Rheological Characterization of Vegetal Pear (Sechium edule)

NASA Astrophysics Data System (ADS)

Castillo-Reyes, José A.; Luna-Solano, Guadalupe; Cantú-Lozano, Denis

2008-07-01

The national production of Mexican vegetal pear (Sechium edule) is located at the present time in more than 130,000 ton/year. The vegetal pear that produced in the center zone of the state of Veracruz is known in international markets; however it is a product that practically has not been studied. This work identifies the rheological behavior of vegetal pear (Sechium edule). A rheometer MCR301 of Anton Paar was utilized for viscosity and shear stress measurements. The objective of this experimental was modeling the rheological behavior of vegetal pear suspensions at three concentrations (1, 2 and 3% w/w), three particle size (1.00, 1.19 and 1.40 mm), at the same conditions of temperature (25, 40 and 70 °C). The results showed that all the suspensions there was a phenomenological behavior as a dilatants fluid (n>1) the performance of flow was represented by the Herschel-Bulkley model, and present values of "yield stress" between from 0.1 to 15 Pa for the different experiments. During evaluation of the activation energy of the suspensions of vegetal pear was found that decreases from 154.4039 kJ/mol to 9.1086 kJ/mol for a particle size of 1.00 mm to 1.4 mm, which implies that the effect of temperature is higher with smaller grains, in this case 1.00 mm. Furthermore, we assessed the effect of particle size by the Péclet number, showing an increase of the viscosity when the Péclet number also increases.

Chayote (Sechium edule) causing hypokalemia in pregnancy.

PubMed

Jensen, L P; Lai, A R

1986-11-01

A case of severe hypokalemia in pregnancy is presented. Chayote, a subtropical vegetable with potent diuretic action, is implicated, as the potassium level returned to normal, without recurrence of hypokalemia, once the ingestion was stopped.

Organic contamination in clams, Venerupis aurea laeta and Cerastoderma edule glaucum, from Sicily (Italy).

PubMed

Di Bella, Giuseppa; Potortì, Angela Giorgia; Licata, Patrizia; Pellizzeri, Vito; Ben Mansour, Hedi; Dugo, Giacomo; Lo Turco, Vincenzo

2018-06-01

Two species of edible clams Venerupis aurea laeta and Cerastoderma edule glaucum from Ganzirri Lake (Sicily, Italy) were investigated to determine OCP and PCB residues by GC-MS. Thirty-five samples were examined for two years in order to perform: a) their actual contamination; b) the daily dietary exposure of seafood consumers to the pollutants in question. In all the clams analysed in this study, PCB and OCP (4,4'-DDE) residues are always below the limits fixed by law. It seems that there is some seasonality of concentrations observed. In fact the more high concentrations of residues are detected in the hot months, for both species and years. Given the consumption of clams and the values obtained in this study for the two species analysed, it is possible estimate that the average daily dietary intake of NDL-PCB and of 4,4'-DDE for adults is really low.

Acetone fraction from Sechium edule (Jacq.) S.w. edible roots exhibits anti-endothelial dysfunction activity.

PubMed

Trejo-Moreno, Celeste; Castro-Martínez, Gabriela; Méndez-Martínez, Marisol; Jiménez-Ferrer, Jesús Enrique; Pedraza-Chaverri, José; Arrellín, Gerardo; Zamilpa, Alejandro; Medina-Campos, Omar Noel; Lombardo-Earl, Galia; Barrita-Cruz, Gerardo Joel; Hernández, Beatriz; Ramírez, Christian Carlos; Santana, María Angélica; Fragoso, Gladis; Rosas, Gabriela

2018-06-28

A recent ethnomedical survey on medicinal plants grown in Mexico revealed that Sechium edule (Jacq.) Sw. (Cucurbitaceae) is one of the most valued plant species to treat cardiovascular diseases, including hypertension. Fruits, young leaves, buds, stems, and tuberous roots of the plant are edible. Considering that endothelial dysfunction induced by Angiotensin II plays an important role in the pathogenesis of hypertension and is accompanied by a prooxidative condition, which in turn induces an inflammatory state, vascular remodeling, and tissue damage, and that S. edule has been reported to possess antioxidant, anti-inflammatory and antihypertensive activity, its capability to control endothelial dysfunction was also assessed. To assess in vivo the anti-endothelial dysfunction activity of the acetone fraction (rSe-ACE) of the hydroalcoholic extract from S. edule roots. Endothelial dysfunction was induced in female C57BL/6 J mice by a daily intraperitoneal injection of angiotensin II for 10 weeks. Either rSe-ACE or losartan (as a control) were co-administered with angiotensin II for the same period. Blood pressure was measured at weeks 0, 5, and 10. Kidney extracts were prepared to determine IL1β, IL4, IL6, IL10, IL17, IFNγ, TNFα, and TGFβ levels by ELISA, along with the prooxidative status as assessed by the activity of antioxidant enzymes. The expression of ICAM-1 was evaluated by immunohistochemistry in kidney histological sections. Kidney and hepatic damage, as well as vascular tissue remodeling, were studied. The rSe-ACE fraction administered at a dose of 10 mg/kg was able to control hypertension, as well as the prooxidative and proinflammatory status in kidney as efficiently as losartan, returning mice to normotensive levels. Additionally, the fraction was more efficient than losartan to prevent liver and kidney damage. Phytochemical characterization identified cinnamic acid as a major compound, and linoleic, palmitic, and myristic acids as the most abundant non-polar components in the mixture, previously reported to aid in the control of hypertension, inflammation, and oxidative stress, three important components of endothelial dysfunction. this study demonstrated that rSe-ACE has anti-endothelial dysfunction activity in an experimental model and highlights the role of cinnamic acid and fatty acids in the observed effects. Copyright © 2018 Elsevier B.V. All rights reserved.

Impact of high pCO2 on shell structure of the bivalve Cerastoderma edule.

PubMed

Milano, Stefania; Schöne, Bernd R; Wang, Schunfeng; Müller, Werner E

2016-08-01

Raised atmospheric emissions of carbon dioxide (CO2) result in an increased ocean pCO2 level and decreased carbonate saturation state. Ocean acidification potentially represents a major threat to calcifying organisms, specifically mollusks. The present study focuses on the impact of elevated pCO2 on shell microstructural and mechanical properties of the bivalve Cerastoderma edule. The mollusks were collected from the Baltic Sea and kept in flow-through systems at six different pCO2 levels from 900 μatm (control) to 24,400 μatm. Extreme pCO2 levels were used to determine the effects of potential leaks from the carbon capture and sequestration sites where CO2 is stored in sub-seabed geological formations. Two approaches were combined to determine the effects of the acidified conditions: (1) Shell microstructures and dissolution damage were analyzed using scanning electron microscopy (SEM) and (2) shell hardness was tested using nanoindentation. Microstructures of specimens reared at different pCO2 levels do not show significant changes in their size and shape. Likewise, the increase of pCO2 does not affect shell hardness. However, dissolution of ontogenetically younger portions of the shell becomes more severe with the increase of pCO2. Irrespective of pCO2, strong negative correlations exist between microstructure size and shell mechanics. An additional sample from the North Sea revealed the same microstructural-mechanical interdependency as the shells from the Baltic Sea. Our findings suggest that the skeletal structure of C. edule is not intensely influenced by pCO2 variations. Furthermore, our study indicates that naturally occurring shell mechanical property depends on the shell architecture at μm-scale. Copyright © 2016 Elsevier Ltd. All rights reserved.

Detection of Infectious Cryptosporidium parvum Oocysts in Mussels (Mytilus galloprovincialis) and Cockles (Cerastoderma edule)

PubMed Central

Gomez-Bautista, M.; Ortega-Mora, L. M.; Tabares, E.; Lopez-Rodas, V.; Costas, E.

2000-01-01

Infective Cryptosporidium parvum oocysts were detected in mussels (Mytilus galloprovincialis) and cockles (Cerastoderma edule) from a shellfish-producing region (Gallaecia, northwest Spain, bounded by the Atlantic Ocean) that accounts for the majority of European shellfish production. Shellfish were collected from bay sites with different degrees of organic pollution. Shellfish harboring C. parvum oocysts were recovered only from areas located near the mouths of rivers with a high density of grazing ruminants on their banks. An approximation of the parasite load of shellfish collected in positive sites indicated that each shellfish transported more than 103 oocysts. Recovered oocysts were infectious for neonatal mice, and PCR-restriction fragment length polymorphism analysis demonstrated a profile similar to that described for genotype C or 2 of the parasite. These results demonstrate that mussels and cockles could act as a reservoir of C. parvum infection for humans. Moreover, estuarine shellfish could be used as an indicator of river water contamination. PMID:10788352

Physiological responses to ocean acidification and warming synergistically reduce condition of the common cockle Cerastoderma edule.

PubMed

Ong, E Z; Briffa, M; Moens, T; Van Colen, C

2017-09-01

The combined effect of ocean acidification and warming on the common cockle Cerastoderma edule was investigated in a fully crossed laboratory experiment. Survival of the examined adult organisms remained high and was not affected by elevated temperature (+3 °C) or lowered pH (-0.3 units). However, the morphometric condition index of the cockles incubated under high pCO 2 conditions (i.e. combined warming and acidification) was significantly reduced after six weeks of incubation. Respiration rates increased significantly under low pH, with highest rates measured under combined warm and low pH conditions. Calcification decreased significantly under low pH while clearance rates increased significantly under warm conditions and were generally lower in low pH treatments. The observed physiological responses suggest that the reduced food intake under hypercapnia is insufficient to support the higher energy requirements to compensate for the higher costs for basal maintenance and growth in future high pCO 2 waters. Copyright © 2017 Elsevier Ltd. All rights reserved.

Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica

PubMed Central

Castro, Ruth M.; Moreira, Lisela; Rojas, María R.; Gilbertson, Robert L.; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

2013-01-01

Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere. PMID:25288955

Study of flavonoids of Sechium edule (Jacq) Swartz (Cucurbitaceae) different edible organs by liquid chromatography photodiode array mass spectrometry.

PubMed

Siciliano, Tiziana; De Tommasi, Nunziatina; Morelli, Ivano; Braca, Alessandra

2004-10-20

A liquid chromatography-mass spectrometry (LC-MS)-based method was developed for the characterization of flavonoids from Sechium edule (Jacq) Swartz (Cucurbitaceae) edible organs, a plant cultivated since pre-Colombian times in Mexico where the fruit is called chayote. Chayote is used for human consumption in many countries; in addition to the fruits, stems, leaves and the tuberous part of the roots are also eaten. Eight flavonoids, including three C-glycosyl and five O-glycosyl flavones, were detected, characterized by nuclear magnetic resonance spectroscopic data, and quantified in roots, leaves, stems, and fruits of the plant by LC-photodiode array-MS. The aglycone moieties are represented by apigenin and luteolin, while the sugar units are glucose, apiose, and rhamnose. The results indicated that the highest total amount of flavonoids was in the leaves (35.0 mg/10 g of dried part), followed by roots (30.5 mg/10 g), and finally by stems (19.3 mg/10 g). Copyright 2004 American Chemical Society

Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

PubMed

Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

2013-09-01

Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.

Community type classification of forest vegetation in young, mixed stands, interior Alaska.

Treesearch

Andrew Youngblood

1993-01-01

A total of 53 upland mixed communities were sampled and classified into five community types: Populus tremuloides/Arctostaphylos uva-ursi, Populus tremuloides/Shepherdla canadensis, Betula papyrifera-Populus tremuloides/Viburnum edule, Betula papyrifera-Populus tremuloldes/Alnus crispa and Picea glauca-Betula papyrlfera/Hylocomlum splendens. Community types were...

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

PubMed

Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

2006-02-01

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

How to handle 'poor' foodstuffs: Acclimation of the common cockle (Cerastoderma edule) to detrital diets

NASA Astrophysics Data System (ADS)

Arambalza, Udane; Ibarrola, Irrintzi; Navarro, Enrique; Urrutxurtu, Iñaki; Urrutia, Miren B.

2018-04-01

As an approach to elucidating the "value" of detritus as a food source for bivalves, we analysed the capability of the common cockle (Cerastoderma edule) to modulate feeding and digestive rates during acclimation to low and high food rations of detrital diets with either low (Juncus maritimus) or high digestibility (Enteromorpha spp.). On acclimation day 3, feeding rates were similar in cockles fed different detrita; however, the absorption rate was higher in cockles fed Enteromorpha spp. With J. maritimus, rising food rations promoted an exponential decrease in absorption efficiency, whereas with Enteromorpha spp., absorption efficiency was only marginally reduced. During acclimation, cockles improved the rate at which both detritus were assimilated by means of increasing ingestion rates while maintaining absorption efficiency. When the time-course of digestive carbohydrase activities was monitored during acclimation to either detritus or phytoplankton (Isochrysis galbana), we found that only phytoplankton promoted the induction of cellulase activity in the digestive glands of cockles. This response in cockles fed phytoplankton promoted an increase in the digestibility of Enteromorpha spp., but had no effect on the digestibility of J. maritimus.

First record and description of metacercariae of Curtuteria arguinae n. sp. (Digenea: Echinostomatidae), parasite of cockles Cerastoderma edule (Mollusca: Bivalvia) in Arcachon Bay, France.

PubMed

Desclaux, Céline; Russell-Pinto, Fernanda; de Montaudouin, Xavier; Bachelet, Guy

2006-06-01

A new Himasthlinae species, Curtuteria arguinae, is described as metacercariae from the cockle Cerastoderma edule (L.), collected at Banc d'Arguin (southwestern France). These metacercariae encysted preferentially in the mantle and also in the foot of cockles. Encysted and chemically excysted metacercariae were studied by light microscopy and scanning electron microscopy, respectively. Excysted metacercariae were elongated and curved ventrally. They bore a 33-spine circumoral collar. Sensory papillae were arranged around the oral sucker and also symmetrically along the ventral surface body, from the collar to the acetabulum. The dorsal and ventral tegument surfaces were densely packed with similar pointed spines. The posterior end of the body was without any spines. Among the Curtuteria species described previously, only Curtuteria haematopodis Smogorjewskaja and Iskova, 1966 had the same number of circumoral collar spines. A 6-yr field survey showed that the cockle population at Banc d'Arguin was subjected to a summer infection of C. arguinae. Curtuteria arguinae phenology of infection is characterized by interannual variability and seasonality (beginning in July-August and maximum in autumn). The first intermediate and final hosts remain unknown.

Extracts and Fractions from Edible Roots of Sechium edule (Jacq.) Sw. with Antihypertensive Activity

PubMed Central

Lombardo-Earl, Galia; Roman-Ramos, Rubén; Zamilpa, Alejandro; Herrera-Ruiz, Maribel; Rosas-Salgado, Gabriela; Tortoriello, Jaime; Jiménez-Ferrer, Enrique

2014-01-01

Sechium edule is traditionally used in Mexico as a therapeutic resource against renal diseases and to control high blood pressure. The purpose of this work is to evaluate the antihypertensive effect of the hydroalcoholic extract obtained from the roots of this plant, including its fractions and subfractions, on different hypertension models induced with angiotensin II (AG II). The hydroalcoholic extract was tested on an in vitro study of isolated aorta rings denuded of endothelial cells, using AG II as the agonist; this assay proved the vasorelaxant effect of this extract. Vagotomized rats were administered different doses of AG II as well as the Hydroalcoholic extract, which reduced blood pressure in 30 mmHg approximately; subsequently this extract was separated into two fractions (acetone and methanol) which were evaluated in the acute hypertension mouse model induced with AG II, where the acetone fraction was identified as the most effective one and was subsequently subfractioned using an open chromatographic column packed with silica gel. The subfractions were also evaluated in the acute hypertension model. Finally, the extract, fraction, and active subfraction were analyzed by MS-PDA-HPLC, identifying cinnamic derivative compounds like cinnamic acid methyl ester. PMID:24812568

Mass mortalities in bivalve populations: A review of the edible cockle Cerastoderma edule (L.)

NASA Astrophysics Data System (ADS)

Burdon, Daryl; Callaway, Ruth; Elliott, Michael; Smith, Tim; Wither, Andrew

2014-10-01

Mass mortalities in bivalve populations have long been of particular concern, especially when the species supports a commercial fishery or is of conservation interest. Here we consider the evidence of mass mortalities of the edible cockle, Cerastoderma edule (L.). Through the construction of a conceptual model eight potential factors (or groups of factors) which may cause mass mortalities are identified and reviewed. These include: food limitation; density; oxygen depletion and organic loadings; temperature and salinity; parasites, pathogens and commensals; toxicants and other persistent pollutants; predation, and changes in sediment, suspended solids, topography and bathymetry. The interplay between factors in recognized and discussed based on evidence mainly from the published literature relating to temperate edible cockle beds. Anecdotal evidence is also reported from a structured survey of site-specific evidence provided by fisheries managers in England and Wales. Case studies from the UK and Europe indicate that there is often no single, clear generic cause of mass mortalities in cockle populations. The importance of linked site-specific scientific investigations and laboratory-based experiments to fill the gaps in our current understanding of mass mortalities in bivalve species is highlighted as necessary to take account of both local extrinsic and intrinsic factors.

Determination and reoxidation of the disulfide bridges of a squash-type trypsin inhibitor from Sechium edule seeds.

PubMed

Faça, Vitor M; Pereira, Sandra R; Laure, Hélen J; Greene, Lewis J

2004-07-01

The determination of the disulfide pairings of SETI-II, a trypsin inhibitor isolated from Sechium edule, is described herein. The inhibitor contains 31 amino acid residues per mol, 6 of which are cysteine. Forty-five nmol (160 microg) of SETI-II was hydrolyzed with 20 microg thermolysin for 48 hr at 45 degrees C, and peptides were separated by reverse phase high performance liquid chromatography (RP-HPLC). The major products were identified by amino acid composition, Edman degradation, and on the basis of the sequence of the inhibitor. The disulfide bridge pairings and (yields) are: Cys1-Cys4 (79%), Cys2-Cys5 (21%) and Cys3-Cys6 (43%). When the reduced inhibitor was reoxidized with glutathione reduced form (GSH)/glutathione oxidized form (GSSG) at pH 8.5 for 3 hr, full activity was recovered. These data show that disulfide bridge pairing and oxidation can be determined at nanomole levels and that sensitive and quantitative Edman degradation can eliminate the final time- and material-consuming step of disulfide determinations by eliminating the need to purify and cleave each peptide containing a disulfide bridge.

An Analysis of Estimated Versus Actual Development Costs for an Electronics State-of-the-Art (SOA) Extension.

DTIC Science & Technology

1987-12-01

DOWNGPAONG SC-EDULE distributiJ-_ _ . 1.,1J=.ted 4 PERFORMING ORGANZA ;ON REPORT NuMBERIS) S MONiTORING ORGANIZATION REP(CRT %L%𔄂ERS, 6a NAME OF PERFORMING...process. It is the one where assistance of other technical experts may be required. It may also require some restructuring of the program merely to

Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram.

PubMed

Lalthansanga, James; Samanta, A K

2015-07-01

This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (p<0.01) as compared to G2, G3, and G4. Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram

PubMed Central

Lalthansanga, James; Samanta, A. K.

2015-01-01

Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). Results: During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (p<0.01) as compared to G2, G3, and G4. Conclusion: Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization. PMID:27047176

Ingestion and absorption of particles derived from different macrophyta in the cockle Cerastoderma edule: effects of food ration.

PubMed

Arambalza, U; Ibarrola, I; Navarro, E; Urrutia, M B

2014-02-01

We analyzed the capacity of the common cockle Cerastoderma edule to utilize detrital food particles obtained from three different macrophytes: the vascular plant Juncus maritimus and two green macroalgae (Ulva lactuca and Enteromorpha sp.). We measured feeding and digestive parameters at three concentrations of detritus (0.5, 1.0 and 3.0 mm(3) l(-1)), so that functional relationships between ingestive and digestive processes could be assessed. Increasing concentrations of detritus (food) resulted in a reduction in filtering activity (clearance rate l h(-1)), but an increase in ingestion rate. Consequently, gut content also increased with increasing food concentration, irrespective of food type. In contrast, the trend followed by absorption efficiency with increasing ingestion rate was determined by food type, being significantly reduced (from 0.63 to 0.11) with Juncus but remaining almost constant with the green macroalgae (0.58 ± 0.07 with Ulva) or only minimally reduced (from 0.66 to 0.48 with Enteromorpha). This differential response had clear consequences for energy uptake: absorption rate increased with increasing particulate organic matter with Enteromorpha but decreased with Juncus. We discuss the possible role of digestive parameters such as digestibility, gut content and gut-residence time in the differential utilization of detrital matter from different vegetal origins by cockles.

Responses to salinity stress in bivalves: Evidence of ontogenetic changes in energetic physiology on Cerastoderma edule.

PubMed

Peteiro, Laura G; Woodin, Sarah A; Wethey, David S; Costas-Costas, Damian; Martínez-Casal, Arantxa; Olabarria, Celia; Vázquez, Elsa

2018-05-29

Estuarine bivalves are especially susceptible to salinity fluctuations. Stage-specific sensibilities may influence the structure and spatial distribution of the populations. Here we investigate differences on the energetic strategy of thread drifters (3-4 mm) and sedentary settlers (9-10 mm) of Cerastoderma edule over a wide range of salinities. Several physiological indicators (clearance, respiration and excretion rates, O:N) were measured during acute (2 days) and acclimated responses (7 days of exposure) for both size classes. Our results revealed a common lethal limit for both developmental stages (Salinity 15) but a larger physiological plasticity of thread drifters than sedentary settlers. Acclimation processes in drifters were initiated after 2 days of exposure and they achieved complete acclimation by day 7. Sedentary settlers delay acclimation and at day 7 feeding activity had not resumed and energetic losses through respiration and excretion were higher at the lowest salinity treatment. Different responses facing salinity stress might be related to differences in habitat of each stage. For sedentary settlers which occupy relatively stable niches, energy optimisation include delaying the initiation of the energetically expensive acclimation processes while drifters which occupy less stable environments require a more flexible process which allow them to optimize energy acquisition as fast as possible.

Cryopreservation of chayote (Sechium edule JACQ. SW.) zygotic embryos and shoot-tips from in vitro plantlets.

PubMed

Abdelnour-Esquivel, Ana; Engelmann, Florent

2002-01-01

This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM were successfully cryopreserved using a vitrification technique. Optimal conditions included the culture of mother-plants for 22 days on medium containing 0.3 M sucrose, culture of excised apices on the same medium for 1 day, loading of apices for 20 min with 2M glycerol + 0.4M glycerol, treatment with a series of diluted PVS2 solution (60 % PVS2 followed by 80 % PVS2 solution for 15 min (cultivar Cocoro Blanco [CB]) or 30 min (cultivars CN and Cl) at each concentration), rapid freezing and thawing, washing of shoot-tips with a 1.2 M sucrose solution, followed by recovery on media with progressively decreasing sucrose concentrations until the standard concentration of 0.1 M was reached. The highest survival percentages achieved ranged between 17 and 38 %, depending on the cultivar.

The Use of Tailored Testing with Instructional Programs.

DTIC Science & Technology

1986-03-01

AVAILABILITY OF REPORT Approved for public release: distribution un- t~X DWNCADNGSCHiEDULE li-mited. Reproduction in whole or in part is...of Education ,-’ Washington, DC 20V 0 Chicago, IL r06𔄁 Air Force Human Resources Lab Cdt. Arnold Bohrer . AFHRL/MPD Sectie Psychologisch Cnderzoek...University of Texas-Austin Univ-ir-tat Puss-ldorf Measurement and Evalu-,tion Er zi, gswi ssensch;ftl iches Cpnter Un ivf rsit ’tsst r. 1 Austin, TX 787

Atmospheric Triatomic Molecular Studies.

DTIC Science & Technology

1980-11-17

ADORE.SS(Jf dlII.,.nt tra 05), tivl 15, SECURITY CLA’.SS. (of this rwpofl) __ 1 P7 jl / 15&. DECLASSJFI CAT DJGft*114I1 -J SCmEDULE If- DiSTRIBUT ION...work in Table I are given in Appendix I. I (3) 41 S. - I + t/n LU ) *C14~ & c .) a)Z. W i 0 0 uL a) NCDNN N 0 4-3 0) cl b -4 cu a x of acca Lm %- a

Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule).

PubMed

Mateos, Sergio Espíndola; Cervantes, Carlos Alberto Matías; Zenteno, Edgar; Slomianny, Marie-Christine; Alpuche, Juan; Hernández-Cruz, Pedro; Martínez-Cruz, Ruth; Canseco, Maria del Socorro Pina; Pérez-Campos, Eduardo; Rubio, Manuel Sánchez; Mayoral, Laura Pérez-Campos; Martínez-Cruz, Margarito

2015-10-23

β-Glucosidase (EC 3.2.1.21) is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule) was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1), in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results). One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min(-1). The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

Larger Units: Theater Army -- Army Group -- Field Army

DTIC Science & Technology

1985-01-01

la ing r sky. To prove val ire pport, ire ntrol arties rom h rtillery attalion ceived rai ing serving ntrolling val nfire . rangements ere r ir...servation ntrol f val ire. fantry iv sion val nfire iaison ficer signed. 43 t lization ir sets s y sed e rinciple at ir rength uld ~ ept der...en eaters resented other rce f.ten on . acArthur, r a ple, rrowed al rps) its o , is fusal lease ips edule ened val nfire port e arine

Assessing the Value of Department of Defense Lands in Alaska to a Declining Species, the Rusty Blackbird

DTIC Science & Technology

2008-02-01

Sweet gale (Myrica gale) 1.7 ± 0.7 3.3 ± 1.2 1.6 0.0 ± 0.0 0.3 ± 0.2 * Bog cranberry (Oxycoccus microcarpus) 0.6 ± 0.3...Vaccinium vitis-idaea) 3.0 ± 0.9 2.1 ± 0.6 2.3 0.6 ± 0.3 0.9 ± 0.5 4.0 Highbush cranberry (Viburnum edule) 0.5 ± 0.4 0.5

TIS - Beyond Electronic Mail.

