKI and developed targeted probes for its specific detection in vivo by MRI. Intramuscular injection of glycerol in mice promoted an early inflammatory response, with elevated proportion of M1 macrophages, and partial differentiation towards a M2 phenotype in later stages, where increased CD163 expression was observed. Immunohistological studies confirmed the presence of CD163-macrophages in human rhabdomyolysis-AKI. In cultured macrophages, myoglobin upregulated CD163 expression via HO-1/IL-10 axis. Moreover, we developed gold-coated iron oxide nanoparticles vectorized with an anti-CD163 antibody that specifically targeted CD163 in kidneys from glycerol-injected mice, as determined by MRI studies, and confirmed by electron microscopy and immunological analysis. Our findings are the first to demonstrate that CD163 is present in both human and experimental rhabdomyolysis-induced AKI, suggesting an important role of this molecule in this pathological condition. Therefore, the use of probes targeting CD163-macrophages by MRI may provide important information about the cellular composition of renal lesion in rhabdomyolysis.
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
Code of Federal Regulations, 2011 CFR
2011-04-01
... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that: (1) In the preparation of the product, cocoa or a mixture of cocoa and chocolate liquor is used in such quantity that the...) Chocolate liquor; (3) Safe and suitable vegetable derived fats, oils, and stearins other than cacao fat. The...
Machine Shop (Bldg. 163) north bay, east end interior looking ...
Machine Shop (Bldg. 163) north bay, east end interior looking northeast. Note the 250-ton Shaw bridge crane on the upper rails and two smaller P&H bridge cranes on the lower rails. Three cranes shared the lower rails - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Rubio-Navarro, Alfonso; Carril, Mónica; Padro, Daniel; Guerrero-Hue, Melanie; Tarín, Carlos; Samaniego, Rafael; Cannata, Pablo; Cano, Ainhoa; Villalobos, Juan Manuel Amaro; Sevillano, Ángel Manuel; Yuste, Claudia; Gutiérrez, Eduardo; Praga, Manuel; Egido, Jesús; Moreno, Juan Antonio
2016-01-01
Macrophages play an important role in rhabdomyolysis-acute kidney injury (AKI), although the molecular mechanisms involved in macrophage differentiation are poorly understood. We analyzed the expression and regulation of CD163, a membrane receptor mainly expressed by anti-inflammatory M2 macrophages, in rhabdomyolysis-AKI and developed targeted probes for its specific detection in vivo by MRI. Intramuscular injection of glycerol in mice promoted an early inflammatory response, with elevated proportion of M1 macrophages, and partial differentiation towards a M2 phenotype in later stages, where increased CD163 expression was observed. Immunohistological studies confirmed the presence of CD163-macrophages in human rhabdomyolysis-AKI. In cultured macrophages, myoglobin upregulated CD163 expression via HO-1/IL-10 axis. Moreover, we developed gold-coated iron oxide nanoparticles vectorized with an anti-CD163 antibody that specifically targeted CD163 in kidneys from glycerol-injected mice, as determined by MRI studies, and confirmed by electron microscopy and immunological analysis. Our findings are the first to demonstrate that CD163 is present in both human and experimental rhabdomyolysis-induced AKI, suggesting an important role of this molecule in this pathological condition. Therefore, the use of probes targeting CD163-macrophages by MRI may provide important information about the cellular composition of renal lesion in rhabdomyolysis. PMID:27162559
25 CFR 163.11 - Forest management planning and sustained yield management.
Code of Federal Regulations, 2011 CFR
2011-04-01
... GENERAL FORESTRY REGULATIONS Forest Management and Operations § 163.11 Forest management planning and... 25 Indians 1 2011-04-01 2011-04-01 false Forest management planning and sustained yield management... management planning for Indian forest land shall be carried out through participation in the development and...
Popescu, Luca; Gaudreault, Natasha N; Whitworth, Kristen M; Murgia, Maria V; Nietfeld, Jerome C; Mileham, Alan; Samuel, Melissa; Wells, Kevin D; Prather, Randall S; Rowland, Raymond R R
2017-01-15
African swine fever is a highly contagious, often fatal disease of swine for which there is no vaccine or other curative treatment. The macrophage marker, CD163, is a putative receptor for African swine fever virus (ASFV). Pigs possessing a complete knockout of CD163 on macrophages were inoculated with Georgia 2007/1, a genotype 2 isolate. Knockout and wild type pen mates became infected and showed no differences in clinical signs, mortality, pathology or viremia. There was also no difference following in vitro infection of macrophages. The results do not rule out the possibility that other ASFV strains utilize CD163, but demonstrate that CD163 is not necessary for infection with the Georgia 2007/1 isolate. This work rules out a significant role for CD163 in ASFV infection and creates opportunities to focus on alternative receptors and entry mechanisms. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
NASA Astrophysics Data System (ADS)
Bedogni, R.; Gómez-Ros, J. M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.
2012-08-01
A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).
Machine Shop (Bldg. 163) north bay interior looking east, with ...
Machine Shop (Bldg. 163) north bay interior looking east, with a 250-ton Shaw bridge crane on the upper rails and two smaller P&H bridge cranes on the lower rails. This high-bay, north portion of the building served as the erecting shop - Atchison, Topeka, Santa Fe Railroad, Albuquerque Shops, Machine Shop, 908 Second Street, Southwest, Albuquerque, Bernalillo County, NM
Federal Register 2010, 2011, 2012, 2013, 2014
2012-08-28
... DEPARTMENT OF LABOR Employee Benefits Security Administration 163rd Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Teleconference Meeting Pursuant to the.... 1142, the 163rd open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2011 CFR
2011-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2013 CFR
2013-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2010 CFR
2010-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2012 CFR
2012-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
9 CFR 381.163 - “(Kind) baked” or “(Kind) roasted.”
Code of Federal Regulations, 2014 CFR
2014-01-01
... Composition § 381.163 “(Kind) baked” or “(Kind) roasted.” Such product consists of ready-to-cook poultry of the kind indicated, that has been cooked in dry source heat, e.g., oven roasted or oven baked. ...
31 CFR 363.163 - How do I convert an eligible definitive savings bond?
Code of Federal Regulations, 2010 CFR
2010-07-01
... REGULATIONS GOVERNING SECURITIES HELD IN TREASURYDIRECT Conversion of a Definitive Savings Bond § 363.163 How do I convert an eligible definitive savings bond? We will provide online instructions for converting...
Dultz, G; Gerber, L; Zeuzem, S; Sarrazin, C; Waidmann, O
2016-04-01
Recent data highlighted the association of the macrophage activation marker CD163 with histological inflammation and fibrosis in chronic hepatitis C virus (HCV) infection. The aim of this study was to investigate the influence of successful antiviral treatment and IL28B genotypes on macrophage activation reflected by CD163 levels in HCV infected patients. In a retrospective cohort study, serum sCD163 levels were correlated with results of liver histopathology, IL28B genotyping and clinical parameters in 329 patients with HCV infection, 15 healthy controls and in 161 patients who achieved a sustained virologic response after antiviral treatment. sCD163 levels were significantly higher in patients with chronic HCV infection in comparison to healthy controls (5202 vs 896 ng/mL, P < 0.001). In the multivariate logistic regression analyses, sCD163 was independently associated with histologically determined inflammation (P = 0.043) but not with fibrosis (P = 0.091). sCD163 dropped significantly after successful antiviral treatment in comparison to baseline values (5202 vs 3093 ng/mL, P < 0.001). In the univariate analyses, sCD163 was significantly associated with IL28B genotype (C/C vs C/T+T/T) with higher values in the C/C group (6098 vs 4812 ng/mL, P = 0.003). In the multivariate logistic regression model, sCD163 levels were significantly associated with IL28B genotype (P = 0.003) and sustained virologic response (SVR) (P < 0.001). Our data support the association of activated liver macrophages with hepatic necroinflammation in chronic HCV infection as sCD163 levels drop rapidly after SVR. The irresponsiveness of IL28B minor genotypes to interferon might be related to a lower level of macrophage activation in these patients. © 2015 John Wiley & Sons Ltd.
NASA Astrophysics Data System (ADS)
Halimah, M. K.; Ami Hazlin, M. N.; Muhammad, F. D.
2018-04-01
A series of glass samples with chemical formula {[(TeO2)0.7(B2O3)0.3]0.7(ZnO)0.3}1 - x(Dy2O3)x where x = 0.01, 0.02, 0.03, 0.04 and 0.05 M fraction were synthesized through conventional melt-quenching method. The most common way to fabricate a glass material is by fusion of two or more component oxides followed by their quenching. This technique is known as melt-quenching technique. Kaur et al. (2016) [1] highlighted that the melt-quenching method able to enhance the mechanical properties like hardness and flexural strength of the material. The nature of the glass systems is proven to be amorphous based on the XRD pattern. The FTIR spectra of the glass systems confirm the existence of five bands which are assigned for the BO4, BO3, TeO4 and TeO3 vibrational groups. The density of the glass systems is increased with the addition of Dy2O3 while the molar volume is found to be inversely proportional to the density of the proposed glass. The optical properties of the glasses are determined through the absorption spectra obtained from the UV-VIS spectrophotometer. From the absorption spectra, the indirect and direct optical band gaps and the Urbach energy are found to be inversely proportional to each other. As the molar fraction of the Dy2O3 increased, the optical band gaps are observed to increase as opposed to the Urbach energy. For this glass system, the values of refractive index, electronic polarizability, oxide ion polarizability and the optical basicity are found to decrease as the addition of the dysprosium oxide is increased. From the emission spectra, two intense blue and yellow emission bands are observed, which correspond to the 4F9/2 → 6H15/2 and 4F9/2 → 6H13/2 transitions of Dy3 + ions respectively. The CIE chromaticity coordinates of the zinc borotellurite glass systems are found to be located in the white light region. Generation of white light The generation of the white light can be achieved by using two emission bands which comprise of the yellow
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2011 CFR
2011-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2014 CFR
2014-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2010 CFR
2010-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2012 CFR
2012-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
21 CFR 516.163 - Change in ownership of an index file.
Code of Federal Regulations, 2013 CFR
2013-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
Cytogenetic evaluation of 163 azoospermics.
Rivas, F; Garcia-Esquivel, L; Diaz, M; Rivera, H; Cantu, J M
1987-08-01
A constitutional chromosomal aberration was diagnosed in 38/163 (23.3%) azoospermic patients. Whereas the 47,XXY complement was the commonest (31/38 cases), the following abnormal karyotypes were also found: 46,XX; 46,X,del(Y) (q11); 46,X,r(Y); 46,XY,inv(1) (p3500q21.3)mat; and 46,Y,t(X;3) (q26;q13.2)mat (both the deleted and the annular Y were observed twice). Pooled data from the literature showed that the frequency of chromosomal abnormalities is higher in azoospermic (150.4/1000) than in infertile (55.3/1000) males, which in turn is higher than in newborns (less than 6/1000). The observed different frequency between azoospermic and infertile individuals is given by several types of chromosomal abnormalities, mainly by the complement 47,XXY. The analysis also showed that the male infertility secondary to rob translocations and supernumerary marker chromosomes is usually not related to azoospermia. The contrary occurs in certain rcp and gonosome;autosome translocations and in autosome inversions.
Bi, Weimin; Cheung, Sau-Wai; Breman, Amy M; Bacino, Carlos A
2016-10-01
Deletions in the 4p16.3 region cause Wolf-Hirschhorn syndrome, a well known contiguous microdeletion syndrome with the critical region for common phenotype mapped in WHSCR2. Recently, duplications in 4p16.3 were reported in three patients with developmental delay and dysmorphic features. Through chromosomal microarray analysis, we identified 156 patients with a deletion (n = 109) or duplication (n = 47) in 4p16.3 out of approximately 60,000 patients analyzed by Baylor Miraca Genetics Laboratories. Seventy-five of the postnatally detected deletions encompassed the entire critical region, 32 (43%) of which were associated with other chromosome rearrangements, including six patients (8%) that had a duplication adjacent to the terminal deletion. Our data indicate that Wolf-Hirschhorn syndrome deletions with an adjacent duplication occur at a higher frequency than previously appreciated. Pure deletions (n = 14) or duplications (n = 15) without other copy number changes distal to or inside the WHSCR2 were identified for mapping of critical regions. Our data suggest that deletion of the segment from 0.6 to 0.9 Mb from the terminus of 4p causes a seizure phenotype and duplications of a region distal to the previously defined smallest region of overlap for 4p16.3 microduplication syndrome are associated with neurodevelopmental problems. We detected seven Wolf-Hirschhorn syndrome deletions and one 4p16.3 duplication prenatally; all of the seven are either >8 Mb in size and/or associated with large duplications. In conclusion, our study provides deeper insight into the molecular mechanisms, the critical regions and effective prenatal diagnosis for 4p16.3 deletions/ duplications. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test for gases and vapors; Type C supplied-air respirators, demand and pressure-demand classes; test requirements. 84.163 Section 84.163 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF...
A NEW LARGE SUPER-FAST ROTATOR: (335433) 2005 UW163
DOE Office of Scientific and Technical Information (OSTI.GOV)
Chang, Chan-Kao; Lin, Hsing-Wen; Ip, Wing-Huen
2014-08-20
Asteroids of size larger than 150 m generally do not have rotation periods smaller than 2.2 hr. This spin cutoff is believed to be due to the gravitationally bound rubble-pile structures of the asteroids. Rotation with periods exceeding this critical value will cause asteroid breakup. Up until now, only one object, 2001 OE84, has been found to be an exception to this spin cutoff. We report the discovery of a new super-fast rotator, (335433) 2005 UW163, spinning with a period of 1.290 hr and a light curve variation of r' ∼ 0.8 mag from the observations made at the P48 telescope andmore » the P200 telescope of the Palomar Observatory. Its H{sub r{sup ′}}=17.69±0.27 mag and multi-band colors (i.e., g' – r' = 0.68 ± 0.03 mag, r' – i' = 0.19 ± 0.02 mag and SDSS i – z = –0.45 mag) show it is a V-type asteroid with a diameter of 0.6 + 0.3/ – 0.2 km. This indicates (335433) 2005 UW163 is a super-fast rotator beyond the regime of the small monolithic asteroid.« less
Graversen, Jonas H; Svendsen, Pia; Dagnæs-Hansen, Frederik; Dal, Jakob; Anton, Gabriele; Etzerodt, Anders; Petersen, Mikkel D; Christensen, Peter A; Møller, Holger J; Moestrup, Søren K
2012-01-01
Synthetic glucocorticoids are potent anti-inflammatory drugs but serious side effects such as bone mobilization, muscle mass loss, immunosuppression, and metabolic alterations make glucocorticoid therapy a difficult balance. The therapeutic anti-inflammatory effect of glucocorticoids relies largely on the suppressed release of tumor-necrosis factor-α and other cytokines by macrophages at the sites of inflammation. We have now developed a new biodegradable anti-CD163 antibody-drug conjugate that specifically targets the glucocorticoid, dexamethasone to the hemoglobin scavenger receptor CD163 in macrophages. The conjugate, that in average contains four dexamethasone molecules per antibody, exhibits retained high functional affinity for CD163. In vitro studies in rat macrophages and in vivo studies of Lewis rats showed a strong anti-inflammatory effect of the conjugate measured as reduced lipopolysaccharide-induced secretion of tumor-necrosis factor-α. The in vivo potency of conjugated dexamethasone was about 50-fold that of nonconjugated dexamethasone. In contrast to a strong systemic effect of nonconjugated dexamethasone, the equipotent dose of the conjugate had no such effect, measured as thymus lymphocytes apoptosis, body weight loss, and suppression of endogenous cortisol levels. In conclusion, the study shows antibody-drug conjugates as a future approach in anti-inflammatory macrophage-directed therapy. Furthermore, the data demonstrate CD163 as an excellent macrophage target for anti-inflammatory drug delivery. PMID:22643864
Persistent high plasma levels of sCD163 and sCD14 in adult patients with measles virus infection.
Mascia, Claudia; Pozzetto, Irene; Kertusha, Blerta; Marocco, Raffaella; Del Borgo, Cosmo; Tieghi, Tiziana; Vita, Serena; Savinelli, Stefano; Iannetta, Marco; Vullo, Vincenzo; Lichtner, Miriam; Mastroianni, Claudio Maria
2018-01-01
Measles is an infectious disease that represents a serious public health problem worldwide, being associated with increased susceptibility to secondary infections, especially in the respiratory and gastrointestinal tracts. The aim of this study was to evaluate sCD163 and sCD14 levels in measles virus (MV) infected patients, as markers of immune activation, in order to better understand their role in the pathogenesis of the disease. TNF-α plasma levels were also evaluated. sCD163, sCD14 and TNF-α were measured by ELISA in plasma samples of 27 MV infected patients and 27 healthy donors (HD) included as controls. At the time of hospital admission, sCD163 and sCD14 levels were significantly higher in MV infected patients than in HD, while a decrease in TNF-α levels were found even if without statistical significance. sCD163 and sCD14 levels were significantly decreased after two months from acute infection compared to hospital admission although they remained significantly higher compared to HD. TNF-α levels increased significantly during the follow-up period. Considering clinical parameters, sCD163 levels positively correlated with aspartate aminotransferase, white blood cell count and neutrophils rate, while negatively correlated with the lymphocyte percentage. sCD14 levels positively correlated with the neutrophil and lymphocyte percentages. These results indicate that, despite the resolution of symptoms, an important macrophage/monocyte activation persists in measles patients, even after two months from infection.
Beltrán, Luis M.; García Morillo, José S.; Egido, Jesús; Noval, Manuel Leal; Ferrando-Martinez, Sara; Blanco-Colio, Luis M.; Genebat, Miguel; Villar, José R.; Moreno-Luna, Rafael; Moreno, Juan Antonio
2014-01-01
Background Patients infected with the human immunodeficiency virus (HIV) have an increased risk of cardiovascular disease due to increased inflammation and persistent immune activation. CD163 is a macrophage scavenger receptor that is involved in monocyte-macrophage activation in HIV-infected patients. CD163 interacts with TWEAK, a member of the TNF superfamily. Circulating levels of sTWEAK and sCD163 have been previously associated with cardiovascular disease, but no previous studies have fully analyzed their association with HIV. Objective The aim of this study was to analyze circulating levels of sTWEAK and sCD163 as well as other known markers of inflammation (hsCRP, IL-6 and sTNFRII) and endothelial dysfunction (sVCAM-1 and ADMA) in 26 patients with HIV before and after 48 weeks of antiretroviral treatment (ART) and 23 healthy subjects. Results Patients with HIV had reduced sTWEAK levels and increased sCD163, sVCAM-1, ADMA, hsCRP, IL-6 and sTNFRII plasma concentrations, as well as increased sCD163/sTWEAK ratio, compared with healthy subjects. Antiretroviral treatment significantly reduced the concentrations of sCD163, sVCAM-1, hsCRP and sTNFRII, although they remained elevated when compared with healthy subjects. Antiretroviral treatment had no effect on the concentrations of ADMA and sTWEAK, biomarkers associated with endothelial function. The use of protease inhibitors as part of antiretroviral therapy and the presence of HCV-HIV co-infection and/or active HIV replication attenuated the ART-mediated decrease in sCD163 plasma concentrations. Conclusion HIV-infected patients showed a proatherogenic profile characterized by increased inflammatory, immune-activation and endothelial-dysfunction biomarkers that partially improved after ART. HCV-HIV co-infection and/or active HIV replication enhanced immune activation despite ART. PMID:24594990
47 CFR 80.163 - Operator requirements of the Bridge-to-Bridge Act.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 47 Telecommunication 5 2011-10-01 2011-10-01 false Operator requirements of the Bridge-to-Bridge... Requirements § 80.163 Operator requirements of the Bridge-to-Bridge Act. Each ship subject to the Bridge-to-Bridge Act must have on board a radio operator who holds a restricted radiotelephone operator permit or...
47 CFR 80.163 - Operator requirements of the Bridge-to-Bridge Act.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Operator requirements of the Bridge-to-Bridge... Requirements § 80.163 Operator requirements of the Bridge-to-Bridge Act. Each ship subject to the Bridge-to-Bridge Act must have on board a radio operator who holds a restricted radiotelephone operator permit or...
49 CFR 40.163 - How does the MRO report drug test results?
Code of Federal Regulations, 2012 CFR
2012-10-01
... for the test, if indicated on the CCF (e.g., random, post-accident); (4) Date of the collection; (5... 49 Transportation 1 2012-10-01 2012-10-01 false How does the MRO report drug test results? 40.163... How does the MRO report drug test results? (a) As the MRO, it is your responsibility to report all...
49 CFR 40.163 - How does the MRO report drug test results?
Code of Federal Regulations, 2011 CFR
2011-10-01
... for the test, if indicated on the CCF (e.g., random, post-accident); (4) Date of the collection; (5... 49 Transportation 1 2011-10-01 2011-10-01 false How does the MRO report drug test results? 40.163... How does the MRO report drug test results? (a) As the MRO, it is your responsibility to report all...
49 CFR 40.163 - How does the MRO report drug test results?
Code of Federal Regulations, 2013 CFR
2013-10-01
... for the test, if indicated on the CCF (e.g., random, post-accident); (4) Date of the collection; (5... 49 Transportation 1 2013-10-01 2013-10-01 false How does the MRO report drug test results? 40.163... How does the MRO report drug test results? (a) As the MRO, it is your responsibility to report all...
26 CFR 1.163-8T - Allocation of interest expense among expenditures (temporary).
Code of Federal Regulations, 2011 CFR
2011-04-01
... applying sections 469 (the “passive loss limitation”) and 163 (d) and (h) (the “nonbusiness interest... expense is allocated for the purposes of applying the passive loss limitation and nonbusiness interest... paragraph (m) of this section (relating to limitations on interest expense other than the passive loss and...
Rojo-Martínez, Gemma; Maymó-Masip, Elsa; Rodríguez, M. Mar; Solano, Esther; Goday, Albert; Soriguer, Federico; Valdés, Sergio; Chaves, Felipe Javier; Delgado, Elías; Colomo, Natalia; Hernández, Pilar
2014-01-01
Objective Serum levels of soluble TNF-like weak inducer of apoptosis (sTWEAK) and its scavenger receptor CD163 (sCD163) have been linked to insulin resistance. We analysed the usefulness of these cytokines as biomarkers of type 2 diabetes in a Spanish cohort, together with their relationship to food consumption in the setting of the Di@bet.es study. Research Design and Methods This is a cross-sectional, matched case-control study of 514 type 2 diabetes subjects and 517 controls with a Normal Oral Glucose Tolerance Test (NOGTT), using data from the Di@bet.es study. Study variables included clinical and demographic structured survey, food frequency questionnaire and physical examination. Serum concentrations of sTWEAK and sCD163 were measured by ELISA. Linear regression analysis determined which variables were related to sTWEAK and sCD163 levels. Logistic regression analysis was used to estimate odd ratios of presenting type 2 diabetes. Results sCD163 concentrations and sCD163/sTWEAK ratio were 11.0% and 15.0% higher, respectively, (P<0.001) in type 2 diabetes than in controls. Following adjustment for various confounders, the OR for presenting type 2 diabetes in subjects in the highest vs the lowest tertile of sCD163 was [(OR), 2,01 (95%CI, 1,46–2,97); P for trend <0.001]. Coffee and red wine consumption was negatively associated with serum levels of sCD163 (P = 0.0001 and; P = 0.002 for coffee and red wine intake, respectively). Conclusions High circulating levels of sCD163 are associated with type 2 diabetes in the Spanish population. The association between coffee and red wine intake and these biomarkers deserves further study to confirm its potential role in type 2 diabetes. PMID:24978196
Rojo-Martínez, Gemma; Maymó-Masip, Elsa; Rodríguez, M Mar; Solano, Esther; Goday, Albert; Soriguer, Federico; Valdés, Sergio; Chaves, Felipe Javier; Delgado, Elías; Colomo, Natalia; Hernández, Pilar; Vendrell, Joan; Chacón, Matilde R
2014-01-01
Serum levels of soluble TNF-like weak inducer of apoptosis (sTWEAK) and its scavenger receptor CD163 (sCD163) have been linked to insulin resistance. We analysed the usefulness of these cytokines as biomarkers of type 2 diabetes in a Spanish cohort, together with their relationship to food consumption in the setting of the Di@bet.es study. This is a cross-sectional, matched case-control study of 514 type 2 diabetes subjects and 517 controls with a Normal Oral Glucose Tolerance Test (NOGTT), using data from the Di@bet.es study. Study variables included clinical and demographic structured survey, food frequency questionnaire and physical examination. Serum concentrations of sTWEAK and sCD163 were measured by ELISA. Linear regression analysis determined which variables were related to sTWEAK and sCD163 levels. Logistic regression analysis was used to estimate odd ratios of presenting type 2 diabetes. sCD163 concentrations and sCD163/sTWEAK ratio were 11.0% and 15.0% higher, respectively, (P<0.001) in type 2 diabetes than in controls. Following adjustment for various confounders, the OR for presenting type 2 diabetes in subjects in the highest vs the lowest tertile of sCD163 was [(OR), 2,01 (95%CI, 1,46-2,97); P for trend <0.001]. Coffee and red wine consumption was negatively associated with serum levels of sCD163 (P = 0.0001 and; P = 0.002 for coffee and red wine intake, respectively). High circulating levels of sCD163 are associated with type 2 diabetes in the Spanish population. The association between coffee and red wine intake and these biomarkers deserves further study to confirm its potential role in type 2 diabetes.