DTIC Science & Technology

1979-01-01

UNCLASSIFIED AFIT-CI-79-22T NL;IEllllllEI mIIIhElhElhEI IIIIEEEEEEEEEE EIIIIEEIIIIII IIIIIIEEIIIIEE EIIIIIEIIIIII IIIIIIIIIIIIII LINCI.ASS SECURITY ... SECURITY CLASS. (of thgo report) UNCLASS I ~ f~ ;~ 7 -i; yISO. OECLASSIFrICATIoN/oowNGdrAiNG6i ; SCH EDULE 44: OSISTRIBUTION STAEMENT (ofth ft~ipot APPROVED...IC). - SECURITY CLASSIFICATION OF THIS PAGE (W~hen Dotes Entered) Darwish Mo d I., ynn, 1 T., ilson, e L. (M.S. Ole ic ions) TI - ond Ele roni y~ii es

Detection of Tetrodotoxin Shellfish Poisoning (TSP) Toxins and Causative Factors in Bivalve Molluscs from the UK

PubMed Central

Turner, Andrew D.; Dhanji-Rapkova, Monika; Coates, Lewis; Bickerstaff, Lesley; Milligan, Steve; O’Neill, Alison; Faulkner, Dermot; McEneny, Hugh; Baker-Austin, Craig; Lees, David N.; Algoet, Myriam

2017-01-01

Tetrodotoxins (TTXs) are traditionally associated with the occurrence of tropical Pufferfish Poisoning. In recent years, however, TTXs have been identified in European bivalve mollusc shellfish, resulting in the need to assess prevalence and risk to shellfish consumers. Following the previous identification of TTXs in shellfish from southern England, this study was designed to assess the wider prevalence of TTXs in shellfish from around the coast of the UK. Samples were collected between 2014 and 2016 and subjected to analysis using HILIC-MS/MS. Results showed the continued presence of toxins in shellfish harvested along the coast of southern England, with the maximum concentration of total TTXs reaching 253 µg/kg. TTX accumulation was detected in Pacific oysters (Crassostrea gigas), native oysters (Ostrea edulis) common mussels (Mytilus edulis) and hard clams (Mercenaria mercenaria), but not found in cockles (Cerastoderma edule), razors (Ensis species) or scallops (Pecten maximus). Whilst the highest concentrations were quantified in samples harvested during the warmer summer months, TTXs were still evident during the winter. An assessment of the potential causative factors did not reveal any links with the phytoplankton species Prorocentrum cordatum, instead highlighting a greater level of risk in areas of shallow, estuarine waters with temperatures above 15 °C. PMID:28867772

Assessing the role of benthic filter feeders on phytoplankton production in a shellfish farming site: Mont Saint Michel Bay, France

NASA Astrophysics Data System (ADS)

Cugier, Philippe; Struski, Caroline; Blanchard, Michel; Mazurié, Joseph; Pouvreau, Stéphane; Olivier, Frédéric; Trigui, Jihane R.; Thiébaut, Eric

2010-07-01

The macrobenthic community of Mont Saint Michel Bay (English Channel, France) is mainly dominated by filter feeders, including cultivated species (oysters and mussels). An ecological model of the bay was developed, coupling a 2D hydro-sedimentary model and two biological models for primary production and filter-feeder filtration. The filter-feeder model includes three cultivated species ( Mytilus edulis, Crassostrea gigas and Ostrea edulis), one invasive species ( Crepidula fornicata) and eight wild native species ( Abra alba, Cerastoderma edule, Glycymeris glycymeris, Lanice conchilega, Macoma balthica, Paphia rhomboides, Sabellaria alveolata, andSpisula ovalis). For cultivated and invasive species, the production of biodeposits was computed to assess their role in restimulating primary production. Chlorophyll a concentrations appeared to be strongly controlled by the filter feeders. When the pressure of each benthic compartment on phytoplankton was estimated separately wild species and the invasive slipper limpet C.fornicata were shown to be key elements in the control of primary production. Conversely, the role of cultivated species, particularly oysters, was weaker. Feedback due to the mineralization of biodeposits also appears to be crucial to fully evaluate the role of filter feeders in primary production.

Minute co-variations of Sr/Ca ratios and microstructures in the aragonitic shell of Cerastoderma edule (Bivalvia) - Are geochemical variations at the ultra-scale masking potential environmental signals?

NASA Astrophysics Data System (ADS)

Füllenbach, Christoph S.; Schöne, Bernd R.; Shirai, Kotaro; Takahata, Naoto; Ishida, Akizumi; Sano, Yuji

2017-05-01

It remains a challenging task to reconstruct water temperatures from Sr/Ca ratios of bivalve shells. Although in many aragonitic species, Sr/Ca is negatively correlated to temperature - which is expected based on abiogenic precipitation experiments, the incorporation of Sr into the shell of bivalves is strongly controlled by physiological processes and occurs away from the predicted thermodynamic equilibrium. Strontium-to-calcium ratios of aragonitic shells remain far below that of the ambient water. Moreover, Sr concentrations vary considerably among shell portions consisting of different microstructures and/or organic content. Values observed at annual growth lines and within the intervening shell portions (= annual growth increments) deviate much stronger from each other than expected from a change in temperature or Sr/Cawater. As demonstrated here by ultra-high-resolution chemical analysis (EPMA, NanoSIMS) of a Cerastoderma edule shell, Sr concentrations are also heterogeneously distributed at approximately micrometer resolution. For example, in the outer portion of the outer shell layer, Sr/Ca ratios were statistically significantly (t-, u-tests) higher at circatidal growth lines (irregular simple prismatic structure; arithmetic mean ± 1 standard deviation = 2.86 ± 0.38 mmol/mol; n = 53) than within circatidal increments (nondenticular prismatic structure; 2.42 ± 0.25 mmol/mol; n = 51). S/Cashell, a representative of the concentration of organics, showed the opposite pattern, i.e., significantly higher values in circatidal increments (2.37 ± 0.29 mmol/mol; n = 51) than at circatidal growth lines (2.13 ± 0.47 mmol/mol; n = 53). Overall highest values of Sr/Cashell (3.47 ± 0.65 mmol/mol; n = 3) and S/Cashell (3.98 ± 0.65 mmol/mol; n = 3), however, were typically associated with annual growth lines and larger biomineral units. The intimate link between Sr/Cashell, S/Cashell and shell architecture may indicate that microstructures or the processes controlling their formation exert a strong control over the incorporation of strontium into shells of C. edule. Analytical techniques with lower sampling resolution, e.g., LA-ICP-MS, cannot resolve such fine-scale Sr variations. As a result, the signal-to-noise ratio decreases and the data generated by such techniques may therefore not seem to provide useful paleotemperature data. Future studies should therefore employ a combined analysis of Sr/Cashell and shell microstructures, and interpret Sr/Ca values of shell portions with different microstructures separately.

Effect of some habitual cooking processes on the domoic acid concentration in the cockle (Cerastoderma edule) and Manila clam (Ruditapes philippinarum).

PubMed

Vidal, A; Correa, J; Blanco, J

2009-07-01

The effect of cooking on the concentration and burden of domoic acid in two bivalve molluscs was studied. The Manila clam (Ruditapes philippinarum) and cockle (Cerastoderma edule) were subjected to steaming and boiling, respectively. In both cases, factorial plans were used to evaluate the effects of common cooking methods and the variations likely to take place during the cooking procedure (cooking time and salt concentration in both species, in addition to ethanol percentage in Manila clam). The domoic acid concentration and toxin content were affected by cooking in very different ways in the two species studied. The cockle lost a significant part of its domoic acid content, while the clam did not. Since the weight of the soft tissues in cooked bivalves was lower than in the raw samples in both species, the toxin concentration decreased less than the toxin burden in the cockle, while it increased in the clam, where the toxin burden did not change significantly. Among the cooking variables tested, only cooking time had a noticeable effect on the domoic acid content in the clam and cockle, with the bivalves that were cooked for a longer time having smaller amounts of toxin. It is clear that cooking affects the toxin concentration in bivalves in a way that is species specific. This characteristic must be taken into account when evaluating epidemiological information, establishing allowable toxin levels and in cases where pre-processing treatments such as cooking or similar methods are used in monitoring systems.

Stability Analysis of Interconnected Random-Access Networks.

DTIC Science & Technology

1986-04-01

NERAKOS ET AL. APR 6 UCLRSSIFIED UCT/ DEECS /TR-116-6 RFOSR-TR-86-0552 FIG 07/2 M WII, 1j08 1225 11111 .g.02 MICROCOPY RESOLUTION TEST CHART NATIONAL BUREAU...SCH4EDULE Unlimited NA 4. PERFORMING ORGANIZATION REPORT NUMBERIS) S. MONITORING ORGANIZATION REPORT NUMEER(S) UCT/ DEECS /TR-86-6 A’FOSR.TR. 8 6 - 0 Ga...theorem 2 in [71, as in (10), we have that - - . - - --i -- - - -- * ,,, * ..J - -...... -18- f n E(- U-1 A.. Ee) P Ia a.e. (14) nin i n-11 lrn n1 l -i n1

Digestive selection underlies differential utilization of phytoplankton and sedimentary organics by infaunal bivalves: Experiments with cockles (Cerastoderma edule) using cross-labelled mixed diets.

PubMed

Navarro, Enrique; Méndez, Soco; Urrutia, Miren Begoñe; Arambalza, Udane; Ibarrola, Irrintzi

2016-09-01

Differential utilization of phytoplankton and detrital particles present in natural sediments of mud-flats was studied in a series of experiments performed on the infaunal bivalve Cerastoderma edule. In order to assess digestive selection, parameters of food processing (organic ingestion rate: OIR, gross absorption efficiency: GAE and gut passage time: GPT) were recorded for each organic component in different combinations of food particles radio-labelled with (14)C. Experimental design included the use of both labelled diets of a sole organic component and cross-labelled diets; i.e., mixed suspensions presenting alternatively labelled one of the various components tested: phytoplankton cells, sedimentary organic particles and particulate detritus from vascular salt-marsh plants. Preferential absorption of phytoplankton was accounted for by absorption efficiency values that were two-fold those for sedimentary detritus when recorded with mixed diets of both organic components. Two factors contributed to this difference: a) higher digestibility of microalgae, measured as the ratio of GAE to GPT, and b) faster gut passage of detrital particles that results from digestive selection likely involving the preferential incorporation of phytoplankton into the digestive gland. However, when diets based on a sole organic component (either phytoplankton or detritus) were compared, larger GPT were recorded for detrital particles that enabled improving GAE of this rather refractory food. Overall results of these experiments are consistent with most studies in trophic ecology based on stable isotopes enrichment, concerning both the diversity of trophic sources used by marine bivalves and its preferential utilization of phytoplankton over phyto-detritus. Copyright © 2016 Elsevier Ltd. All rights reserved.

Limitations of metallothioneins in common cockles (Cerastoderma edule) and sponges (Haliclona oculata) as biomarkers of metal contamination in a semi-enclosed coastal area.

PubMed

Aly, W; Williams, I D; Hudson, M D

2014-03-01

Poole Harbour is typical of many heavily anthropologically impacted semi-enclosed estuarine coastal areas under pressure from metal pollution across the world. This study examined the physiological significance of metal burdens within that sensitive area, and assessed the potential use of metallothionein (MT) concentrations in two organisms: the common cockle (Cerastoderma edule) and the Mermaid's glove sponge (Haliclona oculata) for mapping the spatial extent of the biological response to metal contamination. A spectrophotometric method was applied for detection of MT in the bivalve, and for the first time to detect MT in sponges. The results show that while some metal concentrations in cockle and sponge tissues and in their surrounding environment (water and sediment) could be related to sources of metal contamination, MT values in the soft tissue of cockles and whole tissue of sponges are not. No relation could be found between MT in both cockles and sponges, and any of the tested metals (As, Cd, Cr, Cu, Pb, Hg, Ni, Ag, Sn, Zn). Furthermore, some of the lowest MT concentrations were detected in heavily polluted areas, indicating that MT concentrations in tested organisms are not exclusively associated with metal concentrations, as other environmental factors could affect induction of this protein. Organisms probably have a high tolerance to metal contamination and chronic exposure to a high level of contamination resulted in developing a variety of detoxification mechanisms. Results indicate that further study of metal stress in this type of ecosystem may need to examine other indicator species and/or apply a different biomonitoring technique. Copyright © 2013 Elsevier B.V. All rights reserved.

Fruit extract from a Sechium edule hybrid induce apoptosis in leukaemic cell lines but not in normal cells.

PubMed

Aguiñiga-Sánchez, Itzen; Soto-Hernández, Marcos; Cadena-Iñiguez, Jorge; Ruíz-Posadas, Lucero del Mar; Cadena-Zamudio, Jorge David; González-Ugarte, Ana Karen; Steider, Benny Weiss; Santiago-Osorio, Edelmiro

2015-01-01

The antiproliferative potential of a crude extract from the chayote hybrid H-837-07-GISeM® and its potential for apoptosis induction were assessed in leukaemic cell lines and normal mouse bone marrow mononuclear cells (BM-MNCs). The extract strongly inhibited the proliferation of the P388, J774, and WEHI-3 cell lines (with an IC50 below 1.3 μg·mL(-1)), reduced cell viability, and induced apoptotic body production, phosphatidylserine translocation, and DNA fragmentation. However, the extract had no effect on BM-MNCs. We postulate that these properties make the extract a good candidate for an anti-tumour agent for clinical use.

Troglobitic invertebrates: improving the knowledge on the Brazilian subterranean biodiversity through an interactive multi-entry key.

PubMed

Parizotto, Daniele R; Pires, Amanda Ciprandi; Mise, Kleber Makoto; Ferreira, Rodrigo Lopes

2017-12-19

Troglobitic species are those organisms restricted to caves that frequently present unique morphological features related to these environments. In order to study its ecology, evolution and biogeography, it is first required to properly recognize them. However, especially in Brazil, the basic knowledge is still incipient, with few taxonomic studies such as identification keys for this group of organisms. In addition, since the troglobitic species belong to different taxonomic groups, the information to properly recognize them is often sparse and difficult to access. Considering this, an interactive multi entry taxonomic key available online is an interesting approach, as it makes identifications easier. This study aims to construct a multi-access interactive identification key to the troglobitic invertebrates of Brazil, using morphological characters obtained from literature and direct observations of specimens. The key was made in Lucid version 3.3, containing figures of most characters. It comprises seventy-eight species of troglobitic invertebrates that occur in Brazil, forming a matrix of 231 morphological characters and more than 200 images to support identification. The key is freely available online on lucid central (http://keys.lucidcentral.org/keys/v3/troglobitic_invertebrates/troglobitic_invertebrates.html). Since Brazilian laws regarding cave conservation has change in 2008, allowing even the destruction of caves, this multi-access identification key is step to reduce the existing taxonomic impediment and also an important tool for identification of troglobites, especially for non-specialists.

Ingestion, enzymatic digestion and absorption of particles derived from different vegetal sources by the cockle Cerastoderma edule

NASA Astrophysics Data System (ADS)

Arambalza, U.; Urrutia, M. B.; Navarro, E.; Ibarrola, I.

2010-10-01

Ingestion, enzymatic digestion and absorption of particulate detrital matter derived from six different vegetal sources by the common cockle Cerastoderma edule was analyzed in a series of seasonal experiments performed in March, May and October 2005. Two green macroalgae: Ulva lactuca and Enteromorpha sp; two vascular plants: Spartina maritima and Juncus maritimus, the red macroalgae Gracilaria gracilis; and the microalgae Isochrysis galbana were used in experiments. Detrital matter was elaborated by freeze-drying, grinding and sieving (< 63 μm) vegetal tissues. Mono-specific detrital diets of similar organic content (≈ 60-70%) were elaborated by mixing detritus with ashed silt. We measured i) the biochemical composition of different detritus, ii) physiological components of the absorptive balance (i.e. clearance, ingestion, rejection and absorption rate and absorption efficiency), iii) the capability of the digestive gland to hydrolyze carbohydrates from different detritus (digestibility), as well as iv) glandular cellulase and xylanase activities. Detritus type, season and the interaction detritus-season exerted significant effects upon all the physiological components of absorptive balance. Effects were light at the pre-absorptive level, however, huge variations associated to absorption efficiency promoted large significant differences in absorption rates (AR) of different kind of detritus: irrespective of season, highest values corresponded to cockles fed the green macroalgae ( Ulva and Enteromorpha) and lowest to those fed the vascular plant Juncus maritimus. Recorded significant differences in enzymatic digestibility among detritus were found to explain ≈ 40% of differences recorded in AR, and the following regression could be fitted: AR = 0.232 (± 0.032) * Digestibility + 0,072 (± 0.015); r 2 = 0.415; F = 51.036; p < 0.001. Digestibility of Ulva and Enteromorpha was found to be significantly correlated with cellulase activity in the digestive gland, whereas digestibility of Juncus, Spartina and Gracilaria was correlated with xylanase activity. Obtained correlations are discussed in the frame of contrasting conclusions in the literature regarding the importance of detritus as a food source for bivalves.

An immunohistochemical identification key for cell types in adult mouse prostatic and urethral tissue sections

PubMed Central

Turco, Anne E.; Gottschalk, Adam; Halberg, Richard B.; Guo, Jinjin; McMahon, Jill A.; McMahon, Andrew P.

2017-01-01

Though many methods can be used to identify cell types contained in complex tissues, most require cell disaggregation and destroy information about where cells reside in relation to their microenvironment. Here, we describe a polytomous key for cell type identification in intact sections of adult mouse prostate and prostatic urethra. The key is organized as a decision tree and initiates with one round of immunostaining for nerve, epithelial, fibromuscular/hematolymphoid, or vascular associated cells. Cell identities are recursively eliminated by subsequent staining events until the remaining pool of potential cell types can be distinguished by direct comparison to other cells. We validated our identification key using wild type adult mouse prostate and urethra tissue sections and it currently resolves sixteen distinct cell populations which include three nerve fiber types as well as four epithelial, five fibromuscular/hematolymphoid, one nerve-associated, and three vascular-associated cell types. We demonstrate two uses of this novel identification methodology. We first used the identification key to characterize prostate stromal cell type changes in response to constitutive phosphatidylinositide-3-kinase activation in prostate epithelium. We then used the key to map cell lineages in a new reporter mouse strain driven by Wnt10aem1(cre/ERT2)Amc. The identification key facilitates rigorous and reproducible cell identification in prostate tissue sections and can be expanded to resolve additional cell types as new antibodies and other resources become available. PMID:29145476

Sodium-chromium covariation in residual clinopyroxenes from abyssal peridotites sampled in the 43°-46°E region of the Southwest Indian Ridge

NASA Astrophysics Data System (ADS)

Seyler, Monique; Brunelli, Daniele

2018-03-01

Mantle-derived peridotites sampled at three dredge sites between the Discovery and Indomed fracture zones on the Southwest Indian Ridge axis are analyzed for petrography and major and trace element mineral compositions. While textures and microstructures are those typical of normal residual peridotites these rocks display a large compositional variation encompassing the whole spectrum of abyssal peridotites even at the scale of a single dredge site (≤ 1 km). Particularly, clinopyroxenes in peridotites dredged at 44.03°E show a huge variation in sodium contents positively correlated with chromium concentrations. Observed Nasbnd Cr enrichments exceed the commonly reported contents of the spinel abyssal peridotites. Similar values are also found in very few peridotite samples collected at ultra-slow spreading ridges. Major substitutions governing the compositions of these clinopyroxenes suggest that Nasbnd Cr covariation is caused by a more rapid decrease in Al-Tschermak's molecule with respect to the sodic components jadeite ± kosmochlor, as Cr/Al increases and modal clinopyroxene decreases. We conclude that sodium and chromium enrichments must have occurred contemporaneously with aluminum depletion, i.e., during partial melting. Our modelling suggests that partial, non-modal, melting of a depleted peridotite in association with addition of sodium, by percolation of a Na-rich melt in the upwelling mantle, or Na diffusion from a nearby alkaline melt, may explain this enigmatic and counterintuitive trend. A) SWF-26-2-5: Lherzolite; B) SWF-26-2-7: Harzburgite; C) SWF-26-2-11: Lherzolite; D) SWF-26-2-9: Lherzolite with large pyroxene clusters; E) SWF-27-1-12: Harzburgite. Scale bar = 5 cm. Data show that the compositions of these peridotites do not follow fractional melting trends but plot toward Sm and Ce enrichments relative to Yb at decreasing Yb contents. In the same sampling site, clinopyroxenes highly enriched both in Na2O (> 1 wt.%) and Cr2O3 (> 1.5 wt.%) have higher SmN/YbN ratios (> 0.8) than clinopyroxenes poorer in Na and Cr. The two clinopyroxenes having the highest SmN/YbN (2.1, 2.4) and CeN/YbN (0.8, 1.8) ratios have REE patterns indicating of equilibration with an alkaline basalt or a melt derived from a garnet-bearing source [e.g., EDUL Dr6-1-2, Seyler et al. (2011) and PS55-90-20, Hellebrand and Snow (2003)]. However, CeN/YbN ratios do not increase linearly with increasing Na2O and/or Cr2O3. In EDUL peridotites, trends of increasing SmN/YbN and CeN/YbN vs YbN can be modelled by near-batch melting of a depleted spinel peridotite influxed with a melt derived from a garnet-bearing source (Brunelli et al., 2014). SWF-26 peridotites do not follow the same trends as EDUL Dr6 and Arctic peridotites, suggesting different melting conditions and/or interaction with different melt compositions.

A survey for potential biological control agents of Pereskia aculeata Miller (Cactaceae) in Brazil reveals two new species of Horismenus Walker (Hymenoptera: Eulophidae).

PubMed

Pikart, Tiago G; Costa, Valmir A; Hansson, Christer; Cristo, Sandra C DE; Vitorino, Marcelo D

2017-05-30

This paper deals with the description of two new species of Horismenus Walker (Hymenoptera: Eulophidae) from Brazil, parasitoids of larvae of Adetus analis (Haldeman) (Coleoptera: Cerambycidae). Both species are similar to Horismenus steirastomae (Girault), a species that also parasitizes cerambycids. Adetus analis is a pest of Sechium edule (Jacq.) Swartz (Cucurbitaceae), a minor crop in Brazil, Argentina and U.S.A., but also feeds in stems of Pereskia aculeata Miller (Cactaceae), an ornamental plant that has become a problematic weed species in Africa, where it was introduced. The two new Horismenus species are described, diagnosed, and compared to H. steirastomae.

Isolation of Cryptococcus neoformans var. neoformans from bird droppings, fruits and vegetables in Mexico City.

PubMed

López-Martínez, R; Castañón-Olivares, L R

1995-01-01

The presence of Cryptococcus neoformans in various natural sources, such as bird droppings, fruits and vegetables, was investigated. A total of 711 samples were analyzed; C. neoformans var. neoformans was isolated from seven out of 74 bird droppings (9.5%), with parrots as one of the most significant sources. Fruits were positive in 9.5% of the 169 samples studied, specially citrus fruits, particularly grapefruit, in which the highest frequency was found. From the 468 vegetable samples, only 20 were positive (4.2%). It is emphasized that five of the positive vegetables species are autochthonous to Mexico: avocado (Nectandra salicifolia), beet (Beta vulgaris var. quinopodiace), chayote (Sechium edule), stringbean (Cassia sp), and nopal (Opuntia ficus-indica).

Integrated Battlefield Effects Research for the National Training Center. Appendix B. Requirements Design Specification for the Addition of Nuclear and Chemical Capabilities to the National Training Center (NTC) Core Instrumentation Subsystem (CIS)

DTIC Science & Technology

1984-12-31

NiGjA0’NG S04EDULE suniitd N /A since Unclassified A OER04ORMING ORG.AP4IMIOIJ REPORT NUMBER(S) S. MONITORING ORGAzuZ.lION AEPORT NI.JMSEMR(S) R:LJF-84...foot-poad-toro~ Joule (J) 1.355 I1I galo0 (U.S. Liquid) setar ( I( 3.735 412 xI -), inch eater (a) 2.540000 N I - jrk joule M) [.am 000 x 4. joule...Division (How to Fight), FM 11-50, 8. Military Symbols, FM 21-30. 9. NBC (Nuclear, Biological and Chemical) Defense, FM 21-40. N " 10. Combat Communications

A visual identification key utilizing both gestalt and analytic approaches to identification of Carices present in North America (Plantae, Cyperaceae)

PubMed Central

2013-01-01

Abstract Images are a critical part of the identification process because they enable direct, immediate and relatively unmediated comparisons between a specimen being identified and one or more reference specimens. The Carices Interactive Visual Identification Key (CIVIK) is a novel tool for identification of North American Carex species, the largest vascular plant genus in North America, and two less numerous closely-related genera, Cymophyllus and Kobresia. CIVIK incorporates 1288 high-resolution tiled image sets that allow users to zoom in to view minute structures that are crucial at times for identification in these genera. Morphological data are derived from the earlier Carex Interactive Identification Key (CIIK) which in turn used data from the Flora of North America treatments. In this new iteration, images can be viewed in a grid or histogram format, allowing multiple representations of data. In both formats the images are fully zoomable. PMID:24723777

The "Key" Method of Identifying Igneous and Metamorphic Rocks in Introductory Laboratory.

ERIC Educational Resources Information Center

Eves, Robert Leo; Davis, Larry Eugene

1987-01-01

Proposes that identification keys provide an orderly strategy for the identification of igneous and metamorphic rocks in an introductory geology course. Explains the format employed in the system and includes the actual key guides for both igneous and metamorphic rocks. (ML)

Bryophytes for Beginners: The Usability of a Printed Dichotomous Key versus a Multi-Access Computer-Based Key for Bryophyte Identification

ERIC Educational Resources Information Center

Stagg, Bethan C.; Donkin, Maria E.; Smith, Alison M.

2015-01-01

Bryophytes are a rewarding study group in field biology and the UK bryophyte flora has international importance to biodiversity conservation. We designed an identification key to common woodland moss species and compared the usability of two formats, web-based multi-access and printed dichotomous key, with undergraduate students. The rate of…

ChiloKey, an interactive identification tool for the geophilomorph centipedes of Europe (Chilopoda, Geophilomorpha).

PubMed

Bonato, Lucio; Minelli, Alessandro; Lopresti, Massimo; Cerretti, Pierfilippo

2014-01-01

ChiloKey is a matrix-based, interactive key to all 179 species of Geophilomorpha (Chilopoda) recorded from Europe, including species of uncertain identity and those whose morphology is known partially only. The key is intended to assist in identification of subadult and adult specimens, by means of microscopy and simple dissection techniques whenever necessary. The key is freely available through the web at: http://www.biologia.unipd.it/chilokey/ and at http://www.interactive-keys.eu/chilokey/.

Using Web-Based Key Character and Classification Instruction for Teaching Undergraduate Students Insect Identification

ERIC Educational Resources Information Center

Golick, Douglas A.; Heng-Moss, Tiffany M.; Steckelberg, Allen L.; Brooks, David. W.; Higley, Leon G.; Fowler, David

2013-01-01

The purpose of the study was to determine whether undergraduate students receiving web-based instruction based on traditional, key character, or classification instruction differed in their performance of insect identification tasks. All groups showed a significant improvement in insect identifications on pre- and post-two-dimensional picture…

IMBLMS phase B4, additional tasks 5.0. Microbial identification system

NASA Technical Reports Server (NTRS)

1971-01-01

A laboratory study was undertaken to provide simplified procedures leading to the presumptive identification (I/D) of defined microorganisms on-board an orbiting spacecraft. Identifications were to be initiated by nonprofessional bacteriologists, (crew members) on a contingency basis only. Key objectives/constraints for this investigation were as follows:(1) I/D procedures based on limited, defined diagnostic tests, (2) testing oriented about ten selected microorganisms, (3) provide for definitive I/D key and procedures per selected organism, (4) define possible occurrences of false positives for the resulting I/D key by search of the appropriate literature, and (5) evaluation of the I/D key and procedure through a limited field trial on randomly selected subjects using the I/D key.

Sea snakes in Australian waters (Serpentes: subfamilies Hydrophiinae and Laticaudinae)--a review with an updated identification key.

PubMed

Rasmussen, Arne Redsted; Sanders, Kate Laura; Guinea, Michael L; Amey, Andrew P

2014-10-02

Sea snakes (Elapidae, subfamilies Hydrophiinae and Laticaudinae) reach high species richness in the South China Sea and in the Australian region; however, most countries in the two regions still lack up-to-date checklists and identification tools for these snakes. We present an updated reviewed checklist and a new complete identification key to sea snakes in Australian waters. The identification key includes 29 species documented and 4 possibly occurring taxa and is based mostly on easy-to-use external characters. We find no evidence for breeding populations of Laticauda in Australian waters, but include the genus on the list of possibly occurring taxa. 

Dichotomous Identification Keys: A Ladder to Higher Order Knowledge about the Human Body

ERIC Educational Resources Information Center

Sorgo, Andrej

2006-01-01

We tried to enrich teaching human anatomy in high school biology lessons. Students construct dichotomous identification keys to the cells, tissues, organs, or body parts. By doing this, students have achieved higher-order cognitive levels of knowledge because construction of such keys is based on analysis, synthesis, and evaluation. Students found…

Using Web-Based Key Character and Classification Instruction for Teaching Undergraduate Students Insect Identification

NASA Astrophysics Data System (ADS)

Golick, Douglas A.; Heng-Moss, Tiffany M.; Steckelberg, Allen L.; Brooks, David. W.; Higley, Leon G.; Fowler, David

2013-08-01

The purpose of the study was to determine whether undergraduate students receiving web-based instruction based on traditional, key character, or classification instruction differed in their performance of insect identification tasks. All groups showed a significant improvement in insect identifications on pre- and post-two-dimensional picture specimen quizzes. The study also determined student performance on insect identification tasks was not as good as for family-level identification as compared to broader insect orders and arthropod classification identification tasks. Finally, students erred significantly more by misidentification than misspelling specimen names on prepared specimen quizzes. Results of this study support that short web-based insect identification exercises can improve insect identification performance. Also included is a discussion of how these results can be used in teaching and future research on biological identification.