75 FR 41801 - Expansion of Foreign-Trade Zone 163, Ponce, Puerto Rico, Area
Federal Register 2010, 2011, 2012, 2013, 2014
2010-07-19
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1692] Expansion of Foreign-Trade Zone 163, Ponce, Puerto Rico, Area Pursuant to its authority under the Foreign-Trade Zones Act of June 18... include a site at the ProCaribe Industrial Park (Site 11) in Penuelas, Puerto Rico, adjacent to the Ponce...
75 FR 41801 - Expansion of Foreign-Trade Zone 163 Ponce, Puerto Rico, Area
Federal Register 2010, 2011, 2012, 2013, 2014
2010-07-19
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1693] Expansion of Foreign-Trade Zone 163 Ponce, Puerto Rico, Area Pursuant to its authority under the Foreign-Trade Zones Act of June 18..., Puerto Rico, within the Ponce Customs and Border Protection port of entry (FTZ Docket 17-2010, filed 3/8...
Melo, Fernando Menegatti de; Almeida, Sabrina da Nobrega; Uezu, Noemi Saori; Ramirez, Carlos Alberto Ospina; Santos, Antonio Domingues Dos; Toma, Henrique Eisi
2018-06-01
The extraction of dysprosium (Dy3+) ions from aqueous solution was carried out successfully, using magnetite (Fe3O4) nanoparticles functionalized with diethylenetriaminepentaacetic acid (MagNP@DTPA). The process was monitored by energy dispersive X-ray fluorescence spectroscopy, as a function of concentration, proceeding according to a Langmuir isotherm with an equilibrium constant of 2.57 × 10-3 g(MagNP) L-1 and a saturation limit of 63.2 mgDy/gMagNP. The presence of paramagnetic Dy3+ ions attached to the superparamagnetic nanoparticles led to an overall decrease of magnetization. By imaging the nanoparticles surface using scanning transmission electron microscopy equipped with high resolution elemental analysis, it was possible to probe the binding of the Dy3+ ions to DTPA, and to show their distribution in a region of negative magnetic field gradients. This finding is coherent with the observed decrease of magnetization, associated with the antiferromagnetic coupling between the lanthanide ions and the Fe3O4 core.
Castley, Alison; Williams, Leah; James, Ian; Guelfi, George; Berry, Cassandra; Nolan, David
2016-01-01
We investigate the associations of three established plasma biomarkers in the context of HIV and treatment-related variables including a comprehensive cardiovascular disease risk assessment, within a large ambulatory HIV cohort. Patients were recruited in 2010 to form the Royal Perth Hospital HIV/CVD risk cohort. Plasma sCD14, sCD163 and CXCL10 levels were measured in 475 consecutive patients with documented CVD risk (age, ethnicity, gender, smoking, blood pressure, BMI, fasting metabolic profile) and HIV treatment history including immunological/virological outcomes. The biomarkers assessed showed distinct associations with virological response: CXCL10 strongly correlated with HIV-1 RNA (p<0.001), sCD163 was significantly reduced among ‘aviraemic’ patients only (p = 0.02), while sCD14 was unaffected by virological status under 10,000 copies/mL (p>0.2). Associations between higher sCD163 and protease inhibitor therapy (p = 0.05) and lower sCD14 with integrase inhibitor therapy (p = 0.02) were observed. Levels of sCD163 were also associated with CVD risk factors (age, ethnicity, HDL, BMI), with a favourable influence of Framingham score <10% (p = 0.04). Soluble CD14 levels were higher among smokers (p = 0.002), with no effect of other CVD risk factors, except age (p = 0.045). Our findings confirm CXCL10, sCD163 and sCD14 have distinct associations with different aspects of HIV infection and treatment. Levels of CXCL10 correlated with routinely monitored variables, sCD163 levels reflect a deeper level of virological suppression and influence of CVD risk factors, while sCD14 levels were not associated with routinely monitored variables, with evidence of specific effects of smoking and integrase inhibitor therapy warranting further investigation. PMID:27355513
Distribution of CD163-positive cell and MHC class II-positive cell in the normal equine uveal tract.
Sano, Yuto; Matsuda, Kazuya; Okamoto, Minoru; Takehana, Kazushige; Hirayama, Kazuko; Taniyama, Hiroyuki
2016-02-01
Antigen-presenting cells (APCs) in the uveal tract participate in ocular immunity including immune homeostasis and the pathogenesis of uveitis. In horses, although uveitis is the most common ocular disorder, little is known about ocular immunity, such as the distribution of APCs. In this study, we investigated the distribution of CD163-positive and MHC II-positive cells in the normal equine uveal tract using an immunofluorescence technique. Eleven eyes from 10 Thoroughbred horses aged 1 to 24 years old were used. Indirect immunofluorescence was performed using the primary antibodies CD163, MHC class II (MHC II) and CD20. To demonstrate the site of their greatest distribution, positive cells were manually counted in 3 different parts of the uveal tract (ciliary body, iris and choroid), and their average number was assessed by statistical analysis. The distribution of pleomorphic CD163- and MHC II-expressed cells was detected throughout the equine uveal tract, but no CD20-expressed cells were detected. The statistical analysis demonstrated the distribution of CD163- and MHC II-positive cells focusing on the ciliary body. These results demonstrated that the ciliary body is the largest site of their distribution in the normal equine uveal tract, and the ciliary body is considered to play important roles in uveal and/or ocular immune homeostasis. The data provided in this study will help further understanding of equine ocular immunity in the normal state and might be beneficial for understanding of mechanisms of ocular disorders, such as equine uveitis.
Garvin, Stina; Oda, Husam; Arnesson, Lars-Gunnar; Lindström, Annelie; Shabo, Ivan
2018-07-01
Cancer cell fusion with macrophages results in highly tumorigenic hybrids that acquire genetic and phenotypic characteristics from both maternal cells. Macrophage traits, exemplified by CD163 expression, in tumor cells are associated with advanced stages and poor prognosis in breast cancer (BC). In vitro data suggest that cancer cells expressing CD163 acquire radioresistance. Tissue microarray was constructed from primary BC obtained from 83 patients treated with breast-conserving surgery, 50% having received postoperative radiotherapy (RT) and none of the patients had lymph node or distant metastasis. Immunostaining of CD163 in cancer cells and macrophage infiltration (MI) in tumor stroma were evaluated. Macrophage:MCF-7 hybrids were generated by spontaneous in vitro cell fusion. After irradiation (0, 2.5 and 5 Gy γ-radiation), both hybrids and their maternal MCF-7 cells were examined by clonogenic survival. CD163-expression by cancer cells was significantly associated with MI and clinicopathological data. Patients with CD163-positive tumors had significantly shorter disease-free survival (DFS) after RT. In vitro generated macrophage:MCF-7 hybrids developed radioresistance and exhibited better survival and colony forming ability after radiation compared to maternal MCF-7 cancer cells. Our results suggest that macrophage phenotype in tumor cells results in radioresistance in breast cancer and shorter DFS after radiotherapy.
NASA Technical Reports Server (NTRS)
Ranitzsch, P. C.-O.; Porst, J.-P.; Kempf, S.; Pies, C.; Schafer, S.; Hengstler, D.; Fleischmann, A.; Enss, C.; Gastaldo, L.
2012-01-01
The measurement of calorimetric spectra following atomic weak decays, beta (b) and electron capture (EC), of nuclides having a very low Q-value, can provide an impressively high sensitivity to a non-vanishing neutrino mass. The achievable sensitivity in this kind of experiments is directly connected to the performance of the used detectors. In particular an energy resolution of a few eV and a pulse formation time well below 1 microsecond are required. Low temperature Metallic Magnetic Calorimeters (MMCs) for soft X-rays have already shown an energy resolution of 2.0 eV FWHM and a pulse rise-time of about 90 ns for fully micro-fabricated detectors. We present the use of MMCs for high precision measurements of calorimetric spectra following the beta-decay of Re-187 and the EC of Ho-163. We show results obtained with detectors optimized for Re-187 and for Ho-163 experiments respectively. While the detectors equipped with superconducting Re absorbers have not yet reached the aimed performance, a first detector prototype with a Au absorber having implanted Ho-163 ions already shows excellent results. An energy resolution of 12 eV FWHM and a rise time of 90 ns were measured.
Shu, Xinhua; Luhmann, Ulrich F. O.; Aleman, Tomas S.; Barker, Susan E.; Lennon, Alan; Tulloch, Brian; Chen, Mei; Xu, Heping; Jacobson, Samuel G.; Ali, Robin; Wright, Alan F.
2011-01-01
A single founder mutation resulting in a Ser163Arg substitution in the C1QTNF5 gene product causes autosomal dominant late-onset retinal macular degeneration (L-ORMD) in humans, which has clinical and pathological features resembling age-related macular degeneration. We generated and characterised a mouse “knock-in” model carrying the Ser163Arg mutation in the orthologous murine C1qtnf5 gene by site-directed mutagenesis and homologous recombination into mouse embryonic stem cells. Biochemical, immunological, electron microscopic, fundus autofluorescence, electroretinography and laser photocoagulation analyses were used to characterise the mouse model. Heterozygous and homozygous knock-in mice showed no significant abnormality in any of the above measures at time points up to 2 years. This result contrasts with another C1qtnf5 Ser163Arg knock-in mouse which showed most of the features of L-ORMD but differed in genetic background and targeting construct. PMID:22110650
Hu, He; Zhang, Yifan; Shukla, Sourabh; Gu, Yuning; Yu, Xin; Steinmetz, Nicole F
2017-09-26
The increasing prevalence of ultra-high-field magnetic resonance imaging (UHFMRI) in biomedical research and clinical settings will improve the resolution and diagnostic accuracy of MRI scans. However, better contrast agents are needed to achieve a satisfactory signal-to-noise ratio. Here, we report the synthesis of a bimodal contrast agent prepared by loading the internal cavity of tobacco mosaic virus (TMV) nanoparticles with a dysprosium (Dy 3+ ) complex and the near-infrared fluorescence (NIRF) dye Cy7.5. The external surface of TMV was conjugated with an Asp-Gly-Glu-Ala (DGEA) peptide via a polyethylene glycol linker to target integrin α 2 β 1 . The resulting nanoparticle (Dy-Cy7.5-TMV-DGEA) was stable and achieved a high transverse relaxivity in ultra-high-strength magnetic fields (326 and 399 mM -1 s -1 at 7 and 9.4 T, respectively). The contrast agent was also biocompatible (low cytotoxicity) and targeted PC-3 prostate cancer cells and tumors in vitro and in vivo as confirmed by bimodal NIRF imaging and T 2 -mapping UHFMRI. Our results show that Dy-Cy7.5-TMV-DGEA is suitable for multiscale MRI scanning from the cellular level to the whole body, particularly in the context of UHFMRI applications.