A Dichotomous Key for the Identification of Common British Wild Flower Families

ERIC Educational Resources Information Center

Wood, Piers

2004-01-01

This article argues the need for, and provides, a dichotomous single access key for the identification of common British wild flower families. A minimum of technical vocabulary is used while at the same time retaining most of the recent botanical names of families. The key provides a user-friendly opportunity for school pupils to become familiar…

GuiaTreeKey, a multi-access electronic key to identify tree genera in French Guiana.

PubMed

Engel, Julien; Brousseau, Louise; Baraloto, Christopher

2016-01-01

The tropical rainforest of Amazonia is one of the most species-rich ecosystems on earth, with an estimated 16000 tree species. Due to this high diversity, botanical identification of trees in the Amazon is difficult, even to genus, often requiring the assistance of parataxonomists or taxonomic specialists. Advances in informatics tools offer a promising opportunity to develop user-friendly electronic keys to improve Amazonian tree identification. Here, we introduce an original multi-access electronic key for the identification of 389 tree genera occurring in French Guiana terra-firme forests, based on a set of 79 morphological characters related to vegetative, floral and fruit characters. Its purpose is to help Amazonian tree identification and to support the dissemination of botanical knowledge to non-specialists, including forest workers, students and researchers from other scientific disciplines. The electronic key is accessible with the free access software Xper ², and the database is publicly available on figshare: https://figshare.com/s/75d890b7d707e0ffc9bf (doi: 10.6084/m9.figshare.2682550).

A Molecular Key for the Identification of Blow Flies in Southeastern Nebraska

USDA-ARS?s Scientific Manuscript database

The identification of blow flies (Calliphoridae) (typically the first colonizers of cadavers) is difficult, especially in the earlier instars because of their small size, similarity and simplicity in external morphology. We consider how taxonomic keys based on molecular genetic data facilitate accur...

National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Cerataphis brasiliensis

USDA-ARS?s Scientific Manuscript database

Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the palm aphid, Cerataphis brasiliensis, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures...

An Identification Key to Rodent Prey in Owl Pellets from the Northwestern and Southeastern United States: Employing Incisor Size to Distinguish among Genera

ERIC Educational Resources Information Center

Hager, Stephen B.; Cosentino, Bradley J.

2006-01-01

We present an identification key to the common rodent prey found in owl pellets from the Northwestern (NW) and Southeastern (SE) United States that is based on differences in incisor size (arc diameter) among genera.

National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Myzus persicae

USDA-ARS?s Scientific Manuscript database

Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the green peach aphid, Myzus persicae, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures t...

National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Aphis gossypii

USDA-ARS?s Scientific Manuscript database

Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the cotton aphid, Aphis gossypii, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures that ca...

An Interactive Multimedia Dichotomous Key for Teaching Plant Identification

ERIC Educational Resources Information Center

Jacquemart, Anne-Laure; Lhoir, Pierre; Binard, Fabian; Descamps, Charlotte

2016-01-01

Teaching plant identification includes demonstrating how to use dichotomous keys; this requires knowledge of numerous botanical terms and can be challenging, confusing and frustrating for students. Here, we developed a multimedia tool to help students (1) learn botanical terms, (2) practice, train and test their knowledge of plant identification…

Development of Teaching Materials for Field Identification of Plants and Analysis of Their Effectiveness in Science Education.

ERIC Educational Resources Information Center

Ohkawa, Chizuru

2000-01-01

Introduces teaching materials developed for field identification of plants with synoptical keys, identification tables, cards, and programs. Selects approximately 2000 seed plants and uses visibly identifiable characteristics for classification. Recommends using the methodology of identification in other areas for biological identification. (YDS)

Teaching Cardiac Examination Skills

PubMed Central

Smith, Christopher A; Hart, Avery S; Sadowski, Laura S; Riddle, Janet; Evans, Arthur T; Clarke, Peter M; Ganschow, Pamela S; Mason, Ellen; Sequeira, Winston; Wang, Yue

2006-01-01

OBJECTIVE To determine if structured teaching of bedside cardiac examination skills improves medical residents' examination technique and their identification of key clinical findings. DESIGN Firm-based single-blinded controlled trial. SETTING Inpatient service at a university-affiliated public teaching hospital. PARTICIPANTS Eighty Internal Medicine residents. METHODS The study assessed 2 intervention groups that received 3-hour bedside teaching sessions during their 4-week rotation using either: (1) a traditional teaching method, “demonstration and practice” (DP) (n=26) or (2) an innovative method, “collaborative discovery” (CD) (n=24). The control group received their usual ward teaching sessions (n=25). The main outcome measures were scores on examination technique and correct identification of key clinical findings on an objective structured clinical examination (OSCE). RESULTS All 3 groups had similar scores for both their examination technique and identification of key findings in the preintervention OSCE. After teaching, both intervention groups significantly improved their technical examination skills compared with the control group. The increase was 10% (95% confidence interval [CI] 4% to 17%) for CD versus control and 12% (95% CI 6% to 19%) for DP versus control (both P<.005) equivalent to an additional 3 to 4 examination skills being correctly performed. Improvement in key findings was limited to a 5% (95% CI 2% to 9%) increase for the CD teaching method, CD versus control P=.046, equivalent to the identification of an additional 2 key clinical findings. CONCLUSIONS Both programs of bedside teaching increase the technical examination skills of residents but improvements in the identification of key clinical findings were modest and only demonstrated with a new method of teaching. PMID:16423116

Scale Insects, edition 2, a tool for the identification of potential pest scales at U.S.A. ports-of-entry (Hemiptera, Sternorrhyncha, Coccoidea)

PubMed Central

Miller, Douglass R.; Rung, Alessandra; Parikh, Grishma

2014-01-01

Abstract We provide a general overview of features and technical specifications of an online, interactive tool for the identification of scale insects of concern to the U.S.A. ports-of-entry. Full lists of terminal taxa included in the keys (of which there are four), a list of features used in them, and a discussion of the structure of the tool are provided. We also briefly discuss the advantages of interactive keys for the identification of potential scale insect pests. The interactive key is freely accessible on http://idtools.org/id/scales/index.php PMID:25152668

Quantum key management

DOEpatents

Hughes, Richard John; Thrasher, James Thomas; Nordholt, Jane Elizabeth

2016-11-29

Innovations for quantum key management harness quantum communications to form a cryptography system within a public key infrastructure framework. In example implementations, the quantum key management innovations combine quantum key distribution and a quantum identification protocol with a Merkle signature scheme (using Winternitz one-time digital signatures or other one-time digital signatures, and Merkle hash trees) to constitute a cryptography system. More generally, the quantum key management innovations combine quantum key distribution and a quantum identification protocol with a hash-based signature scheme. This provides a secure way to identify, authenticate, verify, and exchange secret cryptographic keys. Features of the quantum key management innovations further include secure enrollment of users with a registration authority, as well as credential checking and revocation with a certificate authority, where the registration authority and/or certificate authority can be part of the same system as a trusted authority for quantum key distribution.

Morphological diversity of microstructures occurring in selected recent bivalve shells and their ecological implications

NASA Astrophysics Data System (ADS)

Brom, Krzysztof Roman; Szopa, Krzysztof

2016-12-01

Environmental adaptation of molluscs during evolution has led to form biomineral exoskeleton - shell. The main compound of their shells is calcium carbonate, which is represented by calcite and/or aragonite. The mineral part, together with the biopolymer matrix, forms many types of microstructures, which are differ in texture. Different types of internal shell microstructures are characteristic for some bivalve groups. Studied bivalve species (freshwater species - duck mussel (Anodonta anatina Linnaeus, 1758) and marine species - common cockle (Cerastoderma edule Linnaeus, 1758), lyrate Asiatic hard clam (Meretrix lyrata Sowerby II, 1851) and blue mussel (Mytilus edulis Linnaeus, 1758)) from different locations and environmental conditions, show that the internal shell microstructure with the shell morphology and thickness have critical impact to the ability to survive in changing environment and also to the probability of surviving predator attack. Moreover, more detailed studies on molluscan structures might be responsible for create mechanically resistant nanomaterials.

Polysaccharide composition of raw and cooked chayote (Sechium edule Sw.) fruits and tuberous roots.

PubMed

Shiga, Tânia M; Peroni-Okita, Fernanda Helena Gonçalves; Carpita, Nicholas C; Lajolo, Franco Maria; Cordenunsi, Beatriz Rosana

2015-10-05

Chayote is a multipurpose table vegetable widely consumed in Latin America countries. Chayote fruits, leaves and tuberous roots contain complex carbohydrates as dietary fiber and starch, vitamins and minerals. The complex polysaccharides (cell walls and starch) were analyzed in the black and green varieties of chayote fruits as well as in green chayote tuberous root before and after a controlled cooking process to assess changes in their composition and structure. The monosaccharide composition and linkage analysis indicated pectins homogalacturonans and rhamnogalacturonan I backbones constitute about 15-20% of the wall mass, but are heavily substituted with, up to 60% neutral arabinans, galactans, arabinogalactans. The remainder is composed of xyloglucan, glucomannans and galactoglucomannans. Chayote cell-wall polysaccharides are highly stable under normal cooking conditions, as confirmed by the optical microscopy of wall structure. We found also that tuberous roots constitute a valuable additional source of quality starch and fiber. Published by Elsevier Ltd.

Effectiveness of Reptile Species Identification--A Comparison of a Dichotomous Key with an Identification Book

ERIC Educational Resources Information Center

Randler, Christoph; Zehender, Irene

2006-01-01

Species identification tasks are a prerequisite for an understanding of biodiversity. Here, we focused on different educational materials to foster the identification of six European reptile species. Our educational training unit was based on natural plastic models of six species and pupils either used an illustrated identification book or a…

Bacteria and Archaea in acidic environments and a key to morphological identification

USGS Publications Warehouse

Robbins, E.I.

2000-01-01

Natural and anthropogenic acidic environments are dominated by bacteria and Archaea. As many as 86 genera or species have been identified or isolated from pH <4.5 environments. This paper reviews the worldwide literature and provide tables of morphological characteristics, habitat information and a key for light microscope identification for the non-microbiologist.

Unnatural selection: talent identification and development in sport.

PubMed

Abbott, Angela; Button, Chris; Pepping, Gert-Jan; Collins, Dave

2005-01-01

The early identification of talented individuals has become increasingly important across many performance domains. Current talent identification (TI) schemes in sport typically select on the basis of discrete, unidimensional measures at unstable periods in the athlete's development. In this article, the concept of talent is revised as a complex, dynamical system in which future behaviors emerge from an interaction of key performance determinants such as psychological behaviors, motor abilities, and physical characteristics. Key nonlinear dynamics concepts are related to TI approaches such as sensitivity to initial conditions, transitions, and exponential behavioral distributions. It is concluded that many TI models place an overemphasis on early identification rather than the development of potentially talented performers. A generic model of talent identification and development is proposed that addresses these issues and provides direction for future research.

Are metallothioneins equally good biomarkers of metal and oxidative stress?

PubMed

Figueira, Etelvina; Branco, Diana; Antunes, Sara C; Gonçalves, Fernando; Freitas, Rosa

2012-10-01

Several researchers investigated the induction of metallothioneins (MTs) in the presence of metals, namely Cadmium (Cd). Fewer studies observed the induction of MTs due to oxidizing agents, and literature comparing the sensitivity of MTs to different stressors is even more scarce or even nonexistent. The role of MTs in metal and oxidative stress and thus their use as a stress biomarker, remains to be clearly elucidated. To better understand the role of MTs as a biomarker in Cerastoderma edule, a bivalve widely used as bioindicator, a laboratory assay was conducted aiming to assess the sensitivity of MTs to metal and oxidative stressors. For this purpose, Cd was used to induce metal stress, whereas hydrogen peroxide (H2O2), being an oxidizing compound, was used to impose oxidative stress. Results showed that induction of MTs occurred at very different levels in metal and oxidative stress. In the presence of the oxidizing agent (H2O2), MTs only increased significantly when the degree of oxidative stress was very high, and mortality rates were higher than 50 percent. On the contrary, C. edule survived to all Cd concentrations used and significant MTs increases, compared to the control, were observed in all Cd exposures. The present work also revealed that the number of ions and the metal bound to MTs varied with the exposure conditions. In the absence of disturbance, MTs bound most (60-70 percent) of the essential metals (Zn and Cu) in solution. In stressful situations, such as the exposure to Cd and H2O2, MTs did not bind to Cu and bound less to Zn. When organisms were exposed to Cd, the total number of ions bound per MT molecule did not change, compared to control. However the sort of ions bound per MT molecule differed; part of the Zn and all Cu ions where displaced by Cd ions. For organisms exposed to H2O2, each MT molecule bound less than half of the ions compared to control and Cd conditions, which indicates a partial oxidation of thiol groups in the cysteine residues through ROS scavenging. The present results suggest that MTs are excellent markers of metal stress, but not of oxidative stress. Copyright © 2012 Elsevier Inc. All rights reserved.

Identification of entomopathogenic fungi

USDA-ARS?s Scientific Manuscript database

This chapter provides essential assistance for the identification of the most important genera (and main species) of fungal pathogens affecting insects, mites, and spiders. The key allows identifications regardless of which major spore types might be present with the specimen. The phylogenetic affi...

The Identification of Key Issues in the Development of Sustainable e-Learning and Virtual Campus Initiatives

ERIC Educational Resources Information Center

Stansfield, Mark; Connolly, Thomas; Cartelli, Antonio; Jimoyiannis, Athanassios; Magalhaes, Hugo; Maillet, Katherine

2009-01-01

This paper explores a number of key issues that have been identified as being important in the identification and evaluation of best practice within the context of e-learning and virtual campuses. The "Promoting Best Practice in Virtual Campuses" (PBP-VC) project is a two year European Commission Education Audiovisual and Culture…

Chapter 06: Identification key

Treesearch

Alex Wiedenhoeft

2011-01-01

The key is written to guide you through the identification process in the most efficient and accurate way possible. It presents you with a numbered series of questions and asks you to answer them. The answers you provide will be based on your interpretations of the anatomical characters in your unknown specimen and will lead you to a new set of questions. Each time you...

Keys and the crisis in taxonomy: extinction or reinvention?

PubMed

Walter, David Evans; Winterton, Shaun

2007-01-01

Dichotomous keys that follow a single pathway of character state choices to an end point have been the primary tools for the identification of unknown organisms for more than two centuries. However, a revolution in computer diagnostics is now under way that may result in the replacement of traditional keys by matrix-based computer interactive keys that have many paths to a correct identification and make extensive use of hypertext to link to images, glossaries, and other support material. Progress is also being made on replacing keys entirely by optical matching of specimens to digital databases and DNA sequences. These new tools may go some way toward alleviating the taxonomic impediment to biodiversity studies and other ecological and evolutionary research, especially with better coordination between those who produce keys and those who use them and by integrating interactive keys into larger biological Web sites.

The scorpions of Yunnan (China): updated identification key, new record and redescriptions of Euscorpiops kubani and E. shidian (Arachnida, Scorpiones)

PubMed Central

Di, Zhiyong; He, Yawen; Wu, Yingliang; Cao, Zhijian; Liu, Hui; Jiang, Dahe; Li, Wenxin

2011-01-01

Abstract We present an identification key to the scorpion species of Yunnan (China) with notes on the distribution and ecology. Euscorpiops kubani is recorded for the first time for China. The redescriptions of Euscorpiops shidian and Euscorpiops kubani are provided. The number of known scorpion species from Yunnan is raised to nine. PMID:21594054

Abridged pupa identification key to the common container-breeding mosquitoes in urban Southeast Asia.

PubMed

Bangs, Michael J; Focks, Dana A

2006-09-01

Pupal surveys have been advocated as an alternative or surrogate surveillance method for estimating densities of adult Aedes aegypti and Aedes albopictus. Usually, this survey strategy has required that collected pupae eclose to adults before attempting species identification. Using the pupal survey method in Yogyakarta, Indonesia, this rearing step was obviated with the pupal morphological key described herein for identifying preserved or live pupae. Examination of pupae for the identification of various container-inhabiting mosquito genera and target aedine species proved to be accurate and far less time-consuming and problematic than rearing pupae to adults.

Review of the genus Genaemirum Heinrich (Hymenoptera, Ichneumonidae, Ichneumoninae) with interactive identification keys to species.

PubMed

Rousse, Pascal; Broad, Gavin R; van Noort, Simon

2016-01-01

We describe Genaemirum phagocossorum Rousse, Broad & van Noort, sp. n. , a new ichneumonine parasitoid wasp reared from Eucalyptus nitens logs infested by the cossid moth Coryphodema tristis , which is considered a major pest of forestry and food crops in South Africa. This is the first plausible host association for the genus, and fits with the host association predictions of Heinrich. Two further undescribed species were found in the collections of the Natural History Museum in London and are described as Genaemirum phacochoerus Broad, Rousse & van Noort, sp. n. and Genaemirum fumosum Broad, Rousse & van Noort, sp. n. An identification key to the eight known species and a diagnosis for each species are provided, including photographs of all the primary type specimens. Online Lucid interactive identification keys are available at: http://www.waspweb.org.

TriatoKey: a web and mobile tool for biodiversity identification of Brazilian triatomine species

PubMed Central

Márcia de Oliveira, Luciana; Nogueira de Brito, Raissa; Anderson Souza Guimarães, Paul; Vitor Mastrângelo Amaro dos Santos, Rômulo; Gonçalves Diotaiuti, Liléia; de Cássia Moreira de Souza, Rita

2017-01-01

Abstract Triatomines are blood-sucking insects that transmit the causative agent of Chagas disease, Trypanosoma cruzi. Despite being recognized as a difficult task, the correct taxonomic identification of triatomine species is crucial for vector control in Latin America, where the disease is endemic. In this context, we have developed a web and mobile tool based on PostgreSQL database to help healthcare technicians to overcome the difficulties to identify triatomine vectors when the technical expertise is missing. The web and mobile version makes use of real triatomine species pictures and dichotomous key method to support the identification of potential vectors that occur in Brazil. It provides a user example-driven interface with simple language. TriatoKey can also be useful for educational purposes. Database URL: http://triatokey.cpqrr.fiocruz.br PMID:28605769

Review of the genus Genaemirum Heinrich (Hymenoptera, Ichneumonidae, Ichneumoninae) with interactive identification keys to species

PubMed Central

Rousse, Pascal; Broad, Gavin R.; van Noort, Simon

2016-01-01

Abstract We describe Genaemirum phagocossorum Rousse, Broad & van Noort, sp. n., a new ichneumonine parasitoid wasp reared from Eucalyptus nitens logs infested by the cossid moth Coryphodema tristis, which is considered a major pest of forestry and food crops in South Africa. This is the first plausible host association for the genus, and fits with the host association predictions of Heinrich. Two further undescribed species were found in the collections of the Natural History Museum in London and are described as Genaemirum phacochoerus Broad, Rousse & van Noort, sp. n. and Genaemirum fumosum Broad, Rousse & van Noort, sp. n. An identification key to the eight known species and a diagnosis for each species are provided, including photographs of all the primary type specimens. Online Lucid interactive identification keys are available at: http://www.waspweb.org. PMID:27917066

Why and how might genetic and phylogenetic diversity be reflected in the identification of key biodiversity areas?

PubMed

Brooks, T M; Cuttelod, A; Faith, D P; Garcia-Moreno, J; Langhammer, P; Pérez-Espona, S

2015-02-19

'Key biodiversity areas' are defined as sites contributing significantly to the global persistence of biodiversity. The identification of these sites builds from existing approaches based on measures of species and ecosystem diversity and process. Here, we therefore build from the work of Sgró et al. (2011 Evol. Appl. 4, 326-337. (doi:10.1111/j.1752-4571.2010.00157.x)) to extend a framework for how components of genetic diversity might be considered in the identification of key biodiversity areas. We make three recommendations to inform the ongoing process of consolidating a key biodiversity areas standard: (i) thresholds for the threatened species criterion currently consider a site's share of a threatened species' population; expand these to include the proportion of the species' genetic diversity unique to a site; (ii) expand criterion for 'threatened species' to consider 'threatened taxa' and (iii) expand the centre of endemism criterion to identify as key biodiversity areas those sites holding a threshold proportion of the compositional or phylogenetic diversity of species (within a taxonomic group) whose restricted ranges collectively define a centre of endemism. We also recommend consideration of occurrence of EDGE species (i.e. threatened phylogenetic diversity) in key biodiversity areas to prioritize species-specific conservation actions among sites.

Why and how might genetic and phylogenetic diversity be reflected in the identification of key biodiversity areas?

PubMed Central

Brooks, T. M.; Cuttelod, A.; Faith, D. P.; Garcia-Moreno, J.; Langhammer, P.; Pérez-Espona, S.

2015-01-01

‘Key biodiversity areas' are defined as sites contributing significantly to the global persistence of biodiversity. The identification of these sites builds from existing approaches based on measures of species and ecosystem diversity and process. Here, we therefore build from the work of Sgró et al. (2011 Evol. Appl. 4, 326–337. (doi:10.1111/j.1752-4571.2010.00157.x)) to extend a framework for how components of genetic diversity might be considered in the identification of key biodiversity areas. We make three recommendations to inform the ongoing process of consolidating a key biodiversity areas standard: (i) thresholds for the threatened species criterion currently consider a site's share of a threatened species' population; expand these to include the proportion of the species' genetic diversity unique to a site; (ii) expand criterion for ‘threatened species' to consider ‘threatened taxa’ and (iii) expand the centre of endemism criterion to identify as key biodiversity areas those sites holding a threshold proportion of the compositional or phylogenetic diversity of species (within a taxonomic group) whose restricted ranges collectively define a centre of endemism. We also recommend consideration of occurrence of EDGE species (i.e. threatened phylogenetic diversity) in key biodiversity areas to prioritize species-specific conservation actions among sites. PMID:25561678

Identification of the key ecological factors influencing vegetation degradation in semi-arid agro-pastoral ecotone considering spatial scales

NASA Astrophysics Data System (ADS)

Peng, Yu; Wang, Qinghui; Fan, Min

2017-11-01

When assessing re-vegetation project performance and optimizing land management, identification of the key ecological factors inducing vegetation degradation has crucial implications. Rainfall, temperature, elevation, slope, aspect, land use type, and human disturbance are ecological factors affecting the status of vegetation index. However, at different spatial scales, the key factors may vary. Using Helin County, Inner-Mongolia, China as the study site and combining remote sensing image interpretation, field surveying, and mathematical methods, this study assesses key ecological factors affecting vegetation degradation under different spatial scales in a semi-arid agro-pastoral ecotone. It indicates that the key factors are different at various spatial scales. Elevation, rainfall, and temperature are identified as crucial for all spatial extents. Elevation, rainfall and human disturbance are key factors for small-scale quadrats of 300 m × 300 m and 600 m × 600 m, temperature and land use type are key factors for a medium-scale quadrat of 1 km × 1 km, and rainfall, temperature, and land use are key factors for large-scale quadrats of 2 km × 2 km and 5 km × 5 km. For this region, human disturbance is not the key factor for vegetation degradation across spatial scales. It is necessary to consider spatial scale for the identification of key factors determining vegetation characteristics. The eco-restoration programs at various spatial scales should identify key influencing factors according their scales so as to take effective measurements. The new understanding obtained in this study may help to explore the forces which driving vegetation degradation in the degraded regions in the world.

How Is This Flower Pollinated? A Polyclave Key to Use in Teaching.

ERIC Educational Resources Information Center

Tyrrell, Lucy

1989-01-01

Presents an identification method which uses the process of elimination to identify pollination systems. Provides the polyclave key, methodology for using the key, a sample worksheet, and abbreviation codes for pollination systems. (MVL)

Linking Complex Problem Solving to Opportunity Identification Competence within the Context of Entrepreneurship

ERIC Educational Resources Information Center

Baggen, Yvette; Mainert, Jakob; Lans, Thomas; Biemans, Harm J. A.; Greiff, Samuel; Mulder, Martin

2015-01-01

Today's working life is increasingly characterized by entrepreneurial challenges. Entrepreneurial challenges start at an individual level with the identification of entrepreneurial opportunities, which is acknowledged as one of the key competencies for lifelong learning. Since the identification of entrepreneurial opportunities relies heavily on…

Chapter 08: Comments on, and additional information for, wood identification

Treesearch

Alex C. Wiedenhoeft

2011-01-01

This manual has described the theory of identification (Chapter 1), the botanical basis of wood structure (Chapter 2), the use of a hand lens (Chapter 3), how to use cutting tools to prepare wood for observation with a lens (Chapter 4), and the characters used in hand lens wood identification (Chapter 5) before leading you through an identification key (Chapter 6) and...

Influence of biological, environmental and technical factors on phenolic content and antioxidant activities of Tunisian halophytes.

PubMed

Ksouri, Riadh; Megdiche, Wided; Falleh, Hanen; Trabelsi, Nejla; Boulaaba, Mondher; Smaoui, Abderrazak; Abdelly, Chedly

2008-11-01

Halophyte ability to withstand salt-triggered oxidative stress is governed by multiple biochemical mechanisms that facilitate retention and/or acquisition of water, protect chloroplast functioning, and maintain ion homeostasis. Most essential traits include the synthesis of osmolytes, specific proteins, and antioxidant molecules. This might explain the utilization of some halophytes as traditional medicinal and dietary plants. The present study aimed at assessing the phenolic content and antioxidant activities of some Tunisian halophytes (Cakile maritima, Limoniastrum monopetalum, Mesembryanthemum crystallinum, M. edule, Salsola kali, and Tamarix gallica), depending on biological (species, organ and developmental stage), environmental, and technical (extraction solvent) factors. The total polyphenol contents and antioxidant activities (DPPH and superoxide radicals scavenging activities, and iron chelating and reducing powers) were strongly affected by the above-cited factors. Such variability might be of great importance in terms of valorising these halophytes as a source of naturally secondary metabolites, and the methods for phenolic and antioxidant production.

Molecular evidence for the occurrence of tomato leaf curl New Delhi virus on chayote (Sechium edule) in southern India.

PubMed

Nagendran, K; Mohankumar, S; Mohammed Faisal, P; Bagewadi, B; Karthikeyan, G

2017-12-01

During 2012-2014, mosaic disease on chayote in the farmers field of Kodaikanal region (high altitude zone) of Tamil Nadu was observed. The disease was characterized with severe mosaic, cupping and enation on leaves with reduced fruit size. Disease was found to causes an yield loss of more than 60% with the maximum disease incidence of 100% for the past 5 years consecutively. Preliminary serological and molecular screening indicated the association of begomovirus with the disease. Complete nucleotide sequence and phylogenetic analysis of DNA A revealed the identity of the virus as tomato leaf curl New Delhi virus (ToLCNDV). In recombination analysis study, the major parent was identified as ToLCNDV from Pakistan infecting tomato. Thus the present finding confirms expansion of new geographical region and host for ToLCNDV causing mosaic disease on chayote from Tamil Nadu. To our knowledge this is the first confirmed report for the occurrence of ToLCNDV on chayote in southern India.

Phylogenetic and microscopic studies in the genus Lactifluus (Basidiomycota, Russulales) in West Africa, including the description of four new species.

PubMed

Maba, Dao Lamèga; Guelly, Atsu K; Yorou, Nourou S; Verbeken, Annemieke; Agerer, Reinhard

2015-06-01

Despite the crucial ecological role of lactarioid taxa (Lactifluus, Lactarius) as common ectomycorrhiza formers in tropical African seasonal forests, their current diversity is not yet adequately assessed. During the last few years, numerous lactarioid specimens have been sampled in various ecosystems from Togo (West Africa). We generated 48 ITS sequences and aligned them against lactarioid taxa from other tropical African ecozones (Guineo-Congolean evergreen forests, Zambezian miombo). A Maximum Likelihood phylogenetic tree was inferred from a dataset of 109 sequences. The phylogenetic placement of the specimens, combined with morpho-anatomical data, supported the description of four new species from Togo within the monophyletic genus Lactifluus: within subgen. Lactifluus (L. flavellus), subgen. Russulopsis (L. longibasidius and L. pectinatus), and subgen. Edules (L. melleus). This demonstrates that the current species richness of the genus is considerably higher than hitherto estimated for African species and, in addition, a need to redefine the subgenera and sections within it.

Turfgrass diagnostics and new, advanced technologies

USDA-ARS?s Scientific Manuscript database

Strategies for sustainable, integrated disease management start with reliable pathogen identification. Conventional identification methods such as disease symptomology, host association, morphology and biochemical tests are still key diagnostic indicators for many phytopathogens; however, nucleic ac...

Early Identification of Infants and Toddlers with Deafblindness

ERIC Educational Resources Information Center

Anthony, Tanni L.

2016-01-01

Data from the 2014 National Center on Deaf-Blindness Count show that fewer than 100 infants and toddlers are currently identified with deafblindness across the United States and that identification rates for this population vary greatly from state to state. The author presents a key rationale for timely and accurate identification of early-onset…

A free-access online key to identify Amazonian ferns.

PubMed

Zuquim, Gabriela; Tuomisto, Hanna; Prado, Jefferson

2017-01-01

There is urgent need for more data on species distributions in order to improve conservation planning. A crucial but challenging aspect of producing high-quality data is the correct identification of organisms. Traditional printed floras and dichotomous keys are difficult to use for someone not familiar with the technical jargon. In poorly known areas, such as Amazonia, they also become quickly outdated as new species are described or ranges extended. Recently, online tools have allowed developing dynamic, interactive, and accessible keys that make species identification possible for a broader public. In order to facilitate identifying plants collected in field inventories, we developed an internet-based free-access tool to identify Amazonian fern species. We focused on ferns, because they are easy to collect and their edaphic affinities are relatively well known, so they can be used as an indicator group for habitat mapping. Our key includes 302 terrestrial and aquatic entities mainly from lowland Amazonian forests. It is a free-access key, so the user can freely choose which morphological features to use and in which order to assess them. All taxa are richly illustrated, so specimens can be identified by a combination of character choices, visual comparison, and written descriptions. The identification tool was developed in Lucid 3.5 software and it is available at http://keyserver.lucidcentral.org:8080/sandbox/keys.jsp.

A free-access online key to identify Amazonian ferns

PubMed Central

Zuquim, Gabriela; Tuomisto, Hanna; Prado, Jefferson

2017-01-01

Abstract There is urgent need for more data on species distributions in order to improve conservation planning. A crucial but challenging aspect of producing high-quality data is the correct identification of organisms. Traditional printed floras and dichotomous keys are difficult to use for someone not familiar with the technical jargon. In poorly known areas, such as Amazonia, they also become quickly outdated as new species are described or ranges extended. Recently, online tools have allowed developing dynamic, interactive, and accessible keys that make species identification possible for a broader public. In order to facilitate identifying plants collected in field inventories, we developed an internet-based free-access tool to identify Amazonian fern species. We focused on ferns, because they are easy to collect and their edaphic affinities are relatively well known, so they can be used as an indicator group for habitat mapping. Our key includes 302 terrestrial and aquatic entities mainly from lowland Amazonian forests. It is a free-access key, so the user can freely choose which morphological features to use and in which order to assess them. All taxa are richly illustrated, so specimens can be identified by a combination of character choices, visual comparison, and written descriptions. The identification tool was developed in Lucid 3.5 software and it is available at http://keyserver.lucidcentral.org:8080/sandbox/keys.jsp. PMID:28781548

Field keys to predators of the balsam woolly aphid in North Carolina

Treesearch

Gene D. Amman

1970-01-01

These keys will be useful for field identification of immature insect, adult mite, and slug predators of the balsam woolly aphid. The keys include, in addition to native predators, the larvae of three species introduced to North Carolina.

Forensic dentistry in human identification: A review of the literature.

PubMed

Ata-Ali, Javier; Ata-Ali, Fadi

2014-04-01

An update is provided of the literature on the role of odontology in human identification, based on a PubMed-Medline search of the last 5 years and using the terms: "forensic dentistry" (n = 464 articles), "forensic odontology" (n = 141 articles) and "forensic dentistry identification" (n = 169 articles). Apart from these initial 774 articles, others considered to be important and which were generated by a manual search and cited as references in review articles were also included. Forensic dentistry requires interdisciplinary knowledge, since the data obtained from the oral cavity can contribute to identify an individual or provide information needed in a legal process. Furthermore, the data obtained from the oral cavity can narrow the search range of an individual and play a key role in the victim identification process following mass disasters or catastrophes. This literature search covering the last 5 years describes the novelties referred to buccodental studies in comparative identification, buccodental evaluation in reconstructive identification, human bites as a method for identifying the aggressor, and the role of DNA in dental identification. The oral cavity is a rich and noninvasive source of DNA, and can be used to solve problems of a social, economic or legal nature. Key words:Forensic identification, DNA, forensic dentistry, rugoscopy, cheiloscopy, saliva.

Temporal dynamics and the identification of musical key.

PubMed

Farbood, Morwaread Mary; Marcus, Gary; Poeppel, David

2013-08-01

A central process in music cognition involves the identification of key; however, little is known about how listeners accomplish this task in real time. This study derives from work that suggests overlap between the neural and cognitive resources underlying the analyses of both music and speech and is the first, to our knowledge, to explore the timescales at which the brain infers musical key. We investigated the temporal psychophysics of key-finding over a wide range of tempi using melodic sequences with strong structural cues, where statistical information about overall key profile was ambiguous. Listeners were able to provide robust judgments within specific limits, at rates as high as 400 beats per minute (bpm; ∼7 Hz) and as low as 30 bpm (0.5 Hz), but not outside those bounds. These boundaries on reliable performance show that the process of key-finding is restricted to timescales that are closely aligned with beat induction and speech processing. 2013 APA, all rights reserved

Making the Case for Early Identification and Intervention for Young Children at Risk for Learning Disabilities

ERIC Educational Resources Information Center

Steele, Marcee M.

2004-01-01

The early identification of children with learning disabilities (LD) is difficult but can be accomplished. Observation of key behaviors which are indicators of LD by preschool and kindergarten teachers can assist in this process. This early identification facilitates the use of intervention strategies to provide a positive early experience for…

The genus Alterosa Blahnik, 2005 (Trichoptera, Philopotamidae, Philopotaminae) in northeastern Brazil, including the description of three new species and an identification key for the genus

PubMed Central

Dumas, Leandro Lourenço; Calor, Adolfo Ricardo; Nessimian, Jorge Luiz

2013-01-01

Abstract Alterosa Blahnik, 2005 contains 35 described species distributed in southern and southeastern Brazil. Three new species of Alterosa from northeastern Brazil are described and illustrated, Alterosa amadoi sp. n., Alterosa castroalvesi sp. n. and Alterosa caymmii sp. n., the first records of the genus from northeastern Brazil. An identification key for all known species of the genus is also presented. PMID:23950667

Image use in field guides and identification keys: review and recommendations.

PubMed

Leggett, Roxanne; Kirchoff, Bruce K

2011-01-01

Although illustrations have played an important role in identification keys and guides since the 18th century, their use has varied widely. Some keys lack all illustrations, while others are heavily illustrated. Even within illustrated guides, the way in which images are used varies considerably. Here, we review image use in paper and electronic guides, and establish a set of best practices for image use in illustrated keys and guides. Our review covers image use in both paper and electronic guides, though we only briefly cover apps for mobile devices. With this one exception, we cover the full range of guides, from those that consist only of species descriptions with no keys, to lavishly illustrated technical keys. Emphasis is placed on how images are used, not on the operation of the guides and key, which has been reviewed by others. We only deal with operation when it impacts image use. Few illustrated keys or guides use images in optimal ways. Most include too few images to show taxonomic variation or variation in characters and character states. The use of multiple images allows easier taxon identification and facilitates the understanding of characters. Most images are usually not standardized, making comparison between images difficult. Although some electronic guides allow images to be enlarged, many do not. The best keys and guides use standardized images, displayed at sizes that are easy to see and arranged in a standardized manner so that similar images can be compared across species. Illustrated keys and glossaries should contain multiple images for each character state so that the user can judge variation in the state. Photographic backgrounds should not distract from the subject and, where possible, should be of a standard colour. When used, drawings should be prepared by professional botanical illustrators, and clearly labelled. Electronic keys and guides should allow images to be enlarged so that their details can be seen.

Image use in field guides and identification keys: review and recommendations

PubMed Central

Leggett, Roxanne; Kirchoff, Bruce K.

2011-01-01

Background and aims Although illustrations have played an important role in identification keys and guides since the 18th century, their use has varied widely. Some keys lack all illustrations, while others are heavily illustrated. Even within illustrated guides, the way in which images are used varies considerably. Here, we review image use in paper and electronic guides, and establish a set of best practices for image use in illustrated keys and guides. Scope Our review covers image use in both paper and electronic guides, though we only briefly cover apps for mobile devices. With this one exception, we cover the full range of guides, from those that consist only of species descriptions with no keys, to lavishly illustrated technical keys. Emphasis is placed on how images are used, not on the operation of the guides and key, which has been reviewed by others. We only deal with operation when it impacts image use. Main points Few illustrated keys or guides use images in optimal ways. Most include too few images to show taxonomic variation or variation in characters and character states. The use of multiple images allows easier taxon identification and facilitates the understanding of characters. Most images are usually not standardized, making comparison between images difficult. Although some electronic guides allow images to be enlarged, many do not. Conclusions The best keys and guides use standardized images, displayed at sizes that are easy to see and arranged in a standardized manner so that similar images can be compared across species. Illustrated keys and glossaries should contain multiple images for each character state so that the user can judge variation in the state. Photographic backgrounds should not distract from the subject and, where possible, should be of a standard colour. When used, drawings should be prepared by professional botanical illustrators, and clearly labelled. Electronic keys and guides should allow images to be enlarged so that their details can be seen. PMID:22476475

Forensic dentistry in human identification: A review of the literature

PubMed Central

Ata-Ali, Fadi

2014-01-01

An update is provided of the literature on the role of odontology in human identification, based on a PubMed-Medline search of the last 5 years and using the terms: “forensic dentistry” (n = 464 articles), “forensic odontology” (n = 141 articles) and “forensic dentistry identification” (n = 169 articles). Apart from these initial 774 articles, others considered to be important and which were generated by a manual search and cited as references in review articles were also included. Forensic dentistry requires interdisciplinary knowledge, since the data obtained from the oral cavity can contribute to identify an individual or provide information needed in a legal process. Furthermore, the data obtained from the oral cavity can narrow the search range of an individual and play a key role in the victim identification process following mass disasters or catastrophes. This literature search covering the last 5 years describes the novelties referred to buccodental studies in comparative identification, buccodental evaluation in reconstructive identification, human bites as a method for identifying the aggressor, and the role of DNA in dental identification. The oral cavity is a rich and noninvasive source of DNA, and can be used to solve problems of a social, economic or legal nature. Key words:Forensic identification, DNA, forensic dentistry, rugoscopy, cheiloscopy, saliva. PMID:24790717

Description of the larva of Popanomyia kerteszi James & Woodley (Diptera: Stratiomyidae) and identification key to immature stages of Pachygastrinae.

PubMed

Marques, Karina I de S; Xerez, Roberto de

2009-01-01

The larva of Popanomyia kerteszi James & Woodley is described based on individuals collected under tree barks in initial stages of decomposition in Marambaia island (23 degrees 4'15''S, 43 degrees 53'59''W, at sea level), Rio de Janeiro state, Brazil. The immatures of P. kerteszi were compared with other species of the subfamily Pachygastrinae and an identification key to the described immature stages of this subfamily is presented. This is also the first record of P. kerteszi to Rio de Janeiro.

JellyWeb: an interactive information system on Scyphozoa, Cubozoa and Staurozoa

PubMed Central

Martellos, Stefano; Ukosich, Luca; Avian, Massimo

2016-01-01

Abstract Identification of organisms is traditionally based on the use of “classic” identification keys, normally printed on paper. These keys have several drawbacks: they are mainly based on the systematics, requiring identification of orders, families and genera at first; they are written by experts for other experts, in a specific scientific jargon; they have a “frozen” structure (sequence of theses/antitheses); once published, they cannot be changed or updated without printing a new edition. Due to the use of computers, it is now possible to build new digital identification tools, which: 1) can be produced automatically, if the characters are stored in a database; 2) can be freed from the traditional systematics, giving priority to easy-to-observe characters, incl. those usually uncommon to the classical keys, such as ecology and distribution; 3) can be updated in real time once published on-line; 4) can be available on different media, and on mobile devices. An important feature of these new digital tools is their “collaborative” nature. They can be enriched by the contribution of several researchers, which can cooperate while maintaining rights and property of the resources and data they contribute to the system. JellyWeb, the information system on Scyphozoa, Cubozoa and Staurozoa has been developed in Trieste since 2010. The system was created with the aim of – potentially – becoming a starting point for a wide collaborative effort in developing a user-friendly worldwide digital identification system for jellyfishes. PMID:26877677

New Methodology for Known Metabolite Identification in Metabonomics/Metabolomics: Topological Metabolite Identification Carbon Efficiency (tMICE).

PubMed

Sanchon-Lopez, Beatriz; Everett, Jeremy R

2016-09-02

A new, simple-to-implement and quantitative approach to assessing the confidence in NMR-based identification of known metabolites is introduced. The approach is based on a topological analysis of metabolite identification information available from NMR spectroscopy studies and is a development of the metabolite identification carbon efficiency (MICE) method. New topological metabolite identification indices are introduced, analyzed, and proposed for general use, including topological metabolite identification carbon efficiency (tMICE). Because known metabolite identification is one of the key bottlenecks in either NMR-spectroscopy- or mass spectrometry-based metabonomics/metabolomics studies, and given the fact that there is no current consensus on how to assess metabolite identification confidence, it is hoped that these new approaches and the topological indices will find utility.

"Key to Freshwater Algae": A Web-Based Tool to Enhance Understanding of Microscopic Biodiversity

ERIC Educational Resources Information Center

Shayler, Hannah A.; Siver, Peter A.

2006-01-01

The Freshwater Ecology Laboratory at Connecticut College has developed an interactive, Web-based identification key to freshwater algal genera using the Lucid Professional and Lucid 3 software developed by the Centre for Biological Information Technology at the University of Queensland, Brisbane, Australia. The "Key to Freshwater Algae"…

Another Strategy for Teaching Histology to A&P Students: Classification versus Memorization.

ERIC Educational Resources Information Center

Bavis, Ryan W.; Seveyka, Jerred; Shigeoka, Cassie A.

2000-01-01

Defines dichotomous keys as common learning tools based on identification rather than memorization. Provides an example of a dichotomous key developed for introducing histology in human anatomy and physiology (A&P) courses and explains how students can use the dichotomous key. Discusses the goals of the exercises and the process of…

Revision of Palearctic Trissolcus (Ashmead) (Hymenoptera: Scelionidae)

USDA-ARS?s Scientific Manuscript database

Biological agents to control the brown marmorated stink bug, Halyomorpha halys (Stål) (BMSB), in Western Europe, requires reliable taxonomic resources for identification of Trissolcus wasps. To aid this research endeavor, we present a species identification key to females of Palearctic Trissolcus. M...

A Key to the Pupal Exuviae of the Midges (Diptera: Chironomidae) of Everglades National Park, Florida

USGS Publications Warehouse

Jacobsen, Richard E.

2008-01-01

A key has been developed for identifying the pupal exuviae of 132 taxa of chironomid midges collected in Everglades National Park, as well as 18 additional species from freshwater habitats adjacent to the Park. Descriptions and illustrations are based upon voucher specimens from extensive collections of chironomid pupal exuviae for faunal surveys and biomonitoring research conducted in ENP and surrounding freshwater areas from 1998 to 2007. The key includes taxonomic comments for confirming identifications, as well as brief summaries of the distribution and ecology of each species in southern Florida waters. Information is also provided on the morphology of chironomid pupal exuviae, recommended references for identifying pupal exuviae, techniques for making slides, and methods to confirm proper identification.

Studies of Phlebotomine Sand Flies.

DTIC Science & Technology

A laboratory colony of the sand fly, Lutzomyia anthophora, was established in Gainesville, Florida. Identification keys to the American species of...Sycorax, Warileya and Brumptomyia are given. Also keys to several groups of the large genus Lutzomyia are provided.

Comparing hair-morphology and molecular methods to identify fecal samples from Neotropical felids

PubMed Central

Alberts, Carlos C.; Saranholi, Bruno H.; Frei, Fernando; Galetti, Pedro M.

2017-01-01

To avoid certain problems encountered with more-traditional and invasive methods in behavioral-ecology studies of mammalian predators, such as felids, molecular approaches have been employed to identify feces found in the field. However, this method requires a complete molecular biology laboratory, and usually also requires very fresh fecal samples to avoid DNA degradation. Both conditions are normally absent in the field. To address these difficulties, identification based on morphological characters (length, color, banding, scales and medullar patterns) of hairs found in feces could be employed as an alternative. In this study we constructed a morphological identification key for guard hairs of eight Neotropical felids (jaguar, oncilla, Geoffroy’s cat, margay, ocelot, Pampas cat, puma and jaguarundi) and compared its efficiency to that of a molecular identification method, using the ATP6 region as a marker. For this molecular approach, we simulated some field conditions by postponing sample-conservation procedures. A blind test of the identification key obtained a nearly 70% overall success rate, which we considered equivalent to or better than the results of some molecular methods (probably due to DNA degradation) found in other studies. The jaguar, puma and jaguarundi could be unequivocally discriminated from any other Neotropical felid. On a scale ranging from inadequate to excellent, the key proved poor only for the margay, with only 30% of its hairs successfully identified using this key; and have intermediate success rates for the remaining species, the oncilla, Geoffroy’s cat, ocelot and Pampas cat, were intermediate. Complementary information about the known distributions of felid populations may be necessary to substantially improve the results obtained with the key. Our own molecular results were even better, since all blind-tested samples were correctly identified. Part of these identifications were made from samples kept in suboptimal conditions, with some samples remaining outdoors for up to seven days, simulating conditions in the field. It appears that both methods can be used, depending on the available laboratory facilities and on the expected results. PMID:28880947

Two genera of Aulacoscelinae beetles reflexively bleed azoxyglycosides found in their host cycads.

PubMed

Prado, Alberto; Ledezma, Julieta; Cubilla-Rios, Luis; Bede, Jacqueline C; Windsor, Donald M

2011-07-01

Aulacoscelinae beetles have an ancient relationship with cycads (Cycadophyta: Zamiaceae), which contain highly toxic azoxyglycoside (AZG) compounds. How these "primitive" leaf beetles deal with such host-derived compounds remains largely unknown. Collections were made of adult Aulacoscelis appendiculata from Zamia cf. elegantissima in Panama, A. vogti from Dioon edule in Mexico, and Janbechynea paradoxa from Zamia boliviana in Bolivia. Total AZG levels were quantified in both cycad leaves and adult beetles by high performance liquid chromatography (HPLC). On average, cycad leaves contained between 0.5-0.8% AZG (frozen weight, FW), while adult beetles feeding on the same leaves contained even higher levels of the compounds (average 0.9-1.5% FW). High AZG levels were isolated from reflex bleeding secreted at the leg joints when beetles were disturbed. Nuclear magnetic resonance and mass spectroscopy identified two AZGs, cycasin and macrozamin, in the reflex bleeding; this is the first account of potentially plant-derived compounds in secretions of the Aulacoscelinae. These data as well as the basal phylogenetic position of the Aulacoscelinae suggest that sequestration of plant secondary metabolites appeared early in leaf beetle evolution.

Mesocosm validation of the marine No Effect Concentration of dissolved copper derived from a species sensitivity distribution.

PubMed

Foekema, E M; Kaag, N H B M; Kramer, K J M; Long, K

2015-07-15

The Predicted No Effect Concentration (PNEC) for dissolved copper based on the species sensitivity distribution (SSD) of 24 marine single species tests was validated in marine mesocosms. To achieve this, the impact of actively maintained concentrations of dissolved copper on a marine benthic and planktonic community was studied in 18 outdoor 4.6m(3) mesocosms. Five treatment levels, ranging from 2.9 to 31μg dissolved Cu/L, were created in triplicate and maintained for 82days. Clear effects were observed on gastropod and bivalve molluscs, phytoplankton, zooplankton, sponges and sessile algae. The most sensitive biological endpoints; reproduction success of the bivalve Cerastoderma edule, copepod population development and periphyton growth were significantly affected at concentrations of 9.9μg Cu/L and higher. The No Observed Effect Concentration (NOEC) derived from this study was 5.7μg dissolved Cu/L. Taking into account the DOC concentration of the mesocosm water this NOEC is comparable to the PNEC derived from the SSD. Copyright © 2015. Published by Elsevier B.V.

Perceptual Audio Hashing Functions

NASA Astrophysics Data System (ADS)

Özer, Hamza; Sankur, Bülent; Memon, Nasir; Anarım, Emin

2005-12-01

Perceptual hash functions provide a tool for fast and reliable identification of content. We present new audio hash functions based on summarization of the time-frequency spectral characteristics of an audio document. The proposed hash functions are based on the periodicity series of the fundamental frequency and on singular-value description of the cepstral frequencies. They are found, on one hand, to perform very satisfactorily in identification and verification tests, and on the other hand, to be very resilient to a large variety of attacks. Moreover, we address the issue of security of hashes and propose a keying technique, and thereby a key-dependent hash function.

Muscidae (Diptera) of forensic importance-an identification key to third instar larvae of the western Palaearctic region and a catalogue of the muscid carrion community.

PubMed

Grzywacz, Andrzej; Hall, Martin J R; Pape, Thomas; Szpila, Krzysztof

2017-05-01

The Muscidae is one of the main dipteran families recognized as important for medico-legal purposes. Although an association of adult flies with decomposing human and animal bodies is documented for about 200 taxa worldwide, cadavers and carrion represents a breeding habitat for considerably fewer species. Species that do colonize dead human bodies can do so under diverse environmental conditions and, under certain circumstances, Muscidae may be the only colonizers of a body. Because of difficulties in identification, many studies have identified immature and/or adult muscids only to the genus or family level. This lack of detailed species-level identifications hinders detailed investigation of their medico-legal usefulness in carrion succession-oriented experiments. Identification to species level of third instars of Muscidae of forensic importance and the utility of larval morphological characters for taxonomic purposes were subjected to an in-depth revision. A combination of characters allowing for the discrimination of third instar muscids from other forensically important dipterans is proposed. An identification key for third instar larvae, which covers the full set of cadaver-colonising species of Muscidae from the western Palaearctic (Europe, North Africa, Middle East), is provided. This key will facilitate more detailed and species-specific knowledge of the occurrence of Muscidae in forensic entomology experiments and real cases. The carrion-visiting Muscidae worldwide are catalogued, and those species breeding in animal carrion and dead human bodies are briefly discussed with regard to their forensic importance.

Validating DNA barcodes: A non-destructive extraction protocol enables simultaneous vouchering of DNA and morphological vouchers

USDA-ARS?s Scientific Manuscript database

Morphology-based keys support accurate identification of many taxa. However, identification can be difficult for taxa that are not well studied, very small, members of cryptic species complexes, or represented by immature stages. For such cases, DNA barcodes may provide diagnostic characters. Ecolog...

Sagebrush identification, ecology, and palatability relative to sage-grouse

Treesearch

Roger Rosentreter

2005-01-01

Basic identification keys and comparison tables for 23 low and big sagebrush (Artemisia) taxa are presented. Differences in sagebrush ecology, soil temperature regimes, geographic range, palatability, mineralogy, and chemistry are discussed. Coumarin, a chemical produced in the glands of some Artemisia species, causes UV-light fluorescence of the...

Mnemonics Are an Effective Tool for Adult Beginners Learning Plant Identification

ERIC Educational Resources Information Center

Stagg, Bethan C.; Donkin, Maria E.

2016-01-01

Most beginners are introduced to plant diversity through identification keys, which develop differentiation skills but not species memorisation. We propose that mnemonics, memorable "name clues" linking a species name with morphological characters, are a complementary learning tool for promoting species memorisation. In the first of two…

Detection, identification, and quantification techniques for spills of hazardous chemicals

NASA Technical Reports Server (NTRS)

Washburn, J. F.; Sandness, G. A.

1977-01-01

The first 400 chemicals listed in the Coast Guard's Chemical Hazards Response Information System were evaluated with respect to their detectability, identifiability, and quantifiability by 12 generalized remote and in situ sensing techniques. Identification was also attempted for some key areas in water pollution sensing technology.

Description and identification of four species of plant parasitic nematodes associated with grassland, fruit trees and maize in Romania.

PubMed

Badi, M; Geraert, E

2002-01-01

Three species of plant parasitic nematodes present in two romanian soil samples were described and identified in the present study. The species belong to order tylenchida and to taxonomical families Tylenchidae (Basiria aberrans) and Belonolaimidae (Tylenchorhynchus georgiensis and Merlinius brevidens). The identification of the present specimens was based on the classical taxonomy, following morphological and morphometrical characters in the species specific identification keys.

A key to the Mexican and Central America Genera of Anthonomini (Curculionidae, Curculioninae)

PubMed Central

Hernández, Macotulio Soto; Jones, Robert W.; Castillo, Pedro Reyes

2013-01-01

Abstract Presently the only keys available for identification of genera of Anthonomini are limited to those of the United States of America and Canada. A dichotomous key is presented to identify all genera of Mexican and Central American Anthonomini. Previous keys do not include the genera Achia, Botanebius, Loncophorus, Loncophorellus and Melexerus. A brief synopsis is given for each genus and photographs of representative species are included. PMID:23717181

A New Paradigm for Known Metabolite Identification in Metabonomics/Metabolomics: Metabolite Identification Efficiency

PubMed Central

Everett, Jeremy R.

2015-01-01

A new paradigm is proposed for assessing confidence in the identification of known metabolites in metabonomics studies using NMR spectroscopy approaches. This new paradigm is based upon the analysis of the amount of metabolite identification information retrieved from NMR spectra relative to the molecular size of the metabolite. Several new indices are proposed including: metabolite identification efficiency (MIE) and metabolite identification carbon efficiency (MICE), both of which can be easily calculated. These indices, together with some guidelines, can be used to provide a better indication of known metabolite identification confidence in metabonomics studies than existing methods. Since known metabolite identification in untargeted metabonomics studies is one of the key bottlenecks facing the science currently, it is hoped that these concepts based on molecular spectroscopic informatics, will find utility in the field. PMID:25750701

A new paradigm for known metabolite identification in metabonomics/metabolomics: metabolite identification efficiency.

PubMed

Everett, Jeremy R

2015-01-01

A new paradigm is proposed for assessing confidence in the identification of known metabolites in metabonomics studies using NMR spectroscopy approaches. This new paradigm is based upon the analysis of the amount of metabolite identification information retrieved from NMR spectra relative to the molecular size of the metabolite. Several new indices are proposed including: metabolite identification efficiency (MIE) and metabolite identification carbon efficiency (MICE), both of which can be easily calculated. These indices, together with some guidelines, can be used to provide a better indication of known metabolite identification confidence in metabonomics studies than existing methods. Since known metabolite identification in untargeted metabonomics studies is one of the key bottlenecks facing the science currently, it is hoped that these concepts based on molecular spectroscopic informatics, will find utility in the field.