Tárkányi, F; Ditrói, F; Takács, S; Hermanne, A; Ignatyuk, A V
2015-04-01
Activation cross-sections data of longer-lived products of proton induced nuclear reactions on dysprosium were extended up to 65MeV by using stacked foil irradiation and gamma spectrometry experimental methods. Experimental cross-sections data for the formation of the radionuclides (159)Dy, (157)Dy, (155)Dy, (161)Tb, (160)Tb, (156)Tb, (155)Tb, (154m2)Tb, (154m1)Tb, (154g)Tb, (153)Tb, (152)Tb and (151)Tb are reported in the 36-65MeV energy range, and compared with an old dataset from 1964. The experimental data were also compared with the results of cross section calculations of the ALICE and EMPIRE nuclear model codes and of the TALYS nuclear reaction model code as listed in the latest on-line libraries TENDL 2013. Copyright © 2015. Published by Elsevier Ltd.
Hattori, Akiko; Takemoto, Minoru; Tokuyama, Hirotake; Koshizaka, Masaya; Yokote, Koutaro
2017-04-01
Dipeptidyl peptidase-4 inhibitor (DPP-4i) is commonly used worldwide for the treatment of type 2 diabetes mellitus. In addition to its hypoglycemic activity, DPP-4i might have anti-inflammatory effects. In this study we examined the effects of DPP-4i on the serum levels of soluble CD163 (sCD163), a marker for activated macrophages, in individuals with type 2 diabetes mellitus. We compared these anti-inflammatory effects with those of α glucosidase inhibitor (αGI). Japanese patients with type 2 diabetes mellitus who were stably maintained on ≤2mg/day glimepiride alone were recruited and randomly assigned to receive additional sitagliptin (n=37) or αGI (n=37). Levels of sCD163 were measured before the addition and after a 24-week treatment period. Addition of sitagliptin significantly reduced the serum sCD163 (632 vs. 575ng/mL, p<0.05), while αGI did not display this effect (624 vs. 607ng/mL). The changes in levels of sCD163 were not related to changes in either HbA1c or body mass index (BMI). Our results suggested that DPP-4i might exert anti-inflammatory effects in individuals with type 2 diabetes mellitus, which are independent of its effects on glycemia and BMI. Copyright © 2017 Elsevier B.V. All rights reserved.
Conlon, J M; Eriksson, B; Grimelius, L; Oberg, K; Thim, L
1987-11-15
By using only reverse-phase h.p.l.c., three fragments of prosomatostatin were isolated from an extract of a human pancreatic neuroendocrine tumour that produced somatostatin, vasoactive intestinal polypeptide and gastrin-releasing peptide. The amino acid composition of the peptides indicated that they represented prosomatostatin-(1-63)-peptide, prosomatostain-(65-76)-peptide and prosomatostatin-(79-92)-peptide (somatostatin-14). The identity of prosomatostatin-(1-63)-peptide was confirmed by characterization of the products of digestion with Armillaria mellea (honey fungus) proteinase. Partial micro-sequencing of prosomatostatin-(1-63)-peptide showed that the Gly24-Ala25 bond of preprosomatostatin was the site of cleavage of the signal peptide. Thus human prosomatostatin is a protein of 92 amino acid residues that is proteolytically cleaved in a pancreatic tumour at the site of a dibasic-residue (arginine-lysine) processing site and at a single-monobasic-residue (arginine) processing site.
33 CFR 165.163 - Safety Zones; Port of New York/New Jersey Fleet Week.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zones; Port of New York... § 165.163 Safety Zones; Port of New York/New Jersey Fleet Week. (a) The following areas are established... parade vessels as it transits the Port of New York and New Jersey from the Verrazano Narrows Bridge to...
Paszkowicz, Wojciech; Ermakova, Olga; López-Solano, Javier; Mujica, Andrés; Muñoz, Alfonso; Minikayev, Roman; Lathe, Christian; Gierlotka, Stanisław; Nikolaenko, Irina; Dabkowska, Hanna
2014-01-15
Dysprosium orthovanadate, DyVO4, belongs to a family of zircon-type orthovanadates showing a phase transition to scheelite-type structures at moderate pressures below 10 GPa. In the present study, the equations of state (EOSs) for both these phases were determined for the first time using high-pressure x-ray diffraction experiments and ab initio calculations based on the density functional theory. Structural parameters for scheelite-type DyVO4 were calculated from x-ray powder diffraction data as well. The high-pressure experiments were performed under pseudo-hydrostatic conditions at pressures up to 8.44 GPa and 5.5 GPa for the stable zircon-type and metastable (quenched) scheelite-type samples, respectively. Assuming as a compression model the Birch-Murnaghan EOS, we obtained the EOS parameters for both phases. The experimental bulk moduli (K0) for zircon-type and scheelite-type DyVO4 are 118(4) GPa and 153(6) GPa, respectively. Theoretical equations of state were determined by ab initio calculations using the PBE exchange-correlation energy functional of Perdew, Burke, and Ernzerhof. These calculations provide K0 values of 126.1 GPa and 142.9 GPa for zircon-type and scheelite-type DyVO4, respectively. The reliability of the present experimental and theoretical results is supported by (i) the consistency between the values yielded by the two methods (the discrepancy in K0 is as low as about 7% for each of the studied polymorphs) and (ii) their similarity to results obtained under similar compression conditions (hydrostatic or pseudo-hydrostatic) for other rare-earth orthovanadates, such as YVO4 and TbVO4.
19 CFR 163.6 - Production and examination of entry and other records and witnesses; penalties.
Code of Federal Regulations, 2010 CFR
2010-04-01
... written, oral, or electronic notice, any Customs officer may require the production of entry records by... 19 Customs Duties 2 2010-04-01 2010-04-01 false Production and examination of entry and other..., DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.6 Production and...
Code of Federal Regulations, 2014 CFR
2014-01-01
... 12 Banks and Banking 1 2014-01-01 2014-01-01 false Inclusion of subordinated debt securities and... Borrowings § 163.81 Inclusion of subordinated debt securities and mandatorily redeemable preferred stock as... 12 CFR part 116, subpart A seeking the OCC's approval of, or non-objection to, the inclusion of...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 12 Banks and Banking 1 2012-01-01 2012-01-01 false Inclusion of subordinated debt securities and... Borrowings § 163.81 Inclusion of subordinated debt securities and mandatorily redeemable preferred stock as... 12 CFR part 116, subpart A seeking the OCC's approval of, or non-objection to, the inclusion of...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 12 Banks and Banking 1 2013-01-01 2013-01-01 false Inclusion of subordinated debt securities and... Borrowings § 163.81 Inclusion of subordinated debt securities and mandatorily redeemable preferred stock as... 12 CFR part 116, subpart A seeking the OCC's approval of, or non-objection to, the inclusion of...
A 'Pot of Gold' Rich with Nuggets (Sol 163)
NASA Technical Reports Server (NTRS)
2004-01-01
This close-up image taken by the Mars Exploration Rover Spirit highlights the nodular nuggets that cover the rock dubbed 'Pot of Gold.' These nuggets appear to stand on the end of stalk-like features. The surface of the rock is dotted with fine-scale pits. Data from the rover's scientific instruments have shown that Pot of Gold contains the mineral hematite, which can be formed with or without water. Scientists are planning further observations of this rock, which they hope will yield more insight into the hematite's origins as well as how the enigmatic nuggets formed. This image was taken by Spirit's microscopic imager on sol 163 (June 18, 2004). The observed area is 3 centimeters by 3 centimeters (1.2 inches by 1.2 inches).The Natural History of Epilepsy in 163 Untreated Patients: Looking for “Oligoepilepsy”
Gasparini, Sara; Ferlazzo, Edoardo; Leonardi, Cinzia Grazia; Cianci, Vittoria; Mumoli, Laura; Sueri, Chiara; Labate, Angelo; Gambardella, Antonio; Aguglia, Umberto
2016-01-01
The clinical evolution of untreated epilepsy has been rarely studied in developed countries, and the existence of a distinct syndrome characterized by rarely repeated seizures (oligoepilepsy) is debated. The aim of this study is to assess the natural history of 163 untreated patients with epilepsy in order to evaluate whether oligoepilepsy retains specific features. We retrospectively evaluated 7344 patients with ≥2 unprovoked seizures. Inclusion criteria: sufficient anamnestic/EEG data, disease duration ≥10 years, follow-up ≥3 years. Exclusion criteria: psychogenic seizures, natural history of disease <5 years. The 163 included subjects were divided into 2 groups according to seizure frequency: oligoepilepsy (≤1/year; 47 subjects) and controls (>1/year; 116 subjects). We also evaluated seizure frequency during the natural history. There were no differences between groups regarding duration of natural history, family history of epilepsy/febrile seizures, interictal EEG. Subjects with oligoepilepsy differed from controls in terms of sex (females 38% vs. 58%, p = 0.03) and drug resistance (6% vs 28%; p = 0.003). Juvenile myoclonic epilepsy was more frequent in controls (9.5% vs 0%, p = 0.04). Patients with oligoepilepsy, differently from controls, had stable seizure frequency. Oligoepilepsy represents a favourable evolution of different epileptic syndromes and keeps a stable seizure frequency over time. PMID:27657542
UVB-induced gene expression in the skin of Xiphophorus maculatus Jp 163 B☆
Yang, Kuan; Boswell, Mikki; Walter, Dylan J.; Downs, Kevin P.; Gaston-Pravia, Kimberly; Garcia, Tzintzuni; Shen, Yingjia; Mitchell, David L.; Walter, Ronald B.
2014-01-01
Xiphophorus fish and interspecies hybrids represent long-standing models to study the genetics underlying spontaneous and induced tumorigenesis. The recent release of the Xiphophorus maculatus genome sequence will allow global genetic regulation studies of genes involved in the inherited susceptibility to UVB-induced melanoma within select backcross hybrids. As a first step toward this goal, we report results of an RNA-Seq approach to identify genes and pathways showing modulated transcription within the skin of X. maculatus Jp 163 B upon UVB exposure. X. maculatus Jp 163 B were exposed to various doses of UVB followed by RNA-Seq analysis at each dose to investigate overall gene expression in each sample. A total of 357 genes with a minimum expression change of 4-fold (p-adj < 0.05) were identified as responsive to UVB. The molecular genetic response of Xiphophorus skin to UVB exposure permitted assessment of; (1) the basal expression level of each transcript for each skin sample, (2) the changes in expression levels for each gene in the transcriptome upon exposure to increasing doses of UVB, and (3) clusters of genes that exhibit similar patterns of change in expression upon UVB exposure. These data provide a foundation for understanding the molecular genetic response of fish skin to UVB exposure. PMID:24556253
Nowlin, Brian T.; Burdo, Tricia H.; Midkiff, Cecily C.; Salemi, Marco; Alvarez, Xavier; Williams, Kenneth C.