Performance Analysis of MYSEA

DTIC Science & Technology

2012-09-01

Services FSD Federated Services Daemon I&A Identification and Authentication IKE Internet Key Exchange KPI Key Performance Indicator LAN Local Area...spection takes place in different processes in the server architecture. Key Performance Indica- tor ( KPI )s associated with the system need to be...application and risk analysis of security controls. Thus, measurement of the KPIs is needed before an informed tradeoff between the performance penalties

Illustrated Key to Skins and Skulls of Bats in the Southeastern and Mid-Atlantic States

Treesearch

Michael A. Menzel; Jennifer M. Menzel; Steven B. Castleberry; James Ozier; W. Mark Ford; John W. Edwards

2002-01-01

In teaching students and technicians how to identify the skins and skulls of southeastern bats in the field and laboratory, it was necessary to develop an illustrated key that makes identification both easy and reliable. Many of the existing keys are poorly illustrated, include bat species that are not applicable, and/or contain univariate discriminatory measurements...

Evaluating a Bilingual Text-Mining System with a Taxonomy of Key Words and Hierarchical Visualization for Understanding Learner-Generated Text

ERIC Educational Resources Information Center

Kong, Siu Cheung; Li, Ping; Song, Yanjie

2018-01-01

This study evaluated a bilingual text-mining system, which incorporated a bilingual taxonomy of key words and provided hierarchical visualization, for understanding learner-generated text in the learning management systems through automatic identification and counting of matching key words. A class of 27 in-service teachers studied a course…

Identification of the terebrantian thrips (Insecta, Thysanoptera) associated with cultivated plants in Java, Indonesia

PubMed Central

Sartiami, Dewi; Mound, Laurence A.

2013-01-01

Abstract An illustrated identification key is provided to 49 species of Thysanoptera, Terebrantia that have been found in association with cultivated plants in Java. This is the first published identification system to this group of insects from Indonesia, and includes 15 species not previously recorded from Indonesia, and a further three species not previously recorded from Java. A table is provided indicating the plants from which thrips were taken. PMID:23794915

Talent development: linking the stakeholders to the process.

PubMed

Pankhurst, Anne; Collins, Dave; Macnamara, Áine

2013-01-01

The three stakeholders (coaches, parents and the National Governing Body) in Talent Identification and Development (TID) are important factors in athlete development. How each of them perceive the key constructs of Talent Identification and Development (i.e. sport specialisation and selection, practice, athlete development, junior and adult success, and the role of the stakeholders), and the coherence of that understanding is not well understood. This study focuses on junior performance tennis and investigates the perceptions of coaches, parents and sports organisations (a National Governing Body) of the five key constructs of Talent Identification and Development. We were interested in examining (a) the extent to which stakeholder perceptions relate to research, (b) the coherence of each stakeholder's perceptions and (c) the extent to which there is coherence between what stakeholders understand each other thinks. Seventy-five coaches, parents, and National Governing Body staff completed a questionnaire that asked participants to rate their degree of agreement/disagreement with researched 'principles' of Talent Identification and Development. The results suggest that stakeholders do not strongly agree with the research supporting principles of Talent Identification and Development. Furthermore, a significant lack of coherence of stakeholder perceptions was evident. This lack of coherence was also evident in each group's understanding of what the other stakeholders believed. The impact of these results on the Talent Identification and Development process is discussed.

Species identification of adult African blowflies (Diptera: Calliphoridae) of forensic importance.

PubMed

Lutz, Lena; Williams, Kirstin A; Villet, Martin H; Ekanem, Mfon; Szpila, Krzysztof

2018-05-01

Necrophagous blowflies can provide an excellent source of evidence for forensic entomologists and are also relevant to problems in public health, medicine, and animal health. However, access to useful information about these blowflies is constrained by the need to correctly identify the flies, and the poor availability of reliable, accessible identification tools is a serious obstacle to the development of forensic entomology in the majority of African countries. In response to this need, a high-quality key to the adults of all species of forensically relevant blowflies of Africa has been prepared, drawing on high-quality entomological materials and modern focus-stacking photomicroscopy. This new key can be easily applied by investigators inexperienced in the taxonomy of blowflies and is made available through a highly accessible online platform. Problematic diagnostic characters used in previous keys are discussed.

Identification of Students with Dyslexia in California Public Schools

ERIC Educational Resources Information Center

Futterman, Kathy R.

2017-01-01

One of the key problems facing public education today is the need for early and accurate identification of students with dyslexia. Students with dyslexia in public schools have historically been largely ignored or under-identified. California public school educators and administrators need to understand what dyslexia is and how to accurately…

High resolution melting (HRM) analysis in sugar beet: identification of SNP markers associated to Fusarium resistance

USDA-ARS?s Scientific Manuscript database

Fusarium spp. cause severe damage in many agricultural crops including sugar beet. Sugar beet needs to be protected from these soil borne pathogens to guarantee an optimal sugar yield in the field. The genetic control is the key to overcoming this disease. Identification of single nucleotide polymor...

Vascular plants of west-central Montana-identification guidebook

Treesearch

Klaus Lackschewitz

1991-01-01

This comprehensive guidebook provides keys, illustrations, and descriptions that aid identification of the 1,600+ species and varieties of vascular plants growing in west-central Montana. The area covered encompasses Ravalli County and southern Missoula County, and it includes the Bitterroot National Forest and portions of the Lolo National Forest. This guidebook uses...

Feature Binding in Visual Working Memory Evaluated by Type Identification Paradigm

ERIC Educational Resources Information Center

Saiki, Jun; Miyatsuji, Hirofumi

2007-01-01

Memory for feature binding comprises a key ingredient in coherent object representations. Previous studies have been equivocal about human capacity for objects in the visual working memory. To evaluate memory for feature binding, a type identification paradigm was devised and used with a multiple-object permanence tracking task. Using objects…

Secure ADS-B authentication system and method

NASA Technical Reports Server (NTRS)

Viggiano, Marc J (Inventor); Valovage, Edward M (Inventor); Samuelson, Kenneth B (Inventor); Hall, Dana L (Inventor)

2010-01-01

A secure system for authenticating the identity of ADS-B systems, including: an authenticator, including a unique id generator and a transmitter transmitting the unique id to one or more ADS-B transmitters; one or more ADS-B transmitters, including a receiver receiving the unique id, one or more secure processing stages merging the unique id with the ADS-B transmitter's identification, data and secret key and generating a secure code identification and a transmitter transmitting a response containing the secure code and ADSB transmitter's data to the authenticator; the authenticator including means for independently determining each ADS-B transmitter's secret key, a receiver receiving each ADS-B transmitter's response, one or more secure processing stages merging the unique id, ADS-B transmitter's identification and data and generating a secure code, and comparison processing comparing the authenticator-generated secure code and the ADS-B transmitter-generated secure code and providing an authentication signal based on the comparison result.

A generic guide to the larvae of the Nearctic Tanytarsini, (Chironomidae:diptera)

USGS Publications Warehouse

Steiner, J.W.; Doughman, J.S.; Moore, C.R.

1982-01-01

Larvae of the tribe Tanytarsini occur in nearly every aquatic habitat in North America where they act as primary consumers in the food chain. This new taxonomic guide overcomes some deficiencies in existing keys to this tribe and the reviewed and updated taxonomy enables identification of the larvae that may be useful as ecological indicators. Over 2,000 specimens from 26 states were examined, identified and measured in this study. The following genera were included: Stempellinell, Zavrelia, Stempellina, Constempellina, Corynocera, Cladotanytarsus,.. Paratanytarsus, Rheotanytarsus,. Micropsectra, Lauterbornia, Nimbocera, Tanytarsus and Neozavrelia. Photographs illustrate mature larvae of these genera with the exception of Zavrelia and Neozavrelia which are not known to exist in North America. The morphological data, Which are summarized in a table of distinctive characteristics and the dichotomous key, enable identification to genus. Notes on range, habitat and food preference are included, and species identifications are presented where applicable.

Mammals of South America, Volume 1, Marsupials, Xenarthrans, Shrews, and Bats

USGS Publications Warehouse

Gardner, A.L.

2007-01-01

The vast terrain between Panama and Tierra del Fuego contains some of the world?s richest mammalian fauna, but until now it has lacked a comprehensive systematic reference to the identification, distribution, and taxonomy of its mammals. The first such book of its kind and the inaugural volume in a three-part series, Mammals of South America both summarizes existing information and encourages further research of the mammals indigenous to the region. Containing identification keys and brief descriptions of each order, family, and genus, the first volume of Mammals of South America covers marsupials, shrews, armadillos, sloths, anteaters, and bats. Species accounts include taxonomic descriptions, synonymies, keys to identification, distributions with maps and a gazetteer of marginal localities, lists of recognized subspecies, brief summaries of natural history information, and discussions of issues related to taxonomic interpretations. Highly anticipated and much needed, this book will be a landmark contribution to mammalogy, zoology, tropical biology, and conservation biology.

Perceived Triggers of Asthma: Key to Symptom Perception and Management

PubMed Central

Janssens, Thomas; Ritz, Thomas

2013-01-01

Adequate asthma management depends on an accurate identification of asthma triggers. A review of the literature on trigger perception in asthma shows that individuals vary in their perception of asthma triggers and that the correlation between self-reported asthma triggers and allergy tests is only modest. In this paper, we provide an overview of psychological mechanisms involved in the process of asthma triggers identification. We identify sources of errors in trigger identification and targets for behavioral interventions that aim to improve the accuracy of asthma trigger identification and thereby enhance asthma control. PMID:23957335

Smell of Stress: Identification of Induced Biochemical Pathways Affecting the Volatile Composition and Flavor Quality of Crops.

PubMed

Wüst, Matthias

2018-04-11

Recent research has shown that the biosynthesis of several key odorants is controlled by genes whose expression is altered or even induced by biotic or abiotic stress. These new findings provide a roadmap for improvement of flavor quality by the application of moderate, well-controlled stress. This strategy aims at reducing the flavor deficiencies in modern commercial varieties as a "green" alternative to genetic engineering. The workflow for a successful implementation of this approach, from the identification of key odorants by molecular science techniques to the investigation of mechanisms controlling their biosynthesis, is complex and calls for interdisciplinary research.

Genomic effects of androstenedione and sex-specific liver cancer susceptibility in mice

EPA Science Inventory

Current strategies for predicting carcinogenic mode of action for nongenotoxic chemicals are based on identification of early key events in toxicity pathways. The goal of this study was to evaluate short-term key event indicators resulting from exposure to androstenedione (A4), a...

Standoff Human Identification Using Body Shape

DOE Office of Scientific and Technical Information (OSTI.GOV)

Matzner, Shari; Heredia-Langner, Alejandro; Amidan, Brett G.

2015-09-01

The ability to identify individuals is a key component of maintaining safety and security in public spaces and around critical infrastructure. Monitoring an open space is challenging because individuals must be identified and re-identified from a standoff distance nonintrusively, making methods like fingerprinting and even facial recognition impractical. We propose using body shape features as a means for identification from standoff sensing, either complementing other identifiers or as an alternative. An important challenge in monitoring open spaces is reconstructing identifying features when only a partial observation is available, because of the view-angle limitations and occlusion or subject pose changes. Tomore » address this challenge, we investigated the minimum number of features required for a high probability of correct identification, and we developed models for predicting a key body feature—height—from a limited set of observed features. We found that any set of nine randomly selected body measurements was sufficient to correctly identify an individual in a dataset of 4426 subjects. For predicting height, anthropometric measures were investigated for correlation with height. Their correlation coefficients and associated linear models were reported. These results—a sufficient number of features for identification and height prediction from a single feature—contribute to developing systems for standoff identification when views of a subject are limited.« less

DNA-Based Identification of Forensically Important Blow Flies (Diptera: Calliphoridae) From India.

PubMed

Bharti, Meenakshi; Singh, Baneshwar

2017-09-01

Correct species identification is the first and the most important criteria in entomological evidence-based postmortem interval (PMI) estimation. Although morphological keys are available for species identification of adult blow flies, keys for immature stages are either lacking or are incomplete. In this study, cytochrome oxidase subunit 1 (COI) reference data were developed from nine species (belonging to three subfamilies, namely, Calliphorinae, Luciliinae, and Chrysomyinae) of blow flies from India. Seven of the nine species included in this study were found suitable for DNA-based identification using COI gene, because they showed nonoverlapping intra- (0.0-0.3%) and inter-(1.96-18.14%) specific diversity, and formed well-supported monophyletic clade in phylogenetic analysis. The remaining two species (i.e., Chrysomya megacephala (Fabricius) and Chrysomya chani Kurahashi) cannot be distinguished reliably using our database because they had a very low interspecific diversity (0.11%), and Ch. megacephala was paraphyletic with respect to Ch. chani in the phylogenetic analysis. We conclude that the COI gene is a useful marker for DNA-based identification of blow flies from India. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Provider reported barriers and solutions to improve testing among tuberculosis patients ‘eligible for drug susceptibility test’: A qualitative study from programmatic setting in India

PubMed Central

Parmar, Malik; Verma, Manoj; Desikan, Prabha; Khan, Sheeba Naz; Kumar, Ajay M. V.

2018-01-01

Background In a study conducted in Bhopal district (a setting with facility for molecular drug susceptibility testing (DST)) located in central India in 2014–15, we found high levels of pre-diagnosis attrition among patients with presumptive multi drug-resistant tuberculosis (MDR-TB)–meaning TB patients who were eligible for DST, were not being tested. Objectives In this study, we explored the health care provider perspectives into barriers and suggested solutions for improving DST. Methods This was a descriptive qualitative study. One to one interviews (n = 10) and focus group discussions (n = 2) with experienced key informants involved in programmatic management of DR-TB were conducted in April 2017. Manual descriptive thematic analysis was performed. Results The key barriers reported were a) lack of or delay in identification of patients eligible for DST because of using treatment register as the source for identifying patients b) lack of assured specimen transport after patient identification and c) lack of tracking. Extra pulmonary TB patients were not getting identified as eligible for DST. Solutions suggested by the health care providers were i) generation of unique identifier at identification in designated microscopy center (DMC), immediate intimation of unique identifier to district and regular monitoring by senior TB laboratory and senior treatment supervisors of patients eligible for DST that were missed; ii) documentation of unique identifier at each step of cascade; iii) use of human carriers/couriers to transport specimen from DMCs especially in rural areas; and iv) routine entry of all presumptive extra-pulmonary TB specimen, as far as possible, in DMC laboratory register. Conclusion Lack of assured specimen transport and lack of accountability for tracking patient after identification and referral were the key barriers. The identification of patients eligible for DST among microbiologically confirmed TB at the time of diagnosis and among clinically confirmed TB at the time of treatment initiation is the key. Use of unique identifier at identification and its use to ensure cohort wise tracking has to be complemented with specimen transport support and prompt feedback to the DMC. The study has implications to improve detection of MDR-TB among diagnosed/notified TB patients. PMID:29677210

Identification of Terrestrial Reflectance From Remote Sensing

NASA Technical Reports Server (NTRS)

Alter-Gartenberg, Rachel; Nolf, Scott R.; Stacy, Kathryn (Technical Monitor)

2000-01-01

Correcting for atmospheric effects is an essential part of surface-reflectance recovery from radiance measurements. Model-based atmospheric correction techniques enable an accurate identification and classification of terrestrial reflectances from multi-spectral imagery. Successful and efficient removal of atmospheric effects from remote-sensing data is a key factor in the success of Earth observation missions. This report assesses the performance, robustness and sensitivity of two atmospheric-correction and reflectance-recovery techniques as part of an end-to-end simulation of hyper-spectral acquisition, identification and classification.

Twenty-six key research questions in urban stream ecology: an assessment of the state of the science

EPA Science Inventory

Although urban streams have been the focus of much research activity in recent years, there remain many unanswered questions about the mechanisms driving the “urban stream syndrome.” Identification of these key research questions is an important step toward effective, efficient ...

75 FR 36642 - Privacy Act of 1974; System of Records

Federal Register 2010, 2011, 2012, 2013, 2014

2010-06-28

... relating to the issue, return, and accountability of keys to secure areas. Records may contain name, Social... disposing of records in the system: Storage: Paper records in file folders and electronic storage media. Retrievability: By name, Social Security Number (SSN), key number, personal identification number (PIN), Magnetic...

Public-Key Cryptography: A Hardware Implementation and Novel Neural Network-Based Approach

DTIC Science & Technology

1992-09-01

FUNDINGISPONSORING 8b. OFFICE SYMBOL 9. PROCUREMENT INSTRUMENT IDENTIFICATION NUMBER ORGANIZATION (if applicable ) 8c. ADDRESS (City, State, and ZIP Code) 10...8217....... ......... 4. .. . . iii TABLE OF CONTENTS I. INTRODUCTION ............................. 1 II. MATHEMATICAL BASIS FOR THE DEVELOPMENT OF PUBLIC-KEY...in the spirit of this future that this thesis is presented. It is an in-depth study of the public-key cryptosystem. First, the mathematical basis

Invasive Plants Field and Reference Guide: An Ecological Perspective of Plant Invaders of Forests and Woodlands

Treesearch

Cynthia D. Huebner; Cassandra Olson; Heather C. Smith; Heather C. Smith

2005-01-01

There are many field guides available about invasive plants and their identification. The purpose of this particular field guide is to give a scientific synthesis of what is known about the behavior of such species in managed, disturbed, and pristine forested systems in addition to key information for accurate identification.

Biology and Identification of Rays in the Chesapeake Bay. Sea Grant Program. Educational Series Number 20.

ERIC Educational Resources Information Center

Smith, Joseph W.; Merriner, J. V.

This booklet provides a brief discussion of the anatomy and biology of rays in the Chesapeake Bay and a key to their identification. Descriptions of seven types of rays are also provided (with accompanying illustrations). These include electric rays, stingrays, butterfly rays, eagle rays, cownose rays, and manta rays. (JN)

Research into the Specific Aspects of Internal Conflict Displays in the Course of Professional Identification

ERIC Educational Resources Information Center

Rensh, Marina A.; Kosyakova, Inessa V.; Agafonova, Anna N.

2016-01-01

The applicability of the researched issue is preconditioned by the need for detecting key determinants which define the process of the person's professional development, identification with the professional environment, and sources of professional self-efficacy. The purpose of the article is to provide the deliverables of the empiric research for…

Hypermedia in the Plant Sciences: The Weed Key and Identification System/Videodisc.

ERIC Educational Resources Information Center

Ragan, Lawrence C.

1991-01-01

In cooperation with a university educational technology unit, an agronomy professor used hypercard and videodisk technology to develop a computer program for identification of 181 weed species based on user-selected characteristics. This solution was found during a search for a way to organize course content in a concise, manageable system. (MSE)

Identification of Special Educational Needs for Early Childhood Inclusive Education in Ghana

ERIC Educational Resources Information Center

Mensah, Florence Akua; Badu-Shayar, Jeremiah

2016-01-01

Early Childhood Education is a key element for the growth and development of every country. This paper, provides a summary of reviewing the impact of early childhood special educational assessment on children to be "at risk" of developing special educational needs. It was identified mainly that early identification of at-risk factors for…

Patients’ Data Management System Protected by Identity-Based Authentication and Key Exchange

PubMed Central

Rivero-García, Alexandra; Santos-González, Iván; Hernández-Goya, Candelaria; Caballero-Gil, Pino; Yung, Moti

2017-01-01

A secure and distributed framework for the management of patients’ information in emergency and hospitalization services is proposed here in order to seek improvements in efficiency and security in this important area. In particular, confidentiality protection, mutual authentication, and automatic identification of patients are provided. The proposed system is based on two types of devices: Near Field Communication (NFC) wristbands assigned to patients, and mobile devices assigned to medical staff. Two other main elements of the system are an intermediate server to manage the involved data, and a second server with a private key generator to define the information required to protect communications. An identity-based authentication and key exchange scheme is essential to provide confidential communication and mutual authentication between the medical staff and the private key generator through an intermediate server. The identification of patients is carried out through a keyed-hash message authentication code. Thanks to the combination of the aforementioned tools, a secure alternative mobile health (mHealth) scheme for managing patients’ data is defined for emergency and hospitalization services. Different parts of the proposed system have been implemented, including mobile application, intermediate server, private key generator and communication channels. Apart from that, several simulations have been performed, and, compared with the current system, significant improvements in efficiency have been observed. PMID:28362328

Patients' Data Management System Protected by Identity-Based Authentication and Key Exchange.

PubMed

Rivero-García, Alexandra; Santos-González, Iván; Hernández-Goya, Candelaria; Caballero-Gil, Pino; Yung, Moti

2017-03-31

A secure and distributed framework for the management of patients' information in emergency and hospitalization services is proposed here in order to seek improvements in efficiency and security in this important area. In particular, confidentiality protection, mutual authentication, and automatic identification of patients are provided. The proposed system is based on two types of devices: Near Field Communication (NFC) wristbands assigned to patients, and mobile devices assigned to medical staff. Two other main elements of the system are an intermediate server to manage the involved data, and a second server with a private key generator to define the information required to protect communications. An identity-based authentication and key exchange scheme is essential to provide confidential communication and mutual authentication between the medical staff and the private key generator through an intermediate server. The identification of patients is carried out through a keyed-hash message authentication code. Thanks to the combination of the aforementioned tools, a secure alternative mobile health (mHealth) scheme for managing patients' data is defined for emergency and hospitalization services. Different parts of the proposed system have been implemented, including mobile application, intermediate server, private key generator and communication channels. Apart from that, several simulations have been performed, and, compared with the current system, significant improvements in efficiency have been observed.

Human factors engineering approaches to patient identification armband design.

PubMed

Probst, C Adam; Wolf, Laurie; Bollini, Mara; Xiao, Yan

2016-01-01

The task of patient identification is performed many times each day by nurses and other members of the care team. Armbands are used for both direct verification and barcode scanning during patient identification. Armbands and information layout are critical to reducing patient identification errors and dangerous workarounds. We report the effort at two large, integrated healthcare systems that employed human factors engineering approaches to the information layout design of new patient identification armbands. The different methods used illustrate potential pathways to obtain standardized armbands across healthcare systems that incorporate human factors principles. By extension, how the designs have been adopted provides examples of how to incorporate human factors engineering into key clinical processes. Copyright © 2015 Elsevier Ltd and The Ergonomics Society. All rights reserved.

A QUICK KEY TO THE SUBFAMILIES AND GENERA OF ANTS OF THE SAVANNAH RIVER SITE

DOE Office of Scientific and Technical Information (OSTI.GOV)

Martin, D

2007-09-04

This taxonomic key was devised to support development of a Rapid Bioassessment Protocol using ants at the Savannah River Site. The emphasis is on 'rapid' and, because the available keys contained a very large number of genera not known to occur at the Savannah River Site, we found that the available keys were unwieldy. Because these keys contained many more genera than we would ever encounter and because this larger number of genera required more couplets in the key and often required examination of characters that are difficult to assess without higher magnifications (60X or higher), more time was requiredmore » to process samples. In developing this set of keys I emphasized character states that are easier for nonspecialists to recognize. I recognize that the character sets used may lead to some errors but I believe that the error rate will be small and, for the purpose of rapid bioassessment, this error rate will be acceptable provided that overall sample sizes are adequate. Oliver and Beattie (1996a, 1996b) found that for rapid assessment of biodiversity the same results were found when identifications were done to morphospecies by people with minimal expertise as when the same data sets were identified by subject matter experts. Basset et al. (2004) concluded that it was not as important to correctly identify all species as it was to be sure that the study included as many functional groups as possible. If your study requires high levels of accuracy, it is highly recommended that, when you key out a specimen and have any doubts concerning the identification, you should refer to keys in Bolton (1994) or to the other keys used to develop this area specific taxonomic key.« less

A QUICK KEY TO THE SUBFAMILIES AND GENERA OF ANTS OF THE SAVANNAH RIVER SITE, AIKEN, SC

DOE Office of Scientific and Technical Information (OSTI.GOV)

Martin, D

2006-10-04

This taxonomic key was devised to support development of a Rapid Bioassessment Protocol using ants at the Savannah River Site. The emphasis is on ''rapid'' and, because the available keys contained a large number of genera not known to occur at the Savannah River Site, we found that the available keys were unwieldy. Because these keys contained more genera than we would likely encounter and because this larger number of genera required both more couplets in the key and often required examination of characters that are difficult to assess without higher magnifications (60X or higher) more time was required tomore » process samples. In developing this set of keys I recognize that the character sets used may lead to some errors but I believe that the error rate will be small and, for the purpose of rapid bioassessment, this error rate will be acceptable provided that overall sample sizes are adequate. Oliver and Beattie (1996a, 1996b) found that for rapid assessment of biodiversity the same results were found when identifications were done to morphospecies by people with minimal expertise as when the same data sets were identified by subject matter experts. Basset et al. (2004) concluded that it was not as important to correctly identify all species as it was to be sure that the study included as many functional groups as possible. If your study requires high levels of accuracy, it is highly recommended that when you key out a specimen and have any doubts concerning the identification, you should refer to keys in Bolton (1994) or to the other keys used to develop this area specific taxonomic key.« less

Description of third instars of Cochliomyia minima (Diptera: Calliphoridae) from West Indies, and updated identification key.

PubMed

Yusseff-Vanegas, S

2014-09-01

The blow fly Cochliomyia minima Shannon is endemic to the Caribbean, and it has great potential for forensic applications because of its abundance and broad distribution in the region. However, its larval stages are unknown. Here, I update previously published identification keys by describing for the first time the morphology of C. minima larvae. The larvae of C. minima are found to be very similar to those of Cochliomyia macellaria F., but the former can be easily identified by the oral sclerite completely pigmented, visible as a spike between mouth hooks. The description of C. minima larvae in this study will be useful to forensic scientists in the Caribbean region.

Comparative morphology of immature stages of four species of Chinavia (Hemiptera, Pentatomidae), with a key to the species of Rio Grande do Sul, Brazil

PubMed Central

Fürstenau, Brenda Bianca Rodrigues Jesse; Schwertner, Cristiano Feldens; Grazia, Jocelia

2013-01-01

Abstract Chinavia Orian (1965) is one of the most diverse genera of Pentatomidae, distributed in the Afrotropical, Neotropical and Nearctic Regions. Thirty-two species are recorded for Brazil, some of them having potential economic impact because they are found on crops and referred to as pests. The morphology of the five nymphal instars of Chinavia armigera (Stål, 1859), Chinavia aseada (Rolston, 1983), Chinavia brasicola (Rolston, 1983) and Chinavia runaspis (Dallas, 1851) are described here. Through a comparative study, identification keys were developed to allow an early identification of the 12 Chinavia species of Rio Grande do Sul. PMID:24039512

Easier detection of invertebrate "identification-key characters" with light of different wavelengths

PubMed Central

2011-01-01

The marine α-taxonomist often encounters two problems. Firstly, the "environmental dirt" that is frequently present on the specimens and secondly the difficulty in distinguishing key-features due to the uniform colours which fixed animals often adopt. Here we show that illuminating animals with deep-blue or ultraviolet light instead of the normal white-light abrogates both difficulties; dirt disappears and important details become clearly visible. This light regime has also two other advantages. It allows easy detection of very small, normally invisible, animals (0.1 μm range). And as these light wavelengths can induce fluorescence, new identification markers may be discovered by this approach. PMID:22040277

Key Competencies for Education in a European Context: Narratives of Accountability or Care

ERIC Educational Resources Information Center

Deakin, Ruth

2008-01-01

This article addresses the ideological challenges and opportunities presented by the European Commission's commitment to the identification of key competencies for education and training, and the development of indicators which can be used to monitor and evaluate progress towards these competences across the European Union. It explores the…

Key Mites Commonly Associated With the Southern Pine Beetle

Treesearch

D.N. Kinn

1976-01-01

This paper outlines a method of preparing mites for microscopic examination and contains a simple key to the 15 species of mites commonly associated with the southern pine bark beetle. Research workers wanting to identify these mites and others curious about them, but untrained in acarology, should find little difficulty in making identifications.

Two New Species of Nocturnal Bees of the Genus Megalopta (Hymenoptera: Halictidae) with Keys to Species

USDA-ARS?s Scientific Manuscript database

Two new species of the nocturnal bee genus Megalopta are described: M. (Megalopta) tetewana, n. sp., from Mexico and M. (Noctoraptor) huaoranii, n. sp., from Ecuador. Identification keys to the Mesoamerican species of Megalopta s. str. and the species of the cleptoparasitic subgenus Noctoraptor ar...

A new species of Tomarus Erichson, 1847 (Coleoptera: Scarabaeidae: Dynastinae: Pentodontini), with a key to the species in Colombia.

PubMed

López-García, Margarita M; Gasca-Álvarez, Héctor J; Amat-García, Germán

2014-10-03

A new Tomarus Erichson, 1847 (Coleoptera: Scarabaeidae: Dynastinae: Pentodontini) species is described from western Colombia. The new species is compared with Tomarus laevicollis (Bates, 1888) from Central America. An identification key is also provided to the species occurring in the country. 

Becoming a Reader: Significant Social Influences on Avid Book Readers

ERIC Educational Resources Information Center

Merga, Margaret K.

2017-01-01

Understanding how social influences can foster avid book reader identification is a key research goal that warrants further investigation beyond a limited early-years lens. The author's 2015 International Study of Avid Book Readers (ISABR) explored, as one of its key research questions, the influence positive social agents can have on avid book…

Educational Quality Bill of Rights

ERIC Educational Resources Information Center

Center for Law and Education (NJ3), 2009

2009-01-01

This paper presents two forms of the Educational Quality Bill of Rights (EQBR). The first is a "one-page version", with a very brief single sentence identification of a key element of quality education in response to each of the key questions about the school (covering standards/learning goals, curriculum, instruction, etc.). The second is a "much…

Escherichia Coli--Key to Modern Genetics.

ERIC Educational Resources Information Center

Bregegere, Francois

1982-01-01

Mid-nineteenth century work by Mendel on plant hybrids and by Pasteur on fermentation gave birth by way of bacterial genetics to modern-day molecular biology. The bacterium Escherichia Coli has occupied a key position in genetic studies leading from early gene identification with DNA to current genetic engineering using recombinant DNA technology.…

Illustrated Plant Identification Keys: An Interactive Tool to Learn Botany

ERIC Educational Resources Information Center

Silva, Helena; Pinho, Rosa; Lopes, Lisia; Nogueira, Antonio J. A.; Silveira, Paulo

2011-01-01

An Interactive Dichotomous Key (IDK) for 390 "taxa" of vascular plants from the Ria de Aveiro, available on a website, was developed to help teach botany to school and universitary students. This multimedia tool includes several links to Descriptive and Illustrated Glossaries. Questionnaires answered by high-school and undergraduate students about…

Antioxidant Activity in Extracts of 27 Indigenous Taiwanese Vegetables

PubMed Central

Chao, Pi-Yu; Lin, Su-Yi; Lin, Kuan-Hung; Liu, Yu-Fen; Hsu, Ju-Ing; Yang, Chi-Ming; Lai, Jun-You

2014-01-01

The objectives of this study were to identify the antioxidants and antioxidant axtivity in 27 of Taiwan’s indigenous vegetables. Lycium chinense (Lc), Lactuca indica (Li), and Perilla ocymoides (Po) contained abundant quercetin (Que), while Artemisia lactiflora (Al) and Gynura bicolor (Gb) were rich in morin and kaempferol, respectively. Additionally, Nymphoides cristata (Nc) and Sechium edule (Se)-yellow had significantly higher levels of myricetin (Myr) than other tested samples. Cyanidin (Cyan) and malvidin (Mal) were abundant in Gb, Abelmoschus esculentus Moench (Abe), Po, Anisogonium esculentum (Retz.) Presl (Ane), Ipomoea batatas (Ib)-purple, and Hemerocallis fulva (Hf)-bright orange. Relatively high levels of Trolox equivalent antioxidant capacity (TEAC), oxygen radical absorption capacity (ORAC), and 1,1-diphenyl-2-picryl-hydrazyl (DPPH) radical scavenger were generated from extracts of Toona sinensis (Ts) and Po. Significant and positive correlations between antioxidant activity and polyphenols, anthocyanidins, Que, Myr, and morin were observed, indicating that these phytochemicals were some of the main components responsible for the antioxidant activity of tested plants. The much higher antioxidant activity of Po, Ts, and Ib (purple leaf) may be related to their higher Cyan, Que, and polyphenol content. PMID:24858497

Differential Olfactory Identification in Children with Autism and Asperger's Disorder: A Comparative and Longitudinal Study

ERIC Educational Resources Information Center

May, Tamara; Brewer, Warrick J.; Rinehart, Nicole J.; Enticott, Peter G.; Brereton, Avril V.; Tonge, Bruce J.

2011-01-01

Key theories of autism implicate orbitofrontal cortex (OFC) compromise, while olfactory identification (OI) deficits are associated with OFC dysfunction. This study aimed to complete a 5-year follow-up of children with high-functioning autism (HFA) who previously lacked the normal age-OI association; and compare unirhinal-OI in children with HFA,…

Identification, expression, and characterization of a major salivary allergen (Cul s 1) of the biting midge Culicoides sonorensis relevant for summer eczema in horses

USDA-ARS?s Scientific Manuscript database

Salivary proteins of Culicoides biting midges are thought to play a key role in the induction of summer eczema (SE), a seasonal recurrent allergic dermatitis in horses. The present study describes the identification of a candidate allergen in artificially collected saliva of the North American speci...

Vector Control During Operation Restore Hope - Somalia

DTIC Science & Technology

2008-11-16

Restore Hope, focusing primarily on pest battalion provided services including and vector control operations. Much of identification of the preventive...and usable arthropod Identification larval mosquito surveys were conducted, materials (i.e., keys) were nonexistent. but only in areas that were...bait would be mosquitoes. The pesticide used for placed adjacent to but away from troop mosquito control ( malathion - ULV) was areas, attracting flies

Identification guide to some Diaptomid species (Crustacea, Copepoda, Calanoida, Diaptomidae) of “de la Plata” River Basin (South America)

PubMed Central

Perbiche-Neves, Gilmar; Boxshall, Geoffrey Allan; Previattelli, Daniel; Nogueira, Marcos Gomes; da Rocha, Carlos Eduardo Falavigna

2015-01-01

Abstract An identification guide is presented for species of calanoid copepod family Diaptomidae from “de la Plata” River Basin (Argentina, Brazil, Bolivia, Paraguay and Uruguay). It was based on material collected during the summer and winter of 2010 from 43 sites across the eastern part and the lower stretches of this basin, the second largest in South America and the fourth in the world. The guide contains identification keys and species diagnoses for males and females, richly supported by scanning electronic micrographs and/or line drawings of 19 species. It also includes some general remarks on the taxonomy and phylogenetic relationships of these species. The key was adjusted to be useful for these species only, with separate keys for each sex, and is the first for females of South America. One species classified herein as incertae sedis was not included in the analysis. At least ten other species have previously been recorded in the basin but were not present in our samples. This is the first attempt to compile comprehensive taxonomic information on this group of copepods in this region, and it is expected to become a useful tool for biologists and young taxonomists interested in the crustacean biota of the Neotropical region. PMID:25931959

[Algorithm of toxigenic genetically altered Vibrio cholerae El Tor biovar strain identification].

PubMed

Smirnova, N I; Agafonov, D A; Zadnova, S P; Cherkasov, A V; Kutyrev, V V

2014-01-01

Development of an algorithm of genetically altered Vibrio cholerae biovar El Tor strai identification that ensures determination of serogroup, serovar and biovar of the studied isolate based on pheno- and genotypic properties, detection of genetically altered cholera El Tor causative agents, their differentiation by epidemic potential as well as evaluation of variability of key pathogenicity genes. Complex analysis of 28 natural V. cholerae strains was carried out by using traditional microbiological methods, PCR and fragmentary sequencing. An algorithm of toxigenic genetically altered V. cholerae biovar El Tor strain identification was developed that includes 4 stages: determination of serogroup, serovar and biovar based on phenotypic properties, confirmation of serogroup and biovar based on molecular-genetic properties determination of strains as genetically altered, differentiation of genetically altered strains by their epidemic potential and detection of ctxB and tcpA key pathogenicity gene polymorphism. The algorithm is based on the use of traditional microbiological methods, PCR and sequencing of gene fragments. The use of the developed algorithm will increase the effectiveness of detection of genetically altered variants of the cholera El Tor causative agent, their differentiation by epidemic potential and will ensure establishment of polymorphism of genes that code key pathogenicity factors for determination of origins of the strains and possible routes of introduction of the infection.

Checklist and identification key of Anomalini (Coleoptera, Scarabaeidae, Rutelinae) of Costa Rica

PubMed Central

Filippini, Valentina; Micó, Estefanía; Galante, Eduardo

2016-01-01

Abstract A checklist and identification key for the species of the tribe Anomalini in Costa Rica are presented. The Anomalini species are important economically, as they have larvae that are or can become agricultural pests, as well as ecologically, having potential as bioindicators. In spite of their importance and richness, identification tools for the group in the Neotropics remain scarce. The Costa Rican fauna comprises six genera (Anomala, Anomalorhina, Callistethus, Epectinaspis, Moroniella, and Strigoderma) and a total of 120 species. Anomala contusa Filippini, Micó, Galante, 2015 is proposed as a synonym of Anomala inbio (Ramírez-Ponce, Bitar, Curoe 2014); Anomala limon nom. n. is proposed as a new name for Anomala inbio Filippini, Galante, Micó, 2015, a homonym of Anomala inbio (Ramírez-Ponce, Bitar, Curoe, 2014); Anomala cinaedias nom. n. is proposed as a new name for Anomala chloropyga Ohaus, 1897, a homonym of Anomala chloropyga Burmeister, 1844; and Anomala chrysomelina is moved to the genus Callistethus. PMID:27833420

The Cyber War: Maintaining and Controlling the Key Cyber Terrain of the Cyberspace Domain

DTIC Science & Technology

2016-06-26

solution strategy to assess options that will enable the commander to realize the Air Force’s cyber mission. Recommendations will be made that will...will present a solution to assist the JFC in achieving cyberspace dominance. Background In the modern world of advanced technology, control of...the solutions are: 1) timely identification of key cyber terrain, 2) accurate mapping of the cyber terrain, 3) defense of key cyber terrain, and 4

Simple Web-based interactive key development software (WEBiKEY) and an example key for Kuruna (Poaceae: Bambusoideae).

PubMed

Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G

2016-04-01

Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.

Paranoia and psychotic process: some clinical applications of projective identification in psychoanalytic psychotherapy.

PubMed

Sweet, Alistair D

2010-01-01

The concept of projective identification has, since its introduction by Melanie Klein over half a century ago, caused much controversy amongst psychoanalysts and psychotherapists. In this paper the author traces some of the key theoretical developments of the concept since its introduction in 1946, including: normal and pathological projective identification, aspects of symbolisation and projective identification as an intrapsychic mechanism. An extended case report of a patient in weekly psychoanalytic psychotherapy is offered in order to expand upon some of the theoretical ideas previously considered. Emphasis is placed on the patient's use of intrapsychic projective mechanisms and the emergence and mutation of such mechanisms in the therapeutic relationship.

Detecting and Treating Depression in People with Mild Intellectual Disability: The Views of Key Stakeholders

ERIC Educational Resources Information Center

McGillivray, Jane A.; McCabe, Marita P.

2010-01-01

There is a pressing need for the development of programs for the early identification and treatment of depression in individuals with mild intellectual disability. The aim of this study was to ascertain the perspective of 64 key stakeholders (people with intellectual disability, healthcare professionals, family/caregivers & support workers)…

Cavernicolous Arrhopalites abchasicus sp. nov. (Collembola: Symphypleona: Arrhopalitidae) from the West Caucasus with a key to the World species of the genus.

PubMed

Vargovitsh, Robert S

2013-01-01

A new troglobiont species of Collembola, Arrhopalites abchasicus sp. nov., from Psyrtskha Cave in Novy Afon (West Caucasus, Abkhazia) is described. Subdivision of the genus Arrhopalites on diversus, caecus and harveyi groups of species is proposed and identification key to the World species is provided.

A Key for the Identification of Eighteen Common Timbers.

ERIC Educational Resources Information Center

Thomas, P. A.

1991-01-01

Dichotomous key for 18 woods in common domestic and architectural use in Britain is provided. It is based upon structures visible with the naked eye and a hand-lens. Descriptions of the necessary anatomy and terminology are given. Timbers include yew, pine, spruce, oak, sweet chestnut, elm, ash, teak, cherry, walnut, mahogany, box, beech,…

Two new species of Aulospongus Norman, 1878 with a key to the Atlantic species (Poecilosclerida; Demospongiae; Porifera).

PubMed

Cavalcanti, Thaynã; Santos, George Garcia; Pinheiro, Ulisses

2014-07-03

We describe two new species: Aulospongus trirhabdostylus sp. nov. and Aulospongus mandela sp. nov. from Potiguar Basin (Rio Grande do Norte State, Northeastern Brazil). Both species were compared with their congeners and an identification key for the Atlantic species of Aulospongus is provided. The genus Aulospongus now contains 16 species.

Experimental studies of forensic odontology to aid in the identification process

PubMed Central

Saxena, Susmita; Sharma, Preeti; Gupta, Nitin

2010-01-01

The importance of dental identification is on the increase year after year. With the passage of time, the role of forensic odontology has increased as very often teeth and dental restorations are the only means of identification. Forensic odontology has played a key role in identification of persons in mass disasters (aviation, earthquakes, Tsunamis), in crime investigations, in ethnic studies, and in identification of decomposed and disfigured bodies like that of drowned persons, fire victims, and victims of motor vehicle accidents. The various methods employed in forensic odontology include tooth prints, radiographs, photographic study, rugoscopy, cheiloscopy and molecular methods. Investigative methods applied in forensic odontology are reasonably reliable, yet the shortcomings must be accounted for to make it a more meaningful and relevant procedure. This paper gives an overview of the various experimental studies to aid in the identification processes, discussing their feasibilities and limitations in day-to-day practice. PMID:21731343

Hawaii Energy Resource Overviews. Volume 5. Social and economic impacts of geothermal development in Hawaii

DOE Office of Scientific and Technical Information (OSTI.GOV)

Canon, P.

1980-06-01

The overview statement of the socio-economic effects of developing geothermal energy in the State of Hawaii is presented. The following functions are presented: (1) identification of key social and economic issues, (2) inventory of all available pertinent data, (3) analysis and assessment of available data, and (4) identification of what additional information is required for adequate assessment.

Serrasalmidae — Piranhas and Pacus

USGS Publications Warehouse

Nico, Leo; Jegu, Michel; Andrade, Marcelo C

2017-01-01

The family Serrasalmidae is a morphologically and ecologically diverse group of South American freshwater fishes consisting of 16 genera and about 91 valid species. This chapter is a summary of the current state of knowledge on serrasalmid taxonomy, species richness, and ecology, and provides an identification key to the genera and references to relevant literature for species-level identifications. Included is information on native and non-native populations.

An Investigation into the Use of Cognitive Ability Tests in the Identification of Gifted Students in Design and Technology

ERIC Educational Resources Information Center

Twissell, Adrian

2011-01-01

This study examines whether MidYIS and YELLIS cognitive ability tests (CATs) are appropriate methods for the identification of giftedness in Design and Technology. A key rationale for the study was whether CATs and able to identify those students with the aptitudes considered of importance to identifying giftedness in Design and Technology and…

Highly Efficient Proteolysis Accelerated by Electromagnetic Waves for Peptide Mapping

PubMed Central

Chen, Qiwen; Liu, Ting; Chen, Gang

2011-01-01

Proteomics will contribute greatly to the understanding of gene functions in the post-genomic era. In proteome research, protein digestion is a key procedure prior to mass spectrometry identification. During the past decade, a variety of electromagnetic waves have been employed to accelerate proteolysis. This review focuses on the recent advances and the key strategies of these novel proteolysis approaches for digesting and identifying proteins. The subjects covered include microwave-accelerated protein digestion, infrared-assisted proteolysis, ultraviolet-enhanced protein digestion, laser-assisted proteolysis, and future prospects. It is expected that these novel proteolysis strategies accelerated by various electromagnetic waves will become powerful tools in proteome research and will find wide applications in high throughput protein digestion and identification. PMID:22379392

On the poorly known haplogynae spiders of the genus Ochyrocera Simon (Araneae, Ochyroceratidae) from Mexico: description of two new species with an updated identification key for Mexican species.

PubMed

Valdez-Mondragón, Alejandro

2017-01-26

Two new species of the spider genus Ochyrocera Simon 1891 are described from Mexico. Ochyrocera jarocha new species was collected under rotten trunks and hollow trunks in a tropical rainforest, in San Martin Volcano, Veracruz, Mexico. Ochyrocera pojoj new species was collected in a mixed forest, under rotten trunks, in La Trinitaria, Chiapas, Mexico, which represents the third species described from the state of Chiapas. With the description of the two new species herein, six species of Ochyrocera are recorded from Mexico. An updated taxonomic identification key and a distribution map to the Mexican species are provided.

"No-Go Considerations" for In Situ Simulation Safety.

PubMed

Bajaj, Komal; Minors, Anjoinette; Walker, Katie; Meguerdichian, Michael; Patterson, Mary

2018-06-01

In situ simulation is the practice of simulation in the actual clinical environment and has demonstrated utility in the assessment of system processes, identification of latent safety threats, and improvement in teamwork and communication. Nonetheless, performing simulated events in a real patient care setting poses potential risks to patient and staff safety. One integral aspect of a comprehensive approach to ensure the safety of in situ simulation includes the identification and establishment of "no-go considerations," that is, key decision-making considerations under which in situ simulations should be canceled, postponed, moved to another area, or rescheduled. These considerations should be modified and adjusted to specific clinical units. This article provides a framework of key essentials in developing no-go considerations.

Input from Key Stakeholders in the National Security Technology Incubator

DOE Office of Scientific and Technical Information (OSTI.GOV)

None

This report documents the input from key stakeholders of the National Security Technology Incubator (NSTI) in developing a new technology incubator and related programs for southern New Mexico. The technology incubator is being developed as part of the National Security Preparedness Project (NSPP), funded by a Department of Energy (DOE)/National Nuclear Security Administration (NNSA) grant. This report includes identification of key stakeholders as well as a description and analysis of their input for the development of an incubator.

Prospects of A and Z identification experiments at LBNL

NASA Astrophysics Data System (ADS)

Gates, Jacklyn M.

2016-12-01

The identification of six new elements within the last 15 years and with proton numbers, Z = 113-118 has transformed the heavy element field. However, one key piece of information on these nuclei remains unmeasured: their proton and mass numbers, A. At Lawrence Berkeley National Laboratory, the heavy element group has undertaken a program to study these new elements to perform experiments aimed at measuring the Z and A.Here, an overview of recent experiments aimed towards identifying the Z of SHE, and the prospects for Z and A identification experiments at LBNL are presented.

Incorporation of unnatural sugars for the identification of glycoproteins.

PubMed

Zaro, Balyn W; Hang, Howard C; Pratt, Matthew R

2013-01-01

Glycosylation is an abundant post-translational modification that alters the fate and function of its substrate proteins. To aid in understanding the significance of protein glycosylation, identification of target proteins is key. As with all proteomics experiments, mass spectrometry has been established as the desired method for substrate identification. However, these approaches require selective enrichment and purification of modified proteins. Chemical reporters in combination with bioorthogonal reactions have emerged as robust tools for identifying post-translational modifications including glycosylation. We provide here a method for the use of bioorthogonal chemical reporters for isolation and identification of glycosylated proteins. More specifically, this protocol is a representative procedure from our own work using an alkyne-bearing O-GlcNAc chemical reporter (GlcNAlk) and a chemically cleavable azido-azo-biotin probe for the identification of O-GlcNAc-modified proteins.

Identification challenges for large space structures

NASA Technical Reports Server (NTRS)

Pappa, Richard S.

1990-01-01

The paper examines the on-orbit modal identification of large space structures, stressing the importance of planning and experience, in preparation for the Space Station Structural Characterization Experiment (SSSCE) for the Space Station Freedom. The necessary information to foresee and overcome practical difficulties is considered in connection with seven key factors, including test objectives, dynamic complexity of the structure, data quality, extent of exploratory studies, availability and understanding of software tools, experience with similar problems, and pretest analytical conditions. These factors affect identification success in ground tests. Comparisons with similar ground tests of assembled systems are discussed, showing that the constraints of space tests make these factors more significant. The absence of data and experiences relating to on-orbit modal identification testing is shown to make identification a uniquely mathematical problem, although all spacecraft are constructed and verified by proven engineering methods.

Identifying Key Features of Student Performance in Educational Video Games and Simulations through Cluster Analysis

ERIC Educational Resources Information Center

Kerr, Deirdre; Chung, Gregory K. W. K.

2012-01-01

The assessment cycle of "evidence-centered design" (ECD) provides a framework for treating an educational video game or simulation as an assessment. One of the main steps in the assessment cycle of ECD is the identification of the key features of student performance. While this process is relatively simple for multiple choice tests, when…

Identification of Key Issues in Adopting a Web 2.0 E-Portfolio Strategy

ERIC Educational Resources Information Center

McKenna, Gary F.; Stansfield, Mark H.

2013-01-01

The purpose of the paper is to identify key issues relating to best practice and sustainability in Web 2.0 as an e-Learning strategy for supporting e-portfolios in Higher Education. A practical guidelines framework was developed for best practices, which can be justified by the lack of available frameworks in the e-Learning literature. A…

Two new species of Paurodontella Husain and Khan, 1968 (Nematoda: Sphaerulariidae) associated with wheat and a diagnostic compendium to the genus

USDA-ARS?s Scientific Manuscript database

An identification key to 10 valid species of Paurodontella is given. A compendium of the most important diagnostic characters with illustrations of each species is included as a practical alternative and supplement to the key. The diagnosis of Paurodontella is emended and a list of all valid specie...

Identification and Characterization of Key Human Performance Issues and Research in the Next Generation Air Transportation System (NextGen)

NASA Technical Reports Server (NTRS)

Lee, Paul U.; Sheridan, Tom; Poage, james L.; Martin, Lynne Hazel; Jobe, Kimberly K.

2010-01-01

This report identifies key human-performance-related issues associated with Next Generation Air Transportation System (NextGen) research in the NASA NextGen-Airspace Project. Four Research Focus Areas (RFAs) in the NextGen-Airspace Project - namely Separation Assurance (SA), Airspace Super Density Operations (ASDO), Traffic Flow Management (TFM), and Dynamic Airspace Configuration (DAC) - were examined closely. In the course of the research, it was determined that the identified human performance issues needed to be analyzed in the context of NextGen operations rather than through basic human factors research. The main gaps in human factors research in NextGen were found in the need for accurate identification of key human-systems related issues within the context of specific NextGen concepts and better design of the operational requirements for those concepts. By focusing on human-system related issues for individual concepts, key human performance issues for the four RFAs were identified and described in this report. In addition, mixed equipage airspace with components of two RFAs were characterized to illustrate potential human performance issues that arise from the integration of multiple concepts.

Erectile dysfunction: physiology, causes and patient management.

PubMed

Steggall, Martin J

This article examines the prevalence, causes, identification, assessment and treatment options for men with erectile dysfunction. Erectile dysfunction is thought to affect one in ten men across the UK and is often a consequence of pathology and/or pharmacology. Treatment can be offered to all patients, but the keys to management are identification, accurate assessment and focused therapy. Nurses are well placed to identify and support men who have this distressing problem.

Identification of a key recombinant narrows the CADASIL gene region to 8 cM and argues against allelism of CADASIL and familial hemiplegic migraine

DOE Office of Scientific and Technical Information (OSTI.GOV)

Dichgans, M.; Mayer, M.; Straube, A.

1996-02-15

This article reports on new information regarding the genetic mapping of the human CADASIL gene region. Previously, the gene had been mapped to human chromosome 19q12. Using the identification of a chromosomal crossover, the region has been refined to an 8-cM interval. 11 refs., 2 figs., 1 tab.

[Horizon scanning in preparation for future health threats: a pilot exercise conducted by the French Institute for Public Health Surveillance in 2014].

PubMed

Eilstein, Daniel; Xerri, Bertrand; Viso, Anne-Catherine; Therre, Hélène; Gorza, Maud; Fuchs, Doriane; Pozuelos, Jérôme; Ioos, Sophie; Che, Didier; Bertrand, Edwige; El Yamani, Mounia; Empereur-Bissonnet, Pascal; Duport, Nicolas; Desenclos, Jean-Claude

2016-01-01

Background: Health surveillance is a reactive process, with no real hindsight for dealing with signals and alerts. It may fail to detect more radical changes with a major medium-term or long-term impact on public health. To increase proactivity, the French Institute for Public Health Surveillance has opted for a prospective monitoring approach.Methods: Several steps were necessary: 1) Identification of public health determinants. 2) Identification of key variables based on a combination of determinants. Variables were classified into three groups (health event trigger factors, dissemination factors and response factors) and were submitted to future development assumptions. 3) Identification, in each of the three groups, of micro-scenarios derived from variable trends. 4) Identification of macro-scenarios, each built from the three micro-scenarios for each of the three groups. 5) Identification of issues for the future of public health.Results: The exercise identified 22 key variables, 17 micro-scenarios and 5 macro-scenarios. The topics retained relate to issues on social and territorial health inequalities, health burden, individual and collective responsibilities in terms of health, ethical aspects, emerging phenomena, ‘Big data’, data mining, new health technologies, interlocking of analysis scales.Conclusions: The approach presented here guides the programming of activities of a health safety agency, particularly for monitoring and surveillance. By describing possible future scenarios, health surveillance can help decision-makers to influence the context towards one or more favourable futures.

Supportive care of women with breast cancer: key concerns and practical solutions.

PubMed

Zdenkowski, Nicholas; Tesson, Stephanie; Lombard, Janine; Lovell, Melanie; Hayes, Sandra; Francis, Prudence A; Dhillon, Haryana M; Boyle, Frances M

2016-11-21

Patients diagnosed with breast cancer may have supportive care needs for many years after diagnosis. High quality multidisciplinary care can help address these needs and reduce the physical and psychological effects of breast cancer and its treatment. Ovarian suppression and extended endocrine therapy benefits are associated with vasomotor, musculoskeletal, sexual and bone density-related side effects. Aromatase inhibitor musculoskeletal syndrome is a common reason for treatment discontinuation. Treatment strategies include education, exercise, simple analgesia and a change to tamoxifen or another aromatase inhibitor. Chemotherapy-induced alopecia may be a constant reminder of breast cancer to the patient, family, friends, acquaintances and even strangers. Alopecia can be prevented in some patients using scalp-cooling technology applied at the time of chemotherapy infusion. The adverse impact of breast cancer diagnosis and treatment on sexual wellbeing is under-reported. Identification of physical and psychological impacts is needed for implementation of treatment strategies. Fear of cancer recurrence reduces quality of life and increases distress, with subsequent impact on role functioning. Identification and multidisciplinary management are key, with referral to psychosocial services recommended where indicated. The benefits of exercise include reduced fatigue, better mental health and reduced musculoskeletal symptoms, and may also include reduced incidence of breast cancer recurrence. Identification and management of unmet supportive care needs are key aspects of breast cancer care, to maximise quality of life and minimise breast cancer recurrence.

Complete Hexose Isomer Identification with Mass Spectrometry

NASA Astrophysics Data System (ADS)

Nagy, Gabe; Pohl, Nicola L. B.

2015-04-01

The first analytical method is presented for the identification and absolute configuration determination of all 24 aldohexose and 2-ketohexose isomers, including the D and L enantiomers for allose, altrose, galactose, glucose, gulose, idose, mannose, talose, fructose, psicose, sorbose, and tagatose. Two unique fixed ligand kinetic method combinations were discovered to create significant enough energetic differences to achieve chiral discrimination among all 24 hexoses. Each of these 24 hexoses yields unique ratios of a specific pair of fragment ions that allows for simultaneous determination of identification and absolute configuration. This mass spectrometric-based methodology can be readily employed for accurate identification of any isolated monosaccharide from an unknown biological source. This work provides a key step towards the goal of complete de novo carbohydrate analysis.