2016-01-01
Macrophage recruitment to the central nervous system (CNS) during AIDS pathogenesis is poorly understood. We measured the accumulation of brain perivascular (CD163+) and inflammatory (MAC387+) macrophages in SIV-infected monkeys. Monocyte progenitors were 5-bromo-2′-deoxyuridine (BrdU) labeled in bone marrow, and CNS macrophages were labeled serially with fluorescent dextrans injected into the cisterna magna. MAC387+ macrophages accumulated in the meninges and choroid plexus in early inflammation and in the perivascular space and SIV encephalitis (SIVE) lesions late. CD163+ macrophages accumulated in the perivascular space and SIVE lesions with late inflammation. Most of the BrdU+ cells were MAC387+; however, CD163+BrdU+ macrophages were present in the meninges and choroid plexus with AIDS. Most (81.6% ± 1.8%) of macrophages in SIVE lesions were present in the CNS before SIVE lesion formation. There was a 2.9-fold increase in SIVp28+ macrophages entering the CNS late compared with those entering early (P < 0.05). The rate of CD163+ macrophage recruitment to the CNS inversely correlated with time to death (P < 0.03) and increased with SIVE. In SIVE animals, soluble CD163 correlated with CD163+ macrophage recruitment (P = 0.02). Most perivascular macrophages that comprise SIVE lesions and multinucleated giant cells are present in the CNS early, before SIVE lesions are formed. Most SIV-infected macrophages traffic to the CNS terminally with AIDS. PMID:25963554
Code of Federal Regulations, 2014 CFR
2014-04-01
... EXCHANGE ACT Miscellaneous § 1.63 Service on self-regulatory organization governing boards or committees by... organization means a “self-regulatory organization” as defined in § 1.3(ee), and includes a “clearing... self-regulatory organization to issue disciplinary charges, to conduct disciplinary proceedings, to...
Code of Federal Regulations, 2013 CFR
2013-04-01
... EXCHANGE ACT Miscellaneous § 1.63 Service on self-regulatory organization governing boards or committees by... organization means a “self-regulatory organization” as defined in § 1.3(ee), and includes a “clearing... self-regulatory organization to issue disciplinary charges, to conduct disciplinary proceedings, to...
Han, Qinglin; Shi, Hongguang; Liu, Fan
2016-05-01
Osteosarcoma is one of the most common childhood cancers with high numbers of cancer-related deaths. Progress in conventional therapies is showing limited improvement. An adaptive T cell-based immunotherapy represents a promising new therapeutic option, but to improve its efficacy, regulatory mechanisms in osteosarcoma need further elucidation. Here, to evaluate the regulatory effect of tumor microenvironment of T cells in osteosarcoma, we examined the peripheral blood (PB) and tumor infiltrating (TI) T cells, and their correlations with PB and tumor immune characteristics. We found that TI T cells contained significantly higher levels of TIM-3(+)PD-1(-) and TIM-3(+)PD-1(+) cells than their PB counterparts. Similar to that in chronic HIV and HCV infections, these TIM-3(+)PD-1(-) and TIM-3(+)PD-1(+) T cells presented reduced proliferation and proinflammatory cytokine secretion in response to stimulation. Presence of M2-type (CD163(+)) macrophages exacerbated T cell immunosuppression, since frequencies of CD163(+) tumor-associated macrophages were directly correlated with the frequencies of suppressed TIM-3(+)PD-1(+) T cells. Moreover, depletion of CD163(+) macrophages significantly improved T cell proliferation and proinflammatory cytokine production. Overall, our data presented an intratumoral T cell-specific immunosuppression that was amplified by M2-type tumor-associated macrophages. Copyright © 2016. Published by Elsevier B.V.
Sun, Han-wen; Wu, Yuan-yuan; Li, Li-qing
2009-03-01
A novel trivalence dysprosium(Dy(3+))-sensitized chemiluminescence method was developed for the first time for the determination of enoxacin (ENX) using flow-injection sampling based on the chemiluminescence (CL) associated with the reaction of the Dy(3+)-cerium(Ce(IV))-S(2)O(3) (2-)-ENX system and the Dy(3+)-MnO(4) (-) S(2)O(3) (2-)-ENX system. The analytical conditions for CL emission were investigated and optimized. The relationship between the CL intensity of ENX and its concentration has good linearity, with a correlation coefficient of 0.9984-0.9994. The limit of detection (LOD, 3sigma) was 0.20 ng/mL for the Dy(3+)-ENX-S(2)O(3)(2-)-Ce(IV)-H(2)SO(4) system and 0.22 ng/mL for the Dy(3+)-ENX-S(2)O(3)(2-)-MnO(4) (-)-HNO(3) system. The relative standard deviation (RSD, n = 11) was 1.8% for 11 determinations of 60 ng/mL ENX. The proposed method was applied to the analysis of ENX in injections, serum and urine samples with a recovery of 98%-105%. A possible mechanism for this sensitized CL reaction is discussed by comparing the CL spectra with the fluorescence emission spectra. The proposed method represents a wide linear range, high sensitivity and accuracy, and can be used for the routine determination of ENX in pharmaceutical preparations and biological fluids. Copyright 2009 John Wiley & Sons, Ltd.
Pasteran, Fernando; Denorme, Laurence; Ote, Isabelle; Gomez, Sonia; De Belder, Denise; Glupczynski, Youri; Bogaerts, Pierre; Ghiglione, Barbara; Power, Pablo; Mertens, Pascal; Corso, Alejandra
2016-11-01
We assessed a novel immunochromatographic lateral flow assay for direct identification of OXA-48-like carbapenemases and accurate differentiation of allele variants with distinct substrate profiles (OXA-48 or OXA-163 subfamilies). The assay allowed rapid (less than 4 min) and reliable direct confirmation of OXA-163- and/or OXA-48-like enzymes (with 100% sensitivity and 100% specificity) from cultured colonies that were recovered from both solid medium and spiked blood culture bottles. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Code of Federal Regulations, 2011 CFR
2011-04-01
... EXCHANGE ACT Miscellaneous § 1.63 Service on self-regulatory organization governing boards or committees by... organization means a “self-regulatory organization” as defined in Commission regulation 1.3(ee) (§ 1.3(ee... committee of persons, or any subcommittee thereof, that is authorized by a self-regulatory organization to...
Code of Federal Regulations, 2012 CFR
2012-04-01
... EXCHANGE ACT Miscellaneous § 1.63 Service on self-regulatory organization governing boards or committees by... organization means a “self-regulatory organization” as defined in Commission regulation 1.3(ee) (§ 1.3(ee... committee of persons, or any subcommittee thereof, that is authorized by a self-regulatory organization to...
Code of Federal Regulations, 2010 CFR
2010-04-01
... EXCHANGE ACT Miscellaneous § 1.63 Service on self-regulatory organization governing boards or committees by... organization means a “self-regulatory organization” as defined in Commission regulation 1.3(ee) (§ 1.3(ee... committee of persons, or any subcommittee thereof, that is authorized by a self-regulatory organization to...
Deichgræber, Pia; Witte, Daniel R; Møller, Holger J; Skriver, Mette V; Richelsen, Bjørn; Jørgensen, Marit E; Johansen, Nanna B; Sandbæk, Annelli
2016-11-01
Our aim was to investigate the association between the macrophage-activation marker soluble CD163 (sCD163), adiponectin, C-reactive protein (CRP) and changes in glycaemia, insulin resistance and insulin secretion in individuals at high risk of type 2 diabetes mellitus. This prospective study included 1014 individuals at high risk of type 2 diabetes mellitus participating in the Danish arm of the Anglo-Danish-Dutch study of Intensive Treatment In PeOple with ScreeN-detected Diabetes in Primary Care (ADDITION-Europe trial) baseline examination in 2001-2006 and follow-up examination (ADDITION-Progression [ADDITION-PRO]) in 2009-2011. Baseline serum samples were analysed for sCD163, adiponectin and CRP. The associations between sCD163, adiponectin and CRP per doubling of concentration, and changes per year in HbA1c, fasting plasma glucose, 2 h glucose, fasting insulin, HOMA-IR and HOMA-β were assessed using a mixed-effects model. A doubling of sCD163 concentration was positively associated with changes in HOMA-β (β = 1.160 per year, 95% CI 0.345, 1.975) as well as a doubling of CRP concentration (β = 0.410 per year, 95% CI 0.051, 0.769) after adjustment for age and sex. A doubling of adiponectin was inversely associated with changes in 2 h glucose (β =-0.063 per year, 95% CI -0.111, -0.014), HOMA-IR (β =-0.038 per year, 95% CI -0.060, -0.015) and HOMA-β (β =-1.028 per year, 95% CI -1.635, -0.421) after adjustment for age and sex. The associations were robust to adjustment for baseline waist circumference and smoking. Adjustment for CRP did not change the associations for sCD163 or adiponectin. Our findings indicate that mechanisms related to inflammation, including macrophage activation and adipocyte metabolism, may play a role in changes in glucose homeostasis in individuals at high risk of type 2 diabetes mellitus.
Perreault, Mylène; Feng, Guo; Will, Sarah; Gareski, Tiffany; Kubasiak, David; Marquette, Kimberly; Vugmeyster, Yulia; Unger, Thaddeus J.; Jones, Juli; Qadri, Ariful; Hahm, Seung; Sun, Ying; Rohde, Cynthia M.; Zwijnenberg, Raphael; Paulsen, Janet; Gimeno, Ruth E.
2013-01-01
Strong genetic data link the Tyrosine kinase receptor B (TrkB) and its major endogenous ligand brain-derived neurotrophic factor (BDNF) to the regulation of energy homeostasis, with loss-of-function mutations in either gene causing severe obesity in both mice and humans. It has previously been reported that peripheral administration of the endogenous TrkB agonist ligand neurotrophin-4 (NT-4) profoundly decreases food intake and body weight in rodents, while paradoxically increasing these same parameters in monkeys. We generated a humanized TrkB agonist antibody, TAM-163, and characterized its therapeutic potential in several models of type 2 diabetes and obesity. In vitro, TAM-163 bound to human and rodent TrkB with high affinity, activated all aspects of the TrkB signaling cascade and induced TrkB internalization and degradation in a manner similar to BDNF. In vivo, peripheral administration of TAM-163 decreased food intake and/or body weight in mice, rats, hamsters, and dogs, but increased food intake and body weight in monkeys. The magnitude of weight change was similar in rodents and non-human primates, occurred at doses where there was no appreciable penetration into deep structures of the brain, and could not be explained by differences in exposures between species. Rather, peripherally administered TAM-163 localized to areas in the hypothalamus and the brain stem located outside the blood-brain barrier in a similar manner between rodents and non-human primates, suggesting differences in neuroanatomy across species. Our data demonstrate that a TrkB agonist antibody, administered peripherally, causes species-dependent effects on body weight similar to the endogenous TrkB ligand NT-4. The possible clinical utility of TrkB agonism in treating weight regulatory disorder, such as obesity or cachexia, will require evaluation in man. PMID:23700410
A 'Pot of Gold' Rich with Nuggets (Sol 163-2)
NASA Technical Reports Server (NTRS)
2004-01-01
This close-up image taken by the Mars Exploration Rover Spirit highlights the nobular nuggets that cover the rock dubbed 'Pot of Gold.' These nuggets appear to stand on the end of stalk-like features. The surface of the rock is dotted with fine-scale pits. Data from the rover's scientific instruments have shown that Pot of Gold contains the mineral hematite, which can be formed with or without water. Scientists are planning further observations of this rock, which they hope will yield more insight into the hematite's origins as well as how the enigmatic nuggets formed. This image was taken by Spirit's microscopic imager on sol 163 (June 18, 2004). The observed area is 3 centimeters by 3 centimeters (1.2 inches by 1.2 inches).Dashti, Yousef; Grkovic, Tanja; Abdelmohsen, Usama Ramadan; Hentschel, Ute; Quinn, Ronald J
2014-05-22
Two sponge-derived actinomycetes, Actinokineospora sp. EG49 and Nocardiopsis sp. RV163, were grown in co-culture and the presence of induced metabolites monitored by ¹H NMR. Ten known compounds, including angucycline, diketopiperazine and β-carboline derivatives 1-10, were isolated from the EtOAc extracts of Actinokineospora sp. EG49 and Nocardiopsis sp. RV163. Co-cultivation of Actinokineospora sp. EG49 and Nocardiopsis sp. RV163 induced the biosynthesis of three natural products that were not detected in the single culture of either microorganism, namely N-(2-hydroxyphenyl)-acetamide (11), 1,6-dihydroxyphenazine (12) and 5a,6,11a,12-tetrahydro-5a,11a-dimethyl[1,4]benzoxazino[3,2-b][1,4]benzoxazine (13a). When tested for biological activity against a range of bacteria and parasites, only the phenazine 12 was active against Bacillus sp. P25, Trypanosoma brucei and interestingly, against Actinokineospora sp. EG49. These findings highlight the co-cultivation approach as an effective strategy to access the bioactive secondary metabolites hidden in the genomes of marine actinomycetes.