Mid-infrared spectroscopy for characterization of Baltic amber (succinite)

NASA Astrophysics Data System (ADS)

Wagner-Wysiecka, Ewa

2018-05-01

Natural Baltic amber (succinite) is the most appreciated fossil resin of the rich cultural traditions dating back to prehistoric times. Its unequivocal identification is extremely important in many branches of science and trades including archeology, paleontology, chemistry and finally mineralogical and gemological societies. Current methods of modification of natural succinite are more and more sophisticated making the identification of natural Baltic amber often challenging. In article the systematic analytical approach for identification of natural and modified under different conditions succinite, using mid-infrared spectroscopy (transmission, Drifts and ATR techniques) is presented. The correlation between spectral characteristics and properties of succinite is discussed pointing that the understanding of the nature of changes is the key of identification of this precious material.

Identification of the key bitter compounds in our daily diet is a prerequisite for the understanding of the hTAS2R gene polymorphisms affecting food choice.

PubMed

Hofmann, Thomas

2009-07-01

In order to decode genetic variations affecting food choice and to determine whether to accept or to reject certain food products, it is a necessary prerequisite to deorphanize the hTAS2R/ligand pairs using the key bitter compounds in foods as stimuli rather than doing this either by using artificial molcules, to which the normal consumer had never been exposed, or by using food-born molecules which do not at all contribute to the overall bitterness. Therefore, the chemical structure of the most active bitter molecules in foods needs to be unequivocally determined in order to be sure that hTAS2R polymorphisms are related to the key molecules which really contribute to the overall bitterness perception of food products. As most studies focused primarily on quantitatively predominating compounds, rather than selecting the target compounds to be identified with regard to taste-activity, it seems that yet unknown components play a key role in evoking the bitter taste of food products. Driven by the need to discover the key players inducing the food taste, the research area "sensomics" made tremendous efforts in recent years to map the sensometabolome and to identify the most intense taste-active metabolites in fresh and processed foods. The present article summarizes recent studies on the identification of orphan key bitter stimuli in fresh, fermented, and thermally processed foods using carrots, cheese, and roasted coffee as examples.

Biology Notes

ERIC Educational Resources Information Center

School Science Review, 1973

1973-01-01

Some helpful ideas are proposed for use by biology teachers. Topics included are Food Webs,'' Key to Identification of Families,'' Viruses,'' Sieve Tube,'' Woodlice,'' Ecology of Oak Leaf Roller Moth,'' and Model Making.'' (PS)

Plant Taxonomy as a Field Study

ERIC Educational Resources Information Center

Dalby, D. H.

1970-01-01

Suggests methods of teaching plant identification and taxonomic theory using keys, statistical analyses, and biometrics. Population variation, genotype- environment interaction and experimental taxonomy are used in laboratory and field. (AL)

Checklist and Simple Identification Key for Frogs and Toads from District IV of The MADA Scheme, Kedah, Malaysia

PubMed Central

Jaafar, Ibrahim; Chai, Teoh Chia; Sah, Shahrul Anuar Mohd; Akil, Mohd Abdul Muin Md.

2009-01-01

A survey was conducted to catalogue the diversity of anurans in District IV of the Muda Agriculture Development Authority Scheme (MADA) in Kedah Darul Aman, Malaysia, from July 1996 to January 1997. Eight species of anurans from three families were present in the study area. Of these, the Common Grass Frog (Fejevarya limnocharis) was the most abundant, followed by Mangrove Frog (Fejevarya cancrivora), Long-legged Frog (Hylarana macrodactyla), and Common Toad (Duttaphrynus melanostictus). Puddle Frog (Occidozyga lima), Taiwanese Giant Frog (Hoplobatrachus rugulosus), and Banded Bullfrog (Kaluola pulchra) were rare during the sampling period, and only one Paddy Frog (Hylarana erythraea) was captured. A simple identification key for the anurans of this area is included for use by scientists and laymen alike. PMID:24575178

Collembola of the genus Protaphorura Absolon, 1901 (Onychiuridae) in the Eastern Palearctic: morphology, distribution, identification key

PubMed Central

Kaprus’, Igor; Weiner, Wanda; Paśnik, Grzegorz

2016-01-01

Abstract Seven new species, Protaphorura jernika sp. n., Protaphorura abscondita sp. n., Protaphorura tuvinica sp. n., Protaphorura vasilinae sp. n., Protaphorura sayanica sp. n., Protaphorura oligopseudocellata sp. n. and Protaphorura nikolai sp. n. from different habitats of the southern Siberia and Far East of Russia, are described. Protaphorura ombrophila (Stach, 1960) is redescribed based on the type specimens. These species differ one from other and from all known species by dorsal and ventral pseudocellar formulae, number of pseudocelli on subcoxae 1 of legs I–III, parapseudocellar formula, chaetotaxy of body, structure of claw, size of postantennal organ and body length. Geographical distribution of all known Protaphorura species of Eastern Palearctic was analysed and an identification key to 50 species was provided. PMID:27853409

Summary of Key Issues Raised in the Technology for Early Awareness of Addiction and Mental Illness (TEAAM-I) Meeting.

PubMed

Baumel, Amit; Baker, Justin; Birnbaum, Michael L; Christensen, Helen; De Choudhury, Munmun; Mohr, David C; Muench, Fred; Schlosser, Danielle; Titov, Nick; Kane, John M

2018-05-01

Technology provides an unparalleled opportunity to remove barriers to earlier identification and engagement in services for mental and addictive disorders by reaching people earlier in the course of illness and providing links to just-in-time, cost-effective interventions. Achieving this opportunity, however, requires stakeholders to challenge underlying assumptions about traditional pathways to mental health care. In this Open Forum, the authors highlight key issues discussed in the Technology for Early Awareness of Addiction and Mental Illness (TEAAM-I) meeting-held October 13-14, 2016, in New York City-that are related to three identified areas in which technology provides important and unique opportunities to advance early identification, increase service engagement, and decrease the duration of untreated mental and addictive disorders.

Reducing time to identification of aerobic bacteria and fastidious micro-organisms in positive blood cultures.

PubMed

Intra, J; Sala, M R; Falbo, R; Cappellini, F; Brambilla, P

2016-12-01

Rapid and early identification of micro-organisms in blood has a key role in the diagnosis of a febrile patient, in particular, in guiding the clinician to define the correct antibiotic therapy. This study presents a simple and very fast method with high performances for identifying bacteria by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS) after only 4 h of incubation. We used early bacterial growth on PolyViteX chocolate agar plates inoculated with five drops of blood-broth medium deposited in the same point and spread with a sterile loop, followed by a direct transfer procedure on MALDI-TOF MS target slides without additional modification. Ninety-nine percentage of aerobic bacteria were correctly identified from 600 monomicrobial-positive blood cultures. This procedure allowed obtaining the correct identification of fastidious pathogens, such as Streptococcus pneumoniae, Neisseria meningitidis and Haemophilus influenzae that need complex nutritional and environmental requirements in order to grow. Compared to the traditional pathogen identification from blood cultures that takes over 24 h, the reliability of results, rapid performance and suitability of this protocol allowed a more rapid administration of optimal antimicrobial treatment in the patients. Bloodstream infections are serious conditions with a high mortality and morbidity rate. Rapid identification of pathogens and appropriate antimicrobial therapy have a key role for successful patient outcome. In this work, we developed a rapid, simplified, accurate, and efficient method, reaching 99 % identification of aerobic bacteria from monomicrobial-positive blood cultures by using early growth on enriched medium, direct transfer to target plate without additional procedures, matrix-assisted laser desorption ionization-time of flight mass spectrometry and SARAMIS database. The application of this protocol allows to anticipate appropriate antibiotic therapy. © 2016 The Society for Applied Microbiology.

Simple Web-based interactive key development software (WEBiKEY) and an example key for Kuruna (Poaceae: Bambusoideae)1

PubMed Central

Attigala, Lakshmi; De Silva, Nuwan I.; Clark, Lynn G.

2016-01-01

Premise of the study: Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. Methods and Results: A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). Conclusions: WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus. PMID:27144109

Fires, A Joint Professional Bulletin for US Field & Air Defense Artillerymen. March-April 2008

DTIC Science & Technology

2008-04-01

actions. However, if the effects synchronization division were not added to the lineup , just the teaming of joint fires division and IO division still...ADAFCO would be the liaison between the two Services who coordinates fires and facilitates track identification thus preventing fratricide. Joint...decisions to be made based on current air users versus planned control measures. Interoperability. Identification is a key feature that enables AC2 nodes

Research on Key Technology and Applications for Internet of Things

NASA Astrophysics Data System (ADS)

Chen, Xian-Yi; Jin, Zhi-Gang

The Internet of Things (IOT) has been paid more and more attention by the academe, industry, and government all over the world. The concept of IOT and the architecture of IOT are discussed. The key technologies of IOT, including Radio Frequency Identification technology, Electronic Product Code technology, and ZigBee technology are analyzed. The framework of digital agriculture application based on IOT is proposed.

Predictors of eyewitness identification decisions from video lineups in England: a field study.

PubMed

Horry, Ruth; Memon, Amina; Wright, Daniel B; Milne, Rebecca

2012-08-01

Eyewitness identification decisions from 1,039 real lineups in England were analysed. Identification procedures have undergone dramatic change in the United Kingdom over recent years. Video lineups are now standard procedure, in which each lineup member is seen sequentially. The whole lineup is seen twice before the witness can make a decision, and the witness can request additional viewings of the lineup. A key aim of this paper was to investigate the association between repeated viewing and eyewitness decisions. Repeated viewing was strongly associated with increased filler identification rates, suggesting that witnesses who requested additional viewings were more willing to guess. In addition, several other factors were associated with lineup outcomes, including the age difference between the suspect and the witness, the type of crime committed, and delay. Overall, the suspect identification rate was 39%, the filler identification rate was 26% and the lineup rejection rate was 35%. (PsycINFO Database Record (c) 2012 APA, all rights reserved).

Dental x-ray image segmentation

NASA Astrophysics Data System (ADS)

Said, Eyad; Fahmy, Gamal F.; Nassar, Diaa; Ammar, Hany

2004-08-01

Law enforcement agencies have been exploiting biometric identifiers for decades as key tools in forensic identification. With the evolution in information technology and the huge volume of cases that need to be investigated by forensic specialists, it has become important to automate forensic identification systems. While, ante mortem (AM) identification, that is identification prior to death, is usually possible through comparison of many biometric identifiers, postmortem (PM) identification, that is identification after death, is impossible using behavioral biometrics (e.g. speech, gait). Moreover, under severe circumstances, such as those encountered in mass disasters (e.g. airplane crashers) or if identification is being attempted more than a couple of weeks postmortem, under such circumstances, most physiological biometrics may not be employed for identification, because of the decay of soft tissues of the body to unidentifiable states. Therefore, a postmortem biometric identifier has to resist the early decay that affects body tissues. Because of their survivability and diversity, the best candidates for postmortem biometric identification are the dental features. In this paper we present an over view about an automated dental identification system for Missing and Unidentified Persons. This dental identification system can be used by both law enforcement and security agencies in both forensic and biometric identification. We will also present techniques for dental segmentation of X-ray images. These techniques address the problem of identifying each individual tooth and how the contours of each tooth are extracted.

Photo interpretation key to Michigan land cover/use

NASA Technical Reports Server (NTRS)

Enslin, W. R.; Hudson, W. D.; Lusch, D. P.

1983-01-01

A set of photo interpretation keys is presented to provide a structured approach to the identification of land cover/use categories as specified in the Michigan Resource Inventory Act. The designated categories are urban and; built up lands; agricultural lands; forest land; nonforested land; water bodies; wetlands; and barren land. The keys were developed for use with medium scale (1:20,000 to 1:24,000) color infrared aerial photography. Although each key is generalized in that it relies only upon the most distinguishing photo characteristics in separating the various land cover/use categories, additional interpretation characteristics, distinguishing features and background material are given.

Voice input/output capabilities at Perception Technology Corporation

NASA Technical Reports Server (NTRS)

Ferber, Leon A.

1977-01-01

Condensed resumes of key company personnel at the Perception Technology Corporation are presented. The staff possesses recognition, speech synthesis, speaker authentication, and language identification. Hardware and software engineers' capabilities are included.

The role of environmental variables in structuring landscape-scale species distributions in seafloor habitats.

PubMed

Kraan, Casper; Aarts, Geert; Van der Meer, Jaap; Piersma, Theunis

2010-06-01

Ongoing statistical sophistication allows a shift from describing species' spatial distributions toward statistically disentangling the possible roles of environmental variables in shaping species distributions. Based on a landscape-scale benthic survey in the Dutch Wadden Sea, we show the merits of spatially explicit generalized estimating equations (GEE). The intertidal macrozoobenthic species, Macoma balthica, Cerastoderma edule, Marenzelleria viridis, Scoloplos armiger, Corophium volutator, and Urothoe poseidonis served as test cases, with median grain-size and inundation time as typical environmental explanatory variables. GEEs outperformed spatially naive generalized linear models (GLMs), and removed much residual spatial structure, indicating the importance of median grain-size and inundation time in shaping landscape-scale species distributions in the intertidal. GEE regression coefficients were smaller than those attained with GLM, and GEE standard errors were larger. The best fitting GEE for each species was used to predict species' density in relation to median grain-size and inundation time. Although no drastic changes were noted compared to previous work that described habitat suitability for benthic fauna in the Wadden Sea, our predictions provided more detailed and unbiased estimates of the determinants of species-environment relationships. We conclude that spatial GEEs offer the necessary methodological advances to further steps toward linking pattern to process.

A gallery of the key characters to ease identification of Dermanyssus gallinae (Acari: Gamasida: Dermanyssidae) and allow differentiation from Ornithonyssus sylviarum (Acari: Gamasida: Macronyssidae).

PubMed

Di Palma, Antonella; Giangaspero, Annunziata; Cafiero, Maria Assunta; Germinara, Giacinto S

2012-05-30

Dermanyssus gallinae (poultry red mite) is a major threat for the poultry industry and is of significant interest for public health. Identification of D. gallinae can be difficult for scientists not familiar with mite morphology and terminology especially when trying to use identification keys. Moreover, this species may easily be confused with another dermanyssoid mite, Ornithonyssus sylviarum (northern fowl mite), which often shares the same hosts and environment. Specimens of D. gallinae were collected at poultry farms in the Puglia and performed for light and scanning electron microscopy observations, identification and micrographs. Moreover specimens of O. sylviarum were collected separately macerated and mounted on slides for light microscopy observations, identification and pictures. The micrographs used in this study, based on LM and SEM observations, highlight the following important identifying characters of D. gallinae: the prominent shoulders of the dorsal shield and the jagged edges of the shield reticulations, the position of setae j1, s1 and the epigynal pores, and the presence on tibia IV pl of one seta. Additional micrographs highlighting the shape of the dorsal (abruptly narrowed posteriorly) and epigynal (narrowly rounded posteriorly) shields and the chelicera (elongate, with distinct digits) of O. sylviarum enable its differentiation from D.gallinae. The photographic support provided here (both LM and SEM pictures) can be considered a practical tool for scientists who are not well acquainted with the morphology of D.gallinae, and who are involved with classical and molecular systematics, veterinary and human health aspects of poultry red mites.

Preparation for an Airport Master Plan for Joint Use Operation at Scott AFB, Illinois.

DTIC Science & Technology

1987-08-01

Airfield and approach lighting b) Air traffic control tower c) Meteorological facilities d) Airport access and service roads e) Utilities f) Public...use, and to comply with all requirements for control of air, water and noise pollution as well as solid waste disposal. Specific conditions would be...Identification of Persons e Identification of Ground Vehicles S• Fencing 0 Gates I * Security Lighting i * Locks and Key Control 9 Critical Areas (Other Than

Research Problems in Developing Giftedness: A Worldwide Perspective.

ERIC Educational Resources Information Center

Passow, A. Harry; Schiff, Jacob H.

1991-01-01

This paper describes world perspectives on gifted education, focusing on definitions, identification procedures, and attitudes. It then examines key areas in gifted education that require further clarification and rigorous examination. (Author/JDD)

Plant-bacterial pathogen interactions mediated by type III effectors.

PubMed

Feng, Feng; Zhou, Jian-Min

2012-08-01

Effectors secreted by the bacterial type III system play a central role in the interaction between Gram-negative bacterial pathogens and their host plants. Recent advances in the effector studies have helped cementing several key concepts concerning bacterial pathogenesis, plant immunity, and plant-pathogen co-evolution. Type III effectors use a variety of biochemical mechanisms to target specific host proteins or DNA for pathogenesis. The identifications of their host targets led to the identification of novel components of plant innate immune system. Key modules of plant immune signaling pathways such as immune receptor complexes and MAPK cascades have emerged as a major battle ground for host-pathogen adaptation. These modules are attacked by multiple type III effectors, and some components of these modules have evolved to actively sense the effectors and trigger immunity. Copyright © 2012 Elsevier Ltd. All rights reserved.

A new species of Cacatuocotyle (Monogenea, Dactylogyridae) parasitizing Astyanax spp. (Characiformes, Characidae) from Brazil, including molecular data and a key to species identification.

PubMed

Zago, Aline Cristina; Franceschini, Lidiane; Müller, Maria Isabel; Silva, Reinaldo José da

2018-06-26

The present study describes Cacatuocotyle papilionis n. sp. (Monogenea, Dactylogyridae) from the skin of the characid fishes Astyanax lacustris (Lütken, 1875) (=Astyanax altiparanae Garutti & Britski, 2000) and Astyanax fasciatus (Cuvier, 1819) (Characiformes, Characidae) from the Southeast of Brazil, supported by morphological and molecular data. The new species differs from all congeners, mainly due to the morphology of the ventral bar (resembling a butterfly), accessory piece, and the number of rings of the male copulatory organ (MCO), comprising a coiled tube with 4.5-5.5 counterclockwise rings. The first molecular data for this monogenean genus is provided in this study, using the partial sequences of the ribosomal gene (28S), as well as providing an identification key to the species.

New Genus and species of Heteroxyidae from Brazil (Axinellida: Demospongiae: Porifera), with a revised identification key for the family.

PubMed

Santos, George Garcia; Pinheiro, Ulisses; Hajdu, Eduardo; Soest, Rob Van

2016-08-26

Alveospongia sinuosclera gen. nov. sp. nov. is described from shallow-waters off Canavieiras (Bahia, Brazil). The species bears an unusual morphology, combining saccular or alveolar, evenly perforated habit, and sinuous spiny microrhabdose microscleres. This sponge is tentatively classified within the Heteroxyidae Dendy (1905), on the basis of its confused choanosomal architecture of styles, and possession of spiny microrhabdose microscleres. Assays to generate DNA sequences from this material were unsuccessful. We emended the diagnosis of the family to include species bearing saccular/alveolar shape, microrhabdose acanthomicrostrongyles and styles/strongyles with modifications at the ends. The proposed new genus is compared to the remaining heteroxyid genera, as well as Crella (Crellidae), Batzella (Chondropsidae), Goreauiella (Astroscleridae) and Sceptrintus (Podospongiidae). A revised key for identification of Heteroxyidae genera is provided.

Review of Marmasoma White with lectotype designation of M. sumptuosum White and an identification key to the Australasian/Oceanian genera of Ecliminae (Diptera, Bombyliidae).

PubMed

Rodrigues, Paula Fernanda Motta; McAlister, Erica; Lamas, Carlos José Einicker

2017-02-15

The bombyliid genus Marmasoma White is restricted to Australia. Marmasoma sumptuosum White, the only known species of the genus, is studied and a lectotype and paralectotypes are designated. Based on the type series and on additional material, a redescription of the species is presented and the main characters of the external morphology of adults are illustrated and photographed, including male and female genitalia. In addition, the remarkable aedeagus of M. sumptuosum, unique among all Ecliminae species by the presence of serrated projections on its apical portion, is described and photographed in detail for the first time. An identification key to the Australasian/Oceanian genera of Ecliminae and a distribution map with the known geographic records of Marmasoma are also included.

Revision of the new world genus Crassomicrodus Ashmead (Hymenoptera, Braconidae, Agathidinae), with an identification key to species

PubMed Central

Figueroa, José Isaac; Sharkey, Michael Joseph; Nápoles, Jesus Romero; García, José Antonio Sánchez; Martínez, Ana Mabel; López-Martínez, Victor; Pineda, Samuel

2011-01-01

Abstract A key to species and descriptions are presented for 14 species of the New World genus Crassomicrodus Ashmead. Seven new species, Crassomicrodus azteca, Crassomicrodus clypealis, Crassomicrodus costaricensis, Crassomicrodus jalisciensis, Crassomicrodus mariae, Crassomicrodus oaxaquensis,and Crassomicrodus olgae are described. Crassomicrodus fenestratus (Viereck) is synonymized with Crassomicrodus nigriceps (Cresson). Crassomicrodus melanopleurus (Ashmead) is recognized as a valid species. PMID:22144862

Effectiveness of Key Knowledge Spreader Identification in Online Communities of Practice: A Simulation Study from Network Perspective

ERIC Educational Resources Information Center

Cao, Yu

2017-01-01

With the rapid development of online communities of practice (CoPs), how to identify key knowledge spreader (KKS) in online CoPs has grown up to be a hot issue. In this paper, we construct a network with variable clustering based on Holme-Kim model to represent CoPs, a simple dynamics of knowledge sharing is considered. Kendall's Tau coefficient…

Description of the larva and pupa of Phileurus truncatus (Palisot de Beauvois, 1806) (Coleoptera: Scarabaeidae: Dynastinae: Phileurini) with a key to described third instars of New World Phileurini.

PubMed

Arguez, Katherine M; Moore, Matthew R; Branham, Marc A

2017-12-10

The third instar and pupa of Phileurus truncatus (Palisot de Beauvois, 1806) (Coleoptera: Scarabaeidae: Dynastinae: Phileurini) is described for the first time based on specimens from Florida, United States of America. An identification key to the third instars of New World Phileurini is also provided.

The Struggle for Comprehensive Education in the Netherlands: The Representation of Secondary School Innovation in Dutch Newspaper Articles in the 1970s

ERIC Educational Resources Information Center

Amsing, Hilda T. A.; Greveling, Linda; Dekker, Jeroen J. H.

2013-01-01

This article focuses on how Dutch newspapers represented the debate in the Netherlands in the 1970s on comprehensive education and thus influenced the Dutch Middle School experiment. Wiborg's identification of key factors of success in Scandinavia was used as a point of reference. The article shows that these key factors did not exist in the…

Efficient biometric authenticated key agreements based on extended chaotic maps for telecare medicine information systems.

PubMed

Lou, Der-Chyuan; Lee, Tian-Fu; Lin, Tsung-Hung

2015-05-01

Authenticated key agreements for telecare medicine information systems provide patients, doctors, nurses and health visitors with accessing medical information systems and getting remote services efficiently and conveniently through an open network. In order to have higher security, many authenticated key agreement schemes appended biometric keys to realize identification except for using passwords and smartcards. Due to too many transmissions and computational costs, these authenticated key agreement schemes are inefficient in communication and computation. This investigation develops two secure and efficient authenticated key agreement schemes for telecare medicine information systems by using biometric key and extended chaotic maps. One scheme is synchronization-based, while the other nonce-based. Compared to related approaches, the proposed schemes not only retain the same security properties with previous schemes, but also provide users with privacy protection and have fewer transmissions and lower computational cost.

31 CFR 537.523 - Authorization of nongovernmental organizations to engage in humanitarian or religious activities.

Code of Federal Regulations, 2011 CFR

2011-07-01

...) Identification of key staff, such as directors and senior officers, at the organization's headquarters and... of income, such as official grants, private endowments, commercial activities; (7) Financial...

31 CFR 537.523 - Authorization of nongovernmental organizations to engage in humanitarian or religious activities.

Code of Federal Regulations, 2013 CFR

2013-07-01

...) Identification of key staff, such as directors and senior officers, at the organization's headquarters and... of income, such as official grants, private endowments, commercial activities; (7) Financial...

31 CFR 537.523 - Authorization of nongovernmental organizations to engage in humanitarian or religious activities.

Code of Federal Regulations, 2012 CFR

2012-07-01

...) Identification of key staff, such as directors and senior officers, at the organization's headquarters and... of income, such as official grants, private endowments, commercial activities; (7) Financial...

The Moss Fauna 1: Tardigrades.

ERIC Educational Resources Information Center

Kinchin, Ian M.

1987-01-01

Describes the Tardigrada as a group of animals suitable for close study in project work. Gives reasons for their suitability and an illustrated identification key. Discusses possible investigations into the ecology and physiology of tardigrades. (Author/CW)

Reptiles.

ERIC Educational Resources Information Center

Naturescope, 1987

1987-01-01

Describes some of the characteristics of various reptiles. Contains teaching activities including making reptile number books and identification keys, flip-ups about cobras, puzzles involving graphing, and group presentations. Includes reproducible handouts to be used with some of the activities. (TW)

Guide to the identification of fish protozoan and metazoan parasites in stained tissue sections

USGS Publications Warehouse

Bruno, D.W.; Nowak, B.; Elliott, D.G.

2006-01-01

The identification of protozoan and metazoan parasites is traditionally carried out using a series of classical keys based upon the morphology of the whole organism. However, in stained tissue sections prepared for light microscopy, taxonomic features will be missing, thus making parasite identification difficult. This work highlights the characteristic features of representative parasites in tissue sections to aid identification. The parasite examples discussed are derived from species affecting finfish, and predominantly include parasites associated with disease or those commonly observed as incidental findings in disease diagnostic cases. Emphasis is on protozoan and small metazoan parasites (such as Myxosporidia) because these are the organisms most likely to be missed or mis-diagnosed during gross examination. Figures are presented in colour to assist biologists and veterinarians who are required to assess host/parasite interactions by light microscopy.

Improving identification of traumatic brain injury after nonmilitary bomb blasts.

PubMed

Rutland-Brown, Wesley; Langlois, Jean A; Bazarian, Jeffrey J; Warden, Deborah

2008-01-01

To improve identification of traumatic brain injury (TBI) in survivors of nonmilitary bomb blasts during the acute care phase. The Centers for Disease Control and Prevention convened a meeting of experts in TBI, emergency medicine, and disaster response to review the recent literature and make recommendations. Seven key recommendations were proposed: (1) increase TBI awareness among medical professionals; (2) encourage use of standard definitions and consistent terminology; (3) improve screening methods for TBI in the acute care setting; (4) clarify the distinction between TBI and acute stress disorder; (5) encourage routine screening of hospitalized trauma patients for TBI; (6) improve identification of nonhospitalized TBI patients; and (7) integrate the appropriate level of TBI identification into all-hazards mass casualty preparedness. By adopting these recommendations, the United States could be better prepared to identify and respond to TBI following future bombing events.

Risk assessment, genetic counseling, and clinical care for hereditary breast cancer.

PubMed

Powers, Jacquelyn; Stopfer, Jill Elise

2014-01-01

During the last 30 years, key advances in the field of cancer genetics have improved identification of high-risk families in which cancer risk can be linked to mutations in cancer susceptible genes. Identification of individuals with heritable cancer risk may influence short- and long-term medical management issues. Heightened screening and risk reducing options can offer lifesaving interventions for the woman and family members who are at risk. © 2014 AWHONN, the Association of Women's Health, Obstetric and Neonatal Nurses.

Research on gait-based human identification

NASA Astrophysics Data System (ADS)

Li, Youguo

Gait recognition refers to automatic identification of individual based on his/her style of walking. This paper proposes a gait recognition method based on Continuous Hidden Markov Model with Mixture of Gaussians(G-CHMM). First, we initialize a Gaussian mix model for training image sequence with K-means algorithm, then train the HMM parameters using a Baum-Welch algorithm. These gait feature sequences can be trained and obtain a Continuous HMM for every person, therefore, the 7 key frames and the obtained HMM can represent each person's gait sequence. Finally, the recognition is achieved by Front algorithm. The experiments made on CASIA gait databases obtain comparatively high correction identification ratio and comparatively strong robustness for variety of bodily angle.