Basinko, Audrey; Douet-Guilbert, Nathalie; Parent, Philippe; Blondin, Gilles; Mingam, M; Monot, Françoise; Morel, Frédéric; Le Bris, Marie-Josée; De Braekeleer, Marc
2008-04-01
This 15-month boy was expressed at the cytogenetic laboratory because of psychomotor development delay. He was tall and had plagiocephaly, micrognathia, high nasal bridge, anteverted nostrils and pectus excavatum. A 46,XY,del(4)(p16.1p16.3) karyotype was found using high-resolution R-banding technique. FISH studies using the LSI Wolf-Hirschhorn dual color 4p16.3 and the TelVysion 4p probes showed no deletion. Using BACs, the distal breakpoint was located in 4p16.3, between RP11-165K4 and RP11-717M10 and the proximal breakpoint in 4p15.33, between RP11-74M11 and RP11-1J7; therefore, approximately 7.96 Mb of the short arm were deleted. The maternal karyotype showed the same deletion, but in a mosaic status. Two distinct phenotypes have been recognized on the basis of the chromosomal bands involved in 4p deletion: the Wolf-Hirschhorn syndrome (WHS) and a proximal 4p deletion syndrome (4p15.2-p15.32). Our observation confirms that the basic WHS phenotype maps distally to this region. Copyright 2008 Wiley-Liss, Inc.
26 CFR 1.163-12 - Deduction of original issue discount on instrument held by related foreign person.
Code of Federal Regulations, 2012 CFR
2012-04-01
... on which the amount is includible in income is determined with reference to the method of accounting... 26 Internal Revenue 2 2012-04-01 2012-04-01 false Deduction of original issue discount on... Deductions for Individuals and Corporations § 1.163-12 Deduction of original issue discount on instrument...
26 CFR 1.163-12 - Deduction of original issue discount on instrument held by related foreign person.
Code of Federal Regulations, 2014 CFR
2014-04-01
... on which the amount is includible in income is determined with reference to the method of accounting... 26 Internal Revenue 2 2014-04-01 2014-04-01 false Deduction of original issue discount on... Deductions for Individuals and Corporations § 1.163-12 Deduction of original issue discount on instrument...
26 CFR 1.163-12 - Deduction of original issue discount on instrument held by related foreign person.
Code of Federal Regulations, 2013 CFR
2013-04-01
... on which the amount is includible in income is determined with reference to the method of accounting... 26 Internal Revenue 2 2013-04-01 2013-04-01 false Deduction of original issue discount on... Deductions for Individuals and Corporations § 1.163-12 Deduction of original issue discount on instrument...
Preneta, Rachel; Papavinasasundaram, K G; Cozzone, Alain J; Duclos, Bertrand
2004-07-01
Several antigens of Mycobacterium tuberculosis, identified by monoclonal antibodies, have been previously cloned and are being exploited in the development of improved vaccines and diagnostic reagents. In this study, the molecular characteristics of two of these antigens, the immunodominant proteins Hsp 16.3 and Hsp 70, were analysed in further detail by assessing their capacity to undergo protein phosphorylation, a chemical modification frequently used by organisms to adjust to environmental variations. Hsp 16.3 was overproduced in an Escherichia coli expression system and purified to homogeneity. Upon incubation in the presence of radioactive ATP, it was shown to possess autophosphorylation activity. Two-dimensional analysis of its phosphoamino acid content revealed that it was modified exclusively at serine residues. In addition, cross-linking experiments demonstrated that it could tightly bind to ATP. Purified Hsp 70 was also shown to autophosphorylate but phosphorylation occurred exclusively at threonine residues. This reaction was found to be strongly stimulated by calcium ions. These data indicate that both structural and functional similarities exist between Hsp 16.3 (Acr) and alpha-crystallin, a eukaryotic protein which plays an important role in maintaining the transparency of the vertebrate eye, and that the functional properties of Hsp 70 from M. tuberculosis are similar to those of other bacterial members of the Hsp 70 family, particularly the E. coli homologue DnaK.
Toupchian, Omid; Sotoudeh, Gity; Mansoori, Anahita; Nasli-Esfahani, Ensieh; Djalali, Mahmoud; Keshavarz, Seyyed Ali; Koohdani, Fariba
2016-01-01
The beneficial effects of n-3 polyunsaturated fatty acids on reducing cardiovascular risks are well documented. However, the relative effect on some markers of macrophage activation and vascular function is unclear. The primary objective of this study was to investigate the effects of docosahexaenoic acid (DHA)-enriched fish oil on the marker of monocyte/macrophage activation factor soluble CD163, asymmetric dimethyl arginine (ADMA), and insulin resistance in type 2 diabetic patients. In this double-blind randomized controlled trial, 72 type 2 diabetic patients with an age between 30-70 years and body mass index (BMI) of 18.5 to 40 kg/m(2) were randomly assigned to receive 2.4-g DHA-enriched fish oil or placebo per day for 8 weeks. Anthropometric measurements, biochemical, and body composition analyses were assessed at baseline and end of study. Analysis of covariance (ANCOVA) was conducted by controlling for possible confounders to assess between-group differences. Serum levels of sCD163, triglycerides, waist circumference (WC), and weight to height ratio (WHtR) decreased significantly in the fish oil group when compared with the control group. Serum ADMA concentration decreased in the fish oil group with no significant between-group differences. Controlling for confounders revealed that the differences observed in sCD163, triglycerides, WC, and WHtR remained statistically significant. Short-time fish oil supplementation decreased serum sCD163, triglycerides levels, WC, and WHtR in T2DM patients. Because of the positive relationship between sCD163 levels and some T2DM and obesity-related complications, it seems that DHA can be considered as a key intervention in obesity and T2DM. Copyright © 2016 National Lipid Association. Published by Elsevier Inc. All rights reserved.
Vita, Serena; Lichtner, Miriam; Marchetti, Giulia; Mascia, Claudia; Merlini, Esther; Cicconi, Paola; Vullo, Vincenzo; Viale, Pierluigi; Costantini, Andrea; DʼArminio Monforte, Antonella
2017-03-01
To contribute to the understanding of the role played by cytomegalovirus (CMV) in sustaining monocyte/macrophage-mediated immune activation in antiretroviral therapy treated HIV-infected subjects. We selected 23 CMV-uninfected and 46 CMV-infected HIV+ subjects, matched for age, CD4 nadir, HIV infection duration, and viral hepatitis serostatus. All subjects were on successful antiretroviral therapy since at least 1 year. A group of 16 healthy donors with similar age and sex was also included. Plasma levels of tumor necrosis factor-alpha, interleukin-6, sCD163, sCD14, and CMV immunoglobulin G levels were measured in duplicate with human enzyme-linked immunosorbent assay kits. We found significantly higher sCD163 plasma levels in HIV+CMV+ compared with HIV+CMV- subjects and healthy donors. This augmentation was confirmed also when subjects positive for hepatitis C virus-Ab were excluded from analysis. Interestingly, a correlation between anti-CMV immunoglobulin G levels and sCD163, tumor necrosis factor-alpha, interleukin-6, and sCD14 in HIV+CMV+ subjects was found. CMV coinfection could be a major driver of monocyte/macrophage activation in virally suppressed HIV+ individuals and might explain the increased risk of non-AIDS morbidity/mortality in HIV/CMV-coinfected subjects.
Highly Durable Na2V6O16·1.63H2O Nanowire Cathode for Aqueous Zinc-Ion Battery.
Hu, Ping; Zhu, Ting; Wang, Xuanpeng; Wei, Xiujuan; Yan, Mengyu; Li, Jiantao; Luo, Wen; Yang, Wei; Zhang, Wencui; Zhou, Liang; Zhou, Zhiqiang; Mai, Liqiang
2018-03-14
Rechargeable aqueous zinc-ion batteries are highly desirable for grid-scale applications due to their low cost and high safety; however, the poor cycling stability hinders their widespread application. Herein, a highly durable zinc-ion battery system with a Na 2 V 6 O 16 ·1.63H 2 O nanowire cathode and an aqueous Zn(CF 3 SO 3 ) 2 electrolyte has been developed. The Na 2 V 6 O 16 ·1.63H 2 O nanowires deliver a high specific capacity of 352 mAh g -1 at 50 mA g -1 and exhibit a capacity retention of 90% over 6000 cycles at 5000 mA g -1 , which represents the best cycling performance compared with all previous reports. In contrast, the NaV 3 O 8 nanowires maintain only 17% of the initial capacity after 4000 cycles at 5000 mA g -1 . A single-nanowire-based zinc-ion battery is assembled, which reveals the intrinsic Zn 2+ storage mechanism at nanoscale. The remarkable electrochemical performance especially the long-term cycling stability makes Na 2 V 6 O 16 ·1.63H 2 O a promising cathode for a low-cost and safe aqueous zinc-ion battery.
26 CFR 1.163-3 - Deduction for discount on bond issued on or before May 27, 1969.
Code of Federal Regulations, 2010 CFR
2010-04-01
... case of a callable bond, at the earlier call date) over the issue price of the bond (as defined in... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deduction for discount on bond issued on or... and Corporations § 1.163-3 Deduction for discount on bond issued on or before May 27, 1969. (a...
Filho, Manoel A. M.; Dutra, José Diogo L.; Rocha, Gerd B.; Simas, Alfredo M.; Freire, Ricardo O.
2014-01-01
Complexes of dysprosium, holmium, and erbium find many applications as single-molecule magnets, as contrast agents for magnetic resonance imaging, as anti-cancer agents, in optical telecommunications, etc. Therefore, the development of tools that can be proven helpful to complex design is presently an active area of research. In this article, we advance a major improvement to the semiempirical description of lanthanide complexes: the Recife Model 1, RM1, model for the lanthanides, parameterized for the trications of Dy, Ho, and Er. By representing such lanthanide in the RM1 calculation as a three-electron atom with a set of 5 d, 6 s, and 6 p semiempirical orbitals, the accuracy of the previous sparkle models, mainly concentrated on lanthanide-oxygen and lanthanide-nitrogen distances, is extended to other types of bonds in the trication complexes’ coordination polyhedra, such as lanthanide-carbon, lanthanide-chlorine, etc. This is even more important as, for example, lanthanide-carbon atom distances in the coordination polyhedra of the complexes comprise about 30% of all distances for all complexes of Dy, Ho, and Er considered. Our results indicate that the average unsigned mean error for the lanthanide-carbon distances dropped from an average of 0.30 Å, for the sparkle models, to 0.04 Å for the RM1 model for the lanthanides; for a total of 509 such distances for the set of all Dy, Ho, and Er complexes considered. A similar behavior took place for the other distances as well, such as lanthanide-chlorine, lanthanide-bromine, lanthanide, phosphorus and lanthanide-sulfur. Thus, the RM1 model for the lanthanides, being advanced in this article, broadens the range of application of semiempirical models to lanthanide complexes by including comprehensively many other types of bonds not adequately described by the previous models. PMID:24497945
[Analysis of 163 rib fractures by imaging examination].
Song, Tian-fu; Wang, Chao-chao
2014-12-01
To explore the applications of imaging examination on rib fracture sites in forensic identification. Features including the sites, numbers of the processed imaging examination and the first radiological technology at diagnosis in 56 cases of rib fractures from 163 injuries were retrospectively analyzed. The detection rate of the rib fractures within 14 days was 65.6%. The initial detection rate of anterior rib fracture proceeded by X-ray was 76.2%, then 90.5% detected at a second time X-ray, while the detection rate of CT was 66.7% and 80.0%, respectively. The initial detec- tion rate of rib fracture in axillary section proceeded by X-ray was 27.6%, then 58.6% detected at a second time X-ray, while the detection rate of CT was 54.3% and 80.4%, respectively. The initial detection rate of posterior rib fracture proceeded by X-ray was 63.6%, then 81.8% detected at a second time X-ray, while the detection rate of CT was 50.0% and 70.0%, respectively. It is important to pay attention to the use of combined imaging examinations and the follow-up results. In the cases of suspicious for rib fracture in axillary section, CT examination is suggested in such false X-ray negative cases.
White light emission of dysprosium doped lanthanum calcium phosphate oxide and oxyfluoride glasses
NASA Astrophysics Data System (ADS)
Luewarasirikul, N.; Kim, H. J.; Meejitpaisan, P.; Kaewkhao, J.
2017-04-01
Lanthanum calcium phosphate oxide and oxyfluoride glasses doped with dysprosium oxide were prepared by melt-quenching technique with chemical composition 20La2O3:10CaO:69P2O5:1Dy2O3 and 20La2O3:10CaF2:69P2O5:1Dy2O3. The physical, optical and luminescence properties of the glass samples were studied to evaluate their potential to using as luminescence materials for solid-state lighting applications. The density, molar volume and refractive index of the glass samples were carried out. The optical and luminescence properties were studied by investigating absorption, excitation, and emission spectra of the glass samples. The absorption spectra were investigated in the UV-Vis-NIR region from 300 to 2000 nm. The excitation spectra observed under 574 nm emission wavelength showed the highest peak centered at 349 nm (6H15/2 → 6P7/2). The emission spectra, excited with 349 nm excitation wavelength showed two major peaks corresponding to 482 nm blue emission (4F9/2 → 6H15/2) and 574 nm yellow emission (4F9/2 → 6H13/2). The experimental lifetime were found to be 0.539 and 0.540 for oxide and oxyfluoride glass sample, respectively. The x,y color coordinates under 349 nm excitation wavelength were (0.38, 0.43) for both glass samples, that be plotted in white region of CIE 1931 chromaticity diagram. The CCT values obtained from the glass samples are 4204 K for oxide glass and 4228 K for oxyfluoride glass corresponding to the commercial cool white light (3100-4500 K). Judd-Ofelt theory had also been employed to obtain the J-O parameters (Ω2, Ω4 and Ω6), oscillator strength, radiative transition possibility, stimulated emission cross section and branching ratio. The Ω2 > Ω4 > Ω6 trend of J-O parameters of both glass samples may indicate the good quality of a glass host for using as optical device application. Temperature dependence of emission spectra was studied from 300 K to 10 K and found that the intensity of the emission peak was found to be increased with
Balermpas, P; Rödel, F; Liberz, R; Oppermann, J; Wagenblast, J; Ghanaati, S; Harter, P N; Mittelbronn, M; Weiss, C; Rödel, C; Fokas, E
2014-10-14
We investigated the prognostic role of tumour-associated macrophages (TAMs) in patients with head and neck squamous cell carcinoma (HNSCC) treated with definitive chemoradiotherapy (CRT). The expression of CD68+, CD163+ and CD11b+ cells was assessed using immunohistochemistry in n=106 pre-treatment tumour biopsy samples and was correlated with clinicopathological characteristics, including T-stage, N-stage, grading, tumour localisation, age and sex as well as local failure-free survival (LFFS), distant metastases-free survival (DMFS), progression-free (PFS), and overall survival (OS). Finally, TAMs expression and vessel density (CD31) were examined in n=12 available early local recurrence samples and compared with their matched primary tumours . The diagnostic images and radiotherapy plans of these 12 patients were also analysed. All local recurrences occurred in the high radiation dose region (⩾70 Gy). With a median follow-up of 40 months, OS at 2 years was 60.5%. High CD163 expression in primary tumours was associated with decreased OS (P=0.010), PFS (P=0.033), LFFS (P=0.036) and DMFS (P=0.038) in multivariate analysis. CD163 demonstrated a strong prognostic value only in human papillomavirus (p16(INK4))-negative patients. Early local recurrence specimens demonstrated a significantly increased infiltration of CD11b+ myeloid cells (P=0.0097) but decreased CD31-positive vessel density (P=0.0004) compared with their matched primary samples. Altogether, baseline CD163 expression predicts for an unfavourable clinical outcome in HNSCC after definitive CRT. Early local recurrences showed increased infiltration by CD11b+ cells. These data provide important insight on the role of TAMs in mediating response to CRT in patients with HNSCC.
NASA Astrophysics Data System (ADS)
Tegafaw, Tirusew; Xu, Wenlong; Wasi Ahmad, Md; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong; Lee, Gang Ho
2015-09-01
A new type of dual-mode T1 and T2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd3+ (8S7/2) plays an important role in T1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy3+ (6H15/2) has the potential to be used in T2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy2O3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd3+ and Dy3+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T1 and T2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (davg = 1.0 nm) showed large r1 and r2 values (r2/r1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R1 and R2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T1 and T2 MR images.
Castley, Alison; Berry, Cassandra; French, Martyn; Fernandez, Sonia; Krueger, Romano; Nolan, David
2014-01-01
Objective We investigated plasma and flow cytometric biomarkers of monocyte status that have been associated with prognostic utility in HIV infection and other chronic inflammatory diseases, comparing 81 HIV+ individuals with a range of treatment outcomes to a group of 21 healthy control blood donors. Our aim is to develop and optimise monocyte assays that combine biological relevance, clinical utility, and ease of adoption into routine HIV laboratory practice. Design Cross-sectional evaluation of concurrent plasma and whole blood samples. Methods A flow cytometry protocol was developed comprising single-tube CD45, CD14, CD16, CD64, CD163, CD143 analysis with appropriately matched isotype controls. Plasma levels of soluble CD14 (sCD14), soluble CD163 (sCD163) and CXCL10 were measured by ELISA. Results HIV status was associated with significantly increased expression of CD64, CD143 and CD163 on CD16+ monocytes, irrespective of the virological response to HIV therapy. Plasma levels of sCD14, sCD163 and CXCL10 were also significantly elevated in association with viremic HIV infection. Plasma sCD163 and CXCL10 levels were restored to healthy control levels by effective antiretroviral therapy while sCD14 levels remained elevated despite virological suppression (p<0.001). Conclusions Flow cytometric and plasma biomarkers of monocyte activation indicate an ongoing systemic inflammatory response to HIV infection, characterised by persistent alterations of CD16+ monocyte expression profiles and elevated sCD14 levels, that are not corrected by antiretroviral therapy and likely to be prognostically significant. In contrast, sCD163 and CXCL10 levels declined on antiretroviral therapy, suggesting multiple activation pathways revealed by these biomarkers. Incorporation of these assays into routine clinical care is feasible and warrants further consideration, particularly in light of emerging therapeutic strategies that specifically target innate immune activation in HIV
Halimah, M K; Ami Hazlin, M N; Muhammad, F D
2018-04-15
A series of glass samples with chemical formula {[(TeO 2 ) 0.7 (B 2 O 3 ) 0.3 ] 0.7 (ZnO) 0.3 } 1-x (Dy 2 O 3 ) x where x=0.01, 0.02, 0.03, 0.04 and 0.05M fraction were synthesized through conventional melt-quenching method. The most common way to fabricate a glass material is by fusion of two or more component oxides followed by their quenching. This technique is known as melt-quenching technique. Kaur et al. (2016) [1] highlighted that the melt-quenching method able to enhance the mechanical properties like hardness and flexural strength of the material. The nature of the glass systems is proven to be amorphous based on the XRD pattern. The FTIR spectra of the glass systems confirm the existence of five bands which are assigned for the BO 4 , BO 3, TeO 4 and TeO 3 vibrational groups. The density of the glass systems is increased with the addition of Dy 2 O 3 while the molar volume is found to be inversely proportional to the density of the proposed glass. The optical properties of the glasses are determined through the absorption spectra obtained from the UV-VIS spectrophotometer. From the absorption spectra, the indirect and direct optical band gaps and the Urbach energy are found to be inversely proportional to each other. As the molar fraction of the Dy 2 O 3 increased, the optical band gaps are observed to increase as opposed to the Urbach energy. For this glass system, the values of refractive index, electronic polarizability, oxide ion polarizability and the optical basicity are found to decrease as the addition of the dysprosium oxide is increased. From the emission spectra, two intense blue and yellow emission bands are observed, which correspond to the 4 F 9/2 → 6 H 15/2 and 4 F 9/2 → 6 H 13/2 transitions of Dy 3+ ions respectively. The CIE chromaticity coordinates of the zinc borotellurite glass systems are found to be located in the white light region. Copyright © 2017 Elsevier B.V. All rights reserved.
Collective excitations in the transitional nuclei 163Re and 165Re
NASA Astrophysics Data System (ADS)
Davis-Merry, T. R.; Joss, D. T.; Page, R. D.; Simpson, J.; Paul, E. S.; Ali, F. A.; Bianco, L.; Carroll, R. J.; Cederwall, B.; Darby, I. G.; Drummond, M. C.; Eeckhaudt, S.; Ertürk, S.; Gómez-Hornillos, M. B.; Grahn, T.; Greenlees, P. T.; Hadinia, B.; Jakobsson, U.; Jones, P. M.; Julin, R.; Juutinen, S.; Ketelhut, S.; Leino, M.; Nieminen, P.; Nyman, M.; O'Donnell, D.; Pakarinen, J.; Peura, P.; Rahkila, P.; Revill, J. P.; Ruotsalainen, P.; Sandzelius, M.; Sapple, P. J.; Sarén, J.; Sayǧi, B.; Scholey, C.; Sorri, J.; Thomson, J.; Uusitalo, J.
2015-03-01
Excited states in the neutron-deficient nuclei 75163Re88 and 75165Re90 were populated in the 106Cd( 60Ni ,p 2 n γ ) and 92Mo( 78Kr , 3 p 2 n γ ) fusion-evaporation reactions at bombarding energies of 270 and 380 MeV, respectively. γ rays were detected at the target position using the JUROGAM spectrometer while recoiling ions were separated in-flight by the RITU gas-filled recoil separator and implanted in the GREAT spectrometer. The energy level schemes for 163Re and 165Re were identified using recoil-decay correlation techniques. At low spin, the yrast bands of these isotopes consist of signature partner bands based on a single π h11 /2 quasiproton configuration. The bands display large energy splitting consistent with the soft triaxial shape typical of transitional nuclei above N =82 . The configurations of the excited states are proposed within the framework of the cranked shell model.
Code of Federal Regulations, 2010 CFR
2010-04-01
... assets, and arranges for the sale to investors of bearer certificates of interest in the trust which do...) for purposes of section 163(f)(2) (A) and (B) does not affect the determination of whether bearer... REMIC as its only asset, and arranges for the sale to investors of regular interests in the REMIC in...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Jaques, Brian; Butt, Darryl P.; Marx, Brian M.
A carbothermic reduction of the metal oxides in a hydrogen/nitrogen mixed gas stream prior to nitriding in a nitrogen gas stream was used to synthesize uranium nitride at 1500 deg. C, cerium nitride at 1400 deg. C, and dysprosium nitride at 1500 deg. C. Cerium nitride and dysprosium nitride were also synthesized via hydriding and nitriding the metal shavings at 900 deg. C and 1500 deg. C, respectively. Also, a novel ball-milling synthesis route was used to produce cerium nitride and dysprosium nitride from the metal shavings at room temperature. Dysprosium nitride was also produced by reacting the metal shavingsmore » in a high purity nitrogen gas stream at 1300 deg. C. All materials were characterized by phase analysis via X-ray diffraction. Only the high purity materials were further analyzed via chemical analysis to characterize the trace oxygen concentration. (authors)« less
Thordardottir, Steinunn; Rodriguez-Vieitez, Elena; Almkvist, Ove; Ferreira, Daniel; Saint-Aubert, Laure; Kinhult-Ståhlbom, Anne; Thonberg, Håkan; Schöll, Michael; Westman, Eric; Wall, Anders; Eriksdotter, Maria; Zetterberg, Henrik; Blennow, Kaj; Nordberg, Agneta; Graff, Caroline
2018-05-10
The range of onset ages within some PSEN1 families is wide, and a few cases of reduced penetrance of PSEN1 mutations have been reported. However, published data on reduced penetrance have been limited to clinical histories, often collected retrospectively and lacking biomarker information. We present a case of reduced penetrance of the PSEN1 H163Y mutation in a carrier prospectively followed for 22 years. Two brothers (A and B), both carriers of the H163Y mutation, were followed between 1995 and 2017. They underwent repeated clinical evaluations, neuropsychological assessments, and cerebrospinal fluid analyses, as well as brain imaging examinations with structural magnetic resonance, [ 18 F]fluorodeoxyglucose positron emission tomography, and [ 11 C]Pittsburgh compound B positron emission tomography. Brother A was followed between 44 and 64 years of age. Cognitive symptoms due to Alzheimer's disease set in at the age of 54. Gradual worsening of symptoms resulted in admittance to a nursing home owing to dependence on others for all activities of daily living. He showed a curvilinear decline in cognitive function on neuropsychological tests, and changes on magnetic resonance imaging, positron emission tomography, and biomarkers in the cerebrospinal fluid supported a clinical diagnosis of Alzheimer's disease. Brother A died at the age of 64 and fulfilled the criteria for definitive Alzheimer's disease according to neuropathological examination results. Brother B was followed between the ages of 43 and 65 and showed no cognitive deterioration on repeated neuropsychological test occasions. In addition, no biomarker evidence of Alzheimer's disease pathology was detected, either on imaging examinations or in cerebrospinal fluid. The average (SD) age of symptom onset for PSEN1 H163Y is 51 ± 7 years according to previous studies. However, we present a case of a biomarker-verified reduction in penetrance in a mutation carrier who was still symptom-free at the age of
Jackson, Ben; Mileham, Alan J.; Ait-Ali, Tahar; Whitelaw, C. Bruce A.
2017-01-01
Porcine Reproductive and Respiratory Syndrome (PRRS) is a panzootic infectious disease of pigs, causing major economic losses to the world-wide pig industry. PRRS manifests differently in pigs of all ages but primarily causes late-term abortions and stillbirths in sows and respiratory disease in piglets. The causative agent of the disease is the positive-strand RNA PRRS virus (PRRSV). PRRSV has a narrow host cell tropism, limited to cells of the monocyte/macrophage lineage. CD163 has been described as a fusion receptor for PRRSV, whereby the scavenger receptor cysteine-rich domain 5 (SRCR5) region was shown to be an interaction site for the virus in vitro. CD163 is expressed at high levels on the surface of macrophages, particularly in the respiratory system. Here we describe the application of CRISPR/Cas9 to pig zygotes, resulting in the generation of pigs with a deletion of Exon 7 of the CD163 gene, encoding SRCR5. Deletion of SRCR5 showed no adverse effects in pigs maintained under standard husbandry conditions with normal growth rates and complete blood counts observed. Pulmonary alveolar macrophages (PAMs) and peripheral blood monocytes (PBMCs) were isolated from the animals and assessed in vitro. Both PAMs and macrophages obtained from PBMCs by CSF1 stimulation (PMMs) show the characteristic differentiation and cell surface marker expression of macrophages of the respective origin. Expression and correct folding of the SRCR5 deletion CD163 on the surface of macrophages and biological activity of the protein as hemoglobin-haptoglobin scavenger was confirmed. Challenge of both PAMs and PMMs with PRRSV genotype 1, subtypes 1, 2, and 3 and PMMs with PRRSV genotype 2 showed complete resistance to viral infections assessed by replication. Confocal microscopy revealed the absence of replication structures in the SRCR5 CD163 deletion macrophages, indicating an inhibition of infection prior to gene expression, i.e. at entry/fusion or unpacking stages. PMID:28231264
ERIC Educational Resources Information Center
Ramos, Adrian
2013-01-01
At UCSB the number of degree seeking undergraduate Chinese international students increased from 6 to 163 between 2010 and 2012. With such a controversial and much discussed topic of international student enrollment at U.S universities, this was the perfect time for me to interview Chinese international students. With the help of Kathy Charmaz'…
Casiglia, Edoardo; Tikhonoff, Valérie; Albertini, Federica; Favaro, Jacopo; Montagnana, Martina; Danese, Elisa; Finatti, Francesco; Benati, Marco; Mazza, Alberto; Dal Maso, Lucia; Spinella, Paolo; Palatini, Paolo
2017-08-01
The possible effect of caffeine as an enhancer of cognitive performance, particularly that on abstract reasoning, has never been studied in an epidemiological setting, especially in relation to -163C>A polymorphism of CYP1A2 gene, largely controlling caffeine metabolism. Aim of this study was to ascertain whether in general population free chronic caffeine intake modifies abstract reasoning, and if this effect is influenced by the above mentioned genotype, by age, schooling, ethanol intake and smoking habits. We studied 1374 unselected men and women aged 51 ± 15 years (range 18-89) from a general population. Daily caffeine intake deriving from coffee, tea, chocolate or cola was calculated from an anamnestic questionnaire and from a 7-day dietary diary. Abstract reasoning was measured in the frame of a neuropsychological assessment as the ability to find a concept linking two words indicating objects or actions and explaining how they were connected. In age-schooling-adjusted linear regression, the higher the caffeine intake, the better the abstraction score. Abstract reasoning depended on caffeine in the -163C>A CC homozygous only (so-called slow metabolizers), where it was higher in the 3rd tertile of caffeine intake. Age and ethanol reduced while smoking and schooling enhanced this association. The interaction term between caffeine and the -163C>A polymorphism was accepted in linear regressions. Caffeine consumption resulted innocuous for the A-carriers (so-called fast metabolizers). In general population, a positive association between caffeine intake and abstract reasoning exists in the CC homozygous of the -163C>A polymorphism of CYP1A2 gene. Copyright © 2017 European Society for Clinical Nutrition and Metabolism. Published by Elsevier Ltd. All rights reserved.
Burnout, Depression, and Borderline Personality: A 1,163-Participant Study.
Bianchi, Renzo; Rolland, Jean-Pierre; Salgado, Jesús F
2017-01-01
We examined the association of burnout with borderline personality (BP) traits in a study of 1,163 educational staff (80.9% women; mean age: 42.96). Because burnout has been found to overlap with depression, parallel analyses of burnout and depression were conducted. Burnout symptoms were assessed with the Shirom-Melamed Burnout Measure, depressive symptoms with the PHQ-9, and BP traits with the Borderline Personality Questionnaire. Burnout was found to be associated with BP traits, controlling for neuroticism and history of depressive disorders. In women, burnout was linked to both the "affective insecurity" and the "impulsiveness" component of BP. In men, only the link between burnout and "affective insecurity" reached statistical significance. Compared to participants with "low" BP scores, participants with "high" BP scores reported more burnout symptoms, depressive symptoms, neuroticism, and occupational stress and less satisfaction with life. Disattenuated correlations between burnout and depression were close to 1, among both women (0.91) and men (0.94). The patterns of association of burnout and depression with the main study variables were similar, pointing to overlapping nomological networks. Burnout symptoms were only partly attributed to work by our participants. Our findings suggest that burnout is associated with BP traits through burnout-depression overlap.
Burnout, Depression, and Borderline Personality: A 1,163-Participant Study
Bianchi, Renzo; Rolland, Jean-Pierre; Salgado, Jesús F.
2018-01-01
We examined the association of burnout with borderline personality (BP) traits in a study of 1,163 educational staff (80.9% women; mean age: 42.96). Because burnout has been found to overlap with depression, parallel analyses of burnout and depression were conducted. Burnout symptoms were assessed with the Shirom-Melamed Burnout Measure, depressive symptoms with the PHQ-9, and BP traits with the Borderline Personality Questionnaire. Burnout was found to be associated with BP traits, controlling for neuroticism and history of depressive disorders. In women, burnout was linked to both the “affective insecurity” and the “impulsiveness” component of BP. In men, only the link between burnout and “affective insecurity” reached statistical significance. Compared to participants with “low” BP scores, participants with “high” BP scores reported more burnout symptoms, depressive symptoms, neuroticism, and occupational stress and less satisfaction with life. Disattenuated correlations between burnout and depression were close to 1, among both women (0.91) and men (0.94). The patterns of association of burnout and depression with the main study variables were similar, pointing to overlapping nomological networks. Burnout symptoms were only partly attributed to work by our participants. Our findings suggest that burnout is associated with BP traits through burnout-depression overlap. PMID:29375447
Podolich, O; Laschevskyy, V; Ovcharenko, L; Kozyrovska, N; Pirttilä, A M
2009-03-01
To induce growth of endophytic bacteria residing in an unculturable state in tissues of in vitro-grown potato plantlets. To isolate and identify the induced bacteria and to localize the strains in tissues of in vitro-grown potato plantlets. The inoculation of in vitro-grown potato plants with Pseudomonas fluorescens IMBG163 led to induction of another bacterium, a pink-pigmented facultative methylotroph that was identified as Methylobacterium sp. using phylogenetic 16S rDNA approach. Two molecular methods were used for localizing methylobacteria in potato plantlets: PCR and in situ hybridization (ISH/FISH). A PCR product specific for the Methylobacterium genus was found in DNA isolated from the surface-sterilized plantlet leaves. Presence of Methylobacterium rRNA was detected by ISH/FISH in leaves and stems of inoculated as well as axenic potato plantlets although the bacterium cannot be isolated from the axenic plants. Methylobacterium sp. resides in unculturable state within tissues of in vitro-grown potato plants and becomes culturable after inoculation with P. fluorescens IMBG163. In order to develop endophytic biofertilizers and biocontrol agents, a detailed knowledge of the life-style of endophytes is essential. To our knowledge, this is the first report on increase of the culturability of endophytes in response to inoculation by nonpathogenic bacteria.
Fujimura, Taku; Kambayashi, Yumi; Furudate, Sadanori; Kakizaki, Aya; Aiba, Setsuya
2014-01-01
M2 macrophages play a critical role in the recruitment of T helper 2 (Th2) regulatory T cells (Treg). To study the role of M2 macrophages and Treg cells in eosinophilic celulitis. We employed immunohistochemical staining for CD163( )and CD206 (macrophages) as well as FoxP3 (Treg), in lesional skin of four cases of eosinophilic cellulitis. CD163(+) CD206(+) M2 macrophages, which were previously reported to produce CCL17 to induce Th2 cells and Treg cells, were predominantly infiltrating the subcutaneous tissues and interstitial area of the dermis. M2 macrophages derived from PBMC showed significantly increased expression of CCL11, CCL17, CCL24 and CCL26 mRNA and production of CCL17 and CCL24, when stimulated by IL-4 or IL- 13. In addition, CCL17-producing cells and CCL24-producing cells were prominent in the lesional skin of EC. Our study sheds light on one of the possible immunological mechanisms of eosinophilic cellulitis.
Fearnside, Philip M
2007-05-01
Brazil's Cuiabá-Santarém (BR-163) Highway provides a valuable example of ways in which decision-making procedures for infrastructure projects in tropical forest areas need to be reformulated in order to guarantee that environmental concerns are properly weighed. BR-163, which is slated to be paved as an export corridor for soybeans via the Amazon River, traverses an area that is largely outside of Brazilian government control. A climate of generalized lawlessness and impunity prevails, and matters related to environment and to land tenure are especially unregulated. Deforestation and illegal logging have accelerated in anticipation of highway paving. Paving would further speed forest loss in the area, as well as stimulate migration of land thieves (grileiros) to other frontiers. An argument is made that the highway should not be reconstructed and paved until after a state of law has been established and it has been independently certified that sufficient governance prevails to secure protected areas and enforce environmental legislation. A waiting period is needed after this is achieved before proceeding with the highway paving. Above all, the logical sequence of steps must be followed, whereby environmental costs are assessed, reported, and weighed prior to making de facto decisions on implementation of infrastructure projects. Deviation from this logical sequence is a common occurrence in many parts of the world, especially in tropical areas.