Identification and characteristics of vulnerable adults attending an inner city sexual health service.

PubMed

Sullivan, Verity; Cheserem, Emily; Milne, Cliodhna; Hopkins, Marina; Lock, Eleanor; Hamlyn, Elizabeth

2015-10-01

Adult safeguarding is the function of protecting vulnerable adults from abuse or neglect. The 2012 Department of Health Draft Care and Support Bill highlighted adult safeguarding as a key government priority and stated that a clear framework is required for organisations dealing with 'adults at risk'. Adults at risk present to sexual health services but no formal guidance currently exists to aid their identification and management in this setting. We conducted a retrospective case note review which identified that vulnerable adults attend our service. They may display recognised risk factors, awareness of which is likely to facilitate identification and assessment of this group and aid appropriate onward referral. © The Author(s) 2015.

Subpathway-GM: identification of metabolic subpathways via joint power of interesting genes and metabolites and their topologies within pathways.

PubMed

Li, Chunquan; Han, Junwei; Yao, Qianlan; Zou, Chendan; Xu, Yanjun; Zhang, Chunlong; Shang, Desi; Zhou, Lingyun; Zou, Chaoxia; Sun, Zeguo; Li, Jing; Zhang, Yunpeng; Yang, Haixiu; Gao, Xu; Li, Xia

2013-05-01

Various 'omics' technologies, including microarrays and gas chromatography mass spectrometry, can be used to identify hundreds of interesting genes, proteins and metabolites, such as differential genes, proteins and metabolites associated with diseases. Identifying metabolic pathways has become an invaluable aid to understanding the genes and metabolites associated with studying conditions. However, the classical methods used to identify pathways fail to accurately consider joint power of interesting gene/metabolite and the key regions impacted by them within metabolic pathways. In this study, we propose a powerful analytical method referred to as Subpathway-GM for the identification of metabolic subpathways. This provides a more accurate level of pathway analysis by integrating information from genes and metabolites, and their positions and cascade regions within the given pathway. We analyzed two colorectal cancer and one metastatic prostate cancer data sets and demonstrated that Subpathway-GM was able to identify disease-relevant subpathways whose corresponding entire pathways might be ignored using classical entire pathway identification methods. Further analysis indicated that the power of a joint genes/metabolites and subpathway strategy based on their topologies may play a key role in reliably recalling disease-relevant subpathways and finding novel subpathways.

Working Memory and Speech Comprehension in Older Adults With Hearing Impairment.

PubMed

Nagaraj, Naveen K

2017-10-17

This study examined the relationship between working memory (WM) and speech comprehension in older adults with hearing impairment (HI). It was hypothesized that WM would explain significant variance in speech comprehension measured in multitalker babble (MTB). Twenty-four older (59-73 years) adults with sensorineural HI participated. WM capacity (WMC) was measured using 3 complex span tasks. Speech comprehension was assessed using multiple passages, and speech identification ability was measured using recall of sentence final-word and key words. Speech measures were performed in quiet and in the presence of MTB at + 5 dB signal-to-noise ratio. Results suggested that participants' speech identification was poorer in MTB, but their ability to comprehend discourse in MTB was at least as good as in quiet. WMC did not explain significant variance in speech comprehension before and after controlling for age and audibility. However, WMC explained significant variance in low-context sentence key words identification in MTB. These results suggest that WMC plays an important role in identifying low-context sentences in MTB, but not when comprehending semantically rich discourse passages. In general, data did not support individual variability in WMC as a factor that predicts speech comprehension ability in older adults with HI.

Diptera of forensic importance in the Iberian Peninsula: larval identification key.

PubMed

Velásquez, Y; Magaña, C; Martínez-Sánchez, A; Rojo, S

2010-09-01

A revision of the species and families of sarcosaprophagous flies (Diptera: Calliphoridae, Sarcophagidae, Muscidae, Fanniidae, Drosophilidae, Phoridae, Piophilidae and Stratiomyidae) suitable for forensic purposes in the Iberian Peninsula is presented. Morphological characteristics that allow the accurate identification of third instars of the species present in the Iberian Peninsula are described and presented in the form of a diagnostic key. For larval Calliphoridae, characteristics such as the spines of the body segments were useful for the genus Calliphora whereas features of the anal segment and the cephalopharyngeal skeleton were useful for larvae of Lucilia. Identification of three Chrysominae species present in the Iberian Peninsula is included. For larval Sarcophagidae, characters such as the arrangement and shape of spiracular openings, structures of the anal segment and the cephalopharyngeal skeleton were used for the first time. A new record of Sarcophaga cultellata Pandellé, from a human corpse, is also included as well as recent incursions into the European cadaveric entomofauna such as Synthesiomyia nudiseta (van der Wulp) and Hermetia illucens (Linnaeus). This work provides useful new information that could be applied to forensic investigations in the Iberian Peninsula and in southern Europe.

The role of automated feedback in training and retaining biological recorders for citizen science.

PubMed

van der Wal, René; Sharma, Nirwan; Mellish, Chris; Robinson, Annie; Siddharthan, Advaith

2016-06-01

The rapid rise of citizen science, with lay people forming often extensive biodiversity sensor networks, is seen as a solution to the mismatch between data demand and supply while simultaneously engaging citizens with environmental topics. However, citizen science recording schemes require careful consideration of how to motivate, train, and retain volunteers. We evaluated a novel computing science framework that allowed for the automated generation of feedback to citizen scientists using natural language generation (NLG) technology. We worked with a photo-based citizen science program in which users also volunteer species identification aided by an online key. Feedback is provided after photo (and identification) submission and is aimed to improve volunteer species identification skills and to enhance volunteer experience and retention. To assess the utility of NLG feedback, we conducted two experiments with novices to assess short-term (single session) and longer-term (5 sessions in 2 months) learning, respectively. Participants identified a specimen in a series of photos. One group received only the correct answer after each identification, and the other group received the correct answer and NLG feedback explaining reasons for misidentification and highlighting key features that facilitate correct identification. We then developed an identification training tool with NLG feedback as part of the citizen science program BeeWatch and analyzed learning by users. Finally, we implemented NLG feedback in the live program and evaluated this by randomly allocating all BeeWatch users to treatment groups that received different types of feedback upon identification submission. After 6 months separate surveys were sent out to assess whether views on the citizen science program and its feedback differed among the groups. Identification accuracy and retention of novices were higher for those who received automated feedback than for those who received only confirmation of the correct identification without explanation. The value of NLG feedback in the live program, captured through questionnaires and evaluation of the online photo-based training tool, likewise showed that the automated generation of informative feedback fostered learning and volunteer engagement and thus paves the way for productive and long-lived citizen science projects. © 2016 The Authors. Conservation Biology published by Wiley Periodicals, Inc. on behalf of Society for Conservation Biology.

The status of parametric studies in radar agriculture

NASA Technical Reports Server (NTRS)

Morain, S. A.

1972-01-01

Outlined is an information system based on the use of remote sensor data and the design, testing, and implementation of interpretation keys for agriculture. The task of crop identification from radar imagery emphasizes dichotomous keys and the effects of frequency, angular and other microwave dependencies of crops for use in discrimination. A mosaic is formulated from imagery and used to study acres in wheat for spread of circular irrigation, spread of crops, and other phenomena.

A Study of the Factors Affecting Productivity at the Naval Air Rework Facilities.

DTIC Science & Technology

1981-06-01

employee satisfaction and job identification, 6 -* - -- - key aspects of worklife to focus on and control according to Mikalachki. He contends that...levels is considered the key to quality of worklife improvement (10,73-74). Herzberg asserted that people are motivated by re- sponsibility and...34Productivity Gains Through Worklife Improvement," Personnel, January-February 1980, pp. 71-74. 11. Hendrix, W. H. and Halverson, V. B. "Organizational

Description of a new species of Coelosis Hope from Guajira Peninsula, northern Colombia (Coleoptera, Scarabaeidae, Dynastinae, Oryctini)

PubMed Central

Neita-Moreno, Jhon César; Orozco, Jesús; Medina-Uribe, Claudia Alejandra

2018-01-01

Abstract A new species of Coelosis is described from the Macuira Mountains, Guajira Peninsula, northern Colombia. A character comparison between this new and other previously known Colombian species in the genus is presented. A key for the identification and distributional map for Colombian species of Coelosis is provided, as well as a key for the genera included in the tribe Oryctini in Colombia. PMID:29670422

Key for European species of the Cheilosia proxima group (Diptera, Syrphidae) with a description of a new species

PubMed Central

Vujić, Ante; Radenković, Snežana; Trifunov, Sonja; Nikolić, Tijana

2013-01-01

Abstract A new hoverfly species, Cheilosia barbafacies Vujić & Radenković sp. n. (Diptera, Syrphidae), is described and distinguished from the closely related species Cheilosia pascuorum Becker, 1894, based on material collected from the mountains of the Balkan Peninsula. Diagnostic characteristics and an identification key for the members of the proxima group of Cheilosia s. str., including the new taxon, are provided. PMID:23653524

Key Issues in the Networking Field Today. Proceedings of the Library of Congress Network Advisory Committee Meeting (Washington, DC, May 6-8, 1985). Network Planning Paper No. 12.

ERIC Educational Resources Information Center

Library of Congress, Washington, DC. Network Development Office.

The May 1985 program session of the Library of Congress Network Advisory Committee focused on the identification of key issues in the networking field. Presentations included discussions of major network developments in the last two decades, the changing network players, the impact of technology on networks, and library networks and the law. The…

Encryption key distribution via chaos synchronization

NASA Astrophysics Data System (ADS)

Keuninckx, Lars; Soriano, Miguel C.; Fischer, Ingo; Mirasso, Claudio R.; Nguimdo, Romain M.; van der Sande, Guy

2017-02-01

We present a novel encryption scheme, wherein an encryption key is generated by two distant complex nonlinear units, forced into synchronization by a chaotic driver. The concept is sufficiently generic to be implemented on either photonic, optoelectronic or electronic platforms. The method for generating the key bitstream from the chaotic signals is reconfigurable. Although derived from a deterministic process, the obtained bit series fulfill the randomness conditions as defined by the National Institute of Standards test suite. We demonstrate the feasibility of our concept on an electronic delay oscillator circuit and test the robustness against attacks using a state-of-the-art system identification method.

Comparison of genetic and visual identification of cisco and lake whitefish larvae from Chaumont Bay, Lake Ontario

USGS Publications Warehouse

George, Ellen M.; Hare, Matthew P.; Crabtree, Darran L.; Lantry, Brian F.; Rudstam, Lars G.

2017-01-01

Cisco Coregonus artedi are an important component of native food webs in the Great Lakes, and their restoration is instrumental to the recovery of lake trout Salvelinus namaycush and Atlantic salmon Salmo salar. Difficulties with visual identification of larvae can confound early life history surveys, as cisco are often difficult to distinguish from lake whitefish C. clupeaformis. We compared traditional visual species identification methods to genetic identifications based on barcoding of the mitochondrial cytochrome C oxidase I gene for 726 coregonine larvae caught in Chaumont Bay, Lake Ontario. We found little agreement between the visual characteristics of cisco identified by genetic barcoding and the most widely used dichotomous key, and the considerable overlap in ranges of traditionally utilized metrics suggest that visual identification of coregonine larvae from Chaumont Bay is impractical. Coregonines are highly variable and plastic species, and often display wide variations in morphometric characteristics across their broad range. This study highlights the importance of developing accurate, geographically appropriate larval identification methods in order to best inform cisco restoration and management efforts.

Conflicted Identification in the Sex Education Classroom: Balancing Professional Values With Organizational Mandates.

PubMed

Williams, Elizabeth A; Jensen, Robin E

2016-09-01

Despite enormous resources spent on sex education, the United States faces an epidemic of unplanned pregnancy and sexually transmitted infections among young people. Little research has examined the role sex educators play in alleviating or exacerbating this problem. In this study, we interviewed 50 sex educators employed by public schools throughout a Midwestern, U.S. state about their experiences in the sex education classroom. Twenty-two interviewees communicated feelings of conflicted identification and provided examples of the ways in which they experienced this subjectivity in the context of their employment. We find these interviews shed light on the as-yet-understudied communicative experience of conflicted identification by delineating key sources of such conflict and discursive strategies used in its negotiation. Our results suggest that those who experience conflicted identification and who have a sense of multiple or nested identifications within their overarching professional identity may be safeguarded to some extent from eventual organizational disidentification. © The Author(s) 2015.

Metabolite identification through multiple kernel learning on fragmentation trees.

PubMed

Shen, Huibin; Dührkop, Kai; Böcker, Sebastian; Rousu, Juho

2014-06-15

Metabolite identification from tandem mass spectrometric data is a key task in metabolomics. Various computational methods have been proposed for the identification of metabolites from tandem mass spectra. Fragmentation tree methods explore the space of possible ways in which the metabolite can fragment, and base the metabolite identification on scoring of these fragmentation trees. Machine learning methods have been used to map mass spectra to molecular fingerprints; predicted fingerprints, in turn, can be used to score candidate molecular structures. Here, we combine fragmentation tree computations with kernel-based machine learning to predict molecular fingerprints and identify molecular structures. We introduce a family of kernels capturing the similarity of fragmentation trees, and combine these kernels using recently proposed multiple kernel learning approaches. Experiments on two large reference datasets show that the new methods significantly improve molecular fingerprint prediction accuracy. These improvements result in better metabolite identification, doubling the number of metabolites ranked at the top position of the candidates list. © The Author 2014. Published by Oxford University Press.

Improving substructure identification accuracy of shear structures using virtual control system

NASA Astrophysics Data System (ADS)

Zhang, Dongyu; Yang, Yang; Wang, Tingqiang; Li, Hui

2018-02-01

Substructure identification is a powerful tool to identify the parameters of a complex structure. Previously, the authors developed an inductive substructure identification method for shear structures. The identification error analysis showed that the identification accuracy of this method is significantly influenced by the magnitudes of two key structural responses near a certain frequency; if these responses are unfavorable, the method cannot provide accurate estimation results. In this paper, a novel method is proposed to improve the substructure identification accuracy by introducing a virtual control system (VCS) into the structure. A virtual control system is a self-balanced system, which consists of some control devices and a set of self-balanced forces. The self-balanced forces counterbalance the forces that the control devices apply on the structure. The control devices are combined with the structure to form a controlled structure used to replace the original structure in the substructure identification; and the self-balance forces are treated as known external excitations to the controlled structure. By optimally tuning the VCS’s parameters, the dynamic characteristics of the controlled structure can be changed such that the original structural responses become more favorable for the substructure identification and, thus, the identification accuracy is improved. A numerical example of 6-story shear structure is utilized to verify the effectiveness of the VCS based controlled substructure identification method. Finally, shake table tests are conducted on a 3-story structural model to verify the efficacy of the VCS to enhance the identification accuracy of the structural parameters.

Identification of crew-systems interactions and decision related trends

DOT National Transportation Integrated Search

2013-05-01

National Aeronautics and Space Administration (NASA) Vehicle System Safety Technology (VSST) project management uses systems analysis to identify key issues and maintain a portfolio of research leading to potential solutions to its three identified t...

An annotated key to the identification of commonly occurring and dominant genera of algae observed in the phytoplankton of the United States

USGS Publications Warehouse

Greeson, Phillip E.

1982-01-01

In early 1979, a retrieval was made for all phytoplankton data contained in the computerized data file of the U. S. Geological Survey. The retrieval revealed the analytical results of 17,959 samples collected and processed between October 1973 and October 1978. Of the approximately 500 genera of freshwater algae reported in the United States, the U.S. Geological Survey observed 321 genera in the phytoplankton. Fifty-two genera were considered to be commonly occurring and 42 genera were considered to be community dominants. The report lists, describes, and provides a detailed taxonomic key to the identification of 58 genera of algae considered either commonly occurring or dominant. Also included is a summary of environmental conditions under which each algal genus was observed, as well as a glossary and an extensive list of selected references.

Adoptive regulatory T cell therapy: challenges in clinical transplantation.

PubMed

Safinia, Niloufar; Sagoo, Pervinder; Lechler, Robert; Lombardi, Giovanna

2010-08-01

The identification and characterisation of regulatory T cells (Tregs) has recently opened up exciting opportunities for Treg cell therapy in transplantation. In this review, we outline the basic biology of Tregs and discuss recent advances and challenges for the identification, isolation and expansion of these cells for cell therapy. Tregs of thymic origin have been shown to be key regulators of immune responses in mice and humans, preventing autoimmunity, graft-versus-host disease and organ graft rejection in the transplantation setting. To date, a variety of different methods to isolate and expand Tregs ex vivo have been advocated. Although promising, relatively few clinical trials of human Treg cell infusion have been initiated. Many key questions about Treg cell therapy still remain and here we provide an in-depth analysis and highlight the challenges and opportunities for immune intervention with Treg-based therapeutics in clinical transplantation.

Scientific Uncertainties in Climate Change Detection and Attribution Studies

NASA Astrophysics Data System (ADS)

Santer, B. D.

2017-12-01

It has been claimed that the treatment and discussion of key uncertainties in climate science is "confined to hushed sidebar conversations at scientific conferences". This claim is demonstrably incorrect. Climate change detection and attribution studies routinely consider key uncertainties in observational climate data, as well as uncertainties in model-based estimates of natural variability and the "fingerprints" in response to different external forcings. The goal is to determine whether such uncertainties preclude robust identification of a human-caused climate change fingerprint. It is also routine to investigate the impact of applying different fingerprint identification strategies, and to assess how detection and attribution results are impacted by differences in the ability of current models to capture important aspects of present-day climate. The exploration of the uncertainties mentioned above will be illustrated using examples from detection and attribution studies with atmospheric temperature and moisture.

Taxonomy of the ant genus Proceratium Roger (Hymenoptera, Formicidae) in the Afrotropical region with a revision of the P.arnoldi clade and description of four new species.

PubMed

Hita Garcia, Francisco; Hawkes, Peter G; Alpert, Gary D

2014-01-01

The taxonomy of the genus Proceratium Roger is updated for the Afrotropical region. We give an overview of the genus in the region, provide an illustrated identification key to the three clades (Proceratiumarnoldi, Proceratiumstictum and Proceratiumtoschii clades) and revise the Proceratiumarnoldi clade. Four new species from the Proceratiumarnoldi clade are described as new: Proceratiumsokoke sp. n. from Kenya, Proceratiumcarri sp. n. from Mozambique, and Proceratiumnilo sp. n. and Proceratiumsali sp. n. from Tanzania. In order to integrate the new species into the existing taxonomic system we present an illustrated identification key to distinguish the seven Afrotropical species of the Proceratiumarnoldi clade. In addition, we provide accounts for all members of the Proceratiumarnoldi clade including detailed descriptions, diagnoses, taxonomic discussions, distribution data and high quality montage images.

Taxonomy of the ant genus Proceratium Roger (Hymenoptera, Formicidae) in the Afrotropical region with a revision of the P. arnoldi clade and description of four new species

PubMed Central

Hita Garcia, Francisco; Hawkes, Peter G.; Alpert, Gary D.

2014-01-01

Abstract The taxonomy of the genus Proceratium Roger is updated for the Afrotropical region. We give an overview of the genus in the region, provide an illustrated identification key to the three clades (Proceratium arnoldi, Proceratium stictum and Proceratium toschii clades) and revise the Proceratium arnoldi clade. Four new species from the Proceratium arnoldi clade are described as new: Proceratium sokoke sp. n. from Kenya, Proceratium carri sp. n. from Mozambique, and Proceratium nilo sp. n. and Proceratium sali sp. n. from Tanzania. In order to integrate the new species into the existing taxonomic system we present an illustrated identification key to distinguish the seven Afrotropical species of the Proceratium arnoldi clade. In addition, we provide accounts for all members of the Proceratium arnoldi clade including detailed descriptions, diagnoses, taxonomic discussions, distribution data and high quality montage images. PMID:25349516

Redescription of Liza bandialensis (Teleostei: Mugilidae) with an identification key to mullet species of Eastern Central Atlantic.

PubMed

Trape, Sébastien; Harrison, Ian J; Diouf, Papa Samba; Durand, Jean-Dominique

2012-02-01

Liza bandialensis Diouf 1991 is redescribed because previous descriptions have not been in well-distributed publications and have lacked sufficient detail or reference to voucher specimens. The description provided here is based on specimens from the Sine Saloum estuary, Senegal (West Africa), from where the species was originally described. The distinctness of the species is confirmed both by meristic and molecular criteria. L. bandialensis presents a unique combination of characters with a low number of scales in the longitudinal series (32-33), 10.5-12 transverse scale rows, and distinctly yellowish dorsal, anal, and caudal fins. The currently known distribution of L. bandialensis includes coastal waters of Senegal, Gambia and Guinea Bissau. Finally, we provide a morphological identification key for the sixteen species of Mugilidae species occurring along the eastern central Atlantic coast of Africa. Copyright © 2011 Académie des sciences. All rights reserved.

Identification of Neurodegenerative Factors Using Translatome-Regulatory Network Analysis

PubMed Central

Brichta, Lars; Shin, William; Jackson-Lewis, Vernice; Blesa, Javier; Yap, Ee-Lynn; Walker, Zachary; Zhang, Jack; Roussarie, Jean-Pierre; Alvarez, Mariano J.; Califano, Andrea; Przedborski, Serge; Greengard, Paul

2016-01-01

For degenerative disorders of the central nervous system, the major obstacle to therapeutic advancement has been the challenge of identifying the key molecular mechanisms underlying neuronal loss. We developed a combinatorial approach including translational profiling and brain regulatory network analysis to search for key determinants of neuronal survival or death. Following the generation of transgenic mice for cell type-specific profiling of midbrain dopaminergic neurons, we established and compared translatome libraries reflecting the molecular signature of these cells at baseline or under degenerative stress. Analysis of these libraries by interrogating a context-specific brain regulatory network led to the identification of a repertoire of intrinsic upstream regulators that drive the dopaminergic stress response. The altered activity of these regulators was not associated with changes in their expression levels. This strategy can be generalized for the elucidation of novel molecular determinants involved in the degeneration of other classes of neurons. PMID:26214373

Conservation genetics and genomics of amphibians and reptiles.

PubMed

Shaffer, H Bradley; Gidiş, Müge; McCartney-Melstad, Evan; Neal, Kevin M; Oyamaguchi, Hilton M; Tellez, Marisa; Toffelmier, Erin M

2015-01-01

Amphibians and reptiles as a group are often secretive, reach their greatest diversity often in remote tropical regions, and contain some of the most endangered groups of organisms on earth. Particularly in the past decade, genetics and genomics have been instrumental in the conservation biology of these cryptic vertebrates, enabling work ranging from the identification of populations subject to trade and exploitation, to the identification of cryptic lineages harboring critical genetic variation, to the analysis of genes controlling key life history traits. In this review, we highlight some of the most important ways that genetic analyses have brought new insights to the conservation of amphibians and reptiles. Although genomics has only recently emerged as part of this conservation tool kit, several large-scale data sources, including full genomes, expressed sequence tags, and transcriptomes, are providing new opportunities to identify key genes, quantify landscape effects, and manage captive breeding stocks of at-risk species.

Deglycosylation systematically improves N-glycoprotein identification in liquid chromatography-tandem mass spectrometry proteomics for analysis of cell wall stress responses in Saccharomyces cerevisiae lacking Alg3p.

PubMed

Bailey, Ulla-Maja; Schulz, Benjamin L

2013-04-01

Post-translational modification of proteins with glycosylation is of key importance in many biological systems in eukaryotes, influencing fundamental biological processes and regulating protein function. Changes in glycosylation are therefore of interest in understanding these processes and are also useful as clinical biomarkers of disease. The presence of glycosylation can also inhibit protease digestion and lower the quality and confidence of protein identification by mass spectrometry. While deglycosylation can improve the efficiency of subsequent protease digest and increase protein coverage, this step is often excluded from proteomic workflows. Here, we performed a systematic analysis that showed that deglycosylation with peptide-N-glycosidase F (PNGase F) prior to protease digestion with AspN or trypsin improved the quality of identification of the yeast cell wall proteome. The improvement in the confidence of identification of glycoproteins following PNGase F deglycosylation correlated with a higher density of glycosylation sites. Optimal identification across the proteome was achieved with PNGase F deglycosylation and complementary proteolysis with either AspN or trypsin. We used this combination of deglycosylation and complementary protease digest to identify changes in the yeast cell wall proteome caused by lack of the Alg3p protein, a key component of the biosynthetic pathway of protein N-glycosylation. The cell wall of yeast lacking Alg3p showed specifically increased levels of Cis3p, a protein important for cell wall integrity. Our results showed that deglycosylation prior to protease digestion improved the quality of proteomic analyses even if protein glycosylation is not of direct relevance to the study at hand. Copyright © 2013 Elsevier B.V. All rights reserved.

Good practices for common sole assessment in the Adriatic Sea: Genetic and morphological differentiation of Solea solea (Linnaeus, 1758) from S. aegyptiaca (Chabanaud, 1927) and stock identification

NASA Astrophysics Data System (ADS)

Sabatini, Laura; Bullo, Marianna; Cariani, Alessia; Celić, Igor; Ferrari, Alice; Guarniero, Ilaria; Leoni, Simone; Marčeta, Bojan; Marcone, Alessandro; Polidori, Piero; Raicevich, Saša; Tinti, Fausto; Vrgoč, Nedo; Scarcella, Giuseppe

2018-07-01

In the Adriatic Sea two cryptic species of sole coexist, the common and Egyptian sole. Soles are one of the most valuable demersal fishery resources in the Adriatic Sea, so a correct species identification is crucial in order to perform stock assessment and implement effective management measures based on reliable and accurate data. In this study specimens collected during fishery-independent and fishery-dependent activities in the Adriatic were analyzed and identified coupling morphological and genetic approaches. A comparison of these two methods for the sole species identification was carried out to assess the most effective, accurate and practical diagnostic morphological key-character(s). Results showed that external characters, in particular features of the posterior dorsal and anal fins, are valid and accurate morphological markers. Based on these traits, a practical identification key of the two sibling species was proposed. Moreover, it was possible to estimate the extent of the error due to species misidentification introduced in the common sole stock assessment carried out in the Northern-central Adriatic Sea (GSA17). A 5% bias in the correct identification of common sole specimens was detected. However, this bias was shown not to affect the common sole stock assessment. Moreover, the genetic profiling of the Adriatic common sole allowed estimating genetic diversity and assessing population structure. Significant divergence between common soles inhabiting the eastern part of the Southern Adriatic Sea and those collected from the other areas of the basin was confirmed. Therefore, the occurrence of genetically differentiated subpopulations supports the need to implement independent stock assessments and management measures.

A gallery of the key characters to ease identification of Dermanyssus gallinae (Acari: Gamasida: Dermanyssidae) and allow differentiation from Ornithonyssus sylviarum (Acari: Gamasida: Macronyssidae)

PubMed Central

2012-01-01

Background Dermanyssus gallinae (poultry red mite) is a major threat for the poultry industry and is of significant interest for public health. Identification of D. gallinae can be difficult for scientists not familiar with mite morphology and terminology especially when trying to use identification keys. Moreover, this species may easily be confused with another dermanyssoid mite, Ornithonyssus sylviarum (northern fowl mite), which often shares the same hosts and environment. Methods Specimens of D. gallinae were collected at poultry farms in the Puglia and performed for light and scanning electron microscopy observations, identification and micrographs. Moreover specimens of O. sylviarum were collected separately macerated and mounted on slides for light microscopy observations, identification and pictures. Results The micrographs used in this study, based on LM and SEM observations, highlight the following important identifying characters of D. gallinae: the prominent shoulders of the dorsal shield and the jagged edges of the shield reticulations, the position of setae j1, s1 and the epigynal pores, and the presence on tibia IV pl of one seta. Additional micrographs highlighting the shape of the dorsal (abruptly narrowed posteriorly) and epigynal (narrowly rounded posteriorly) shields and the chelicera (elongate, with distinct digits) of O. sylviarum enable its differentiation from D.gallinae. Conclusion The photographic support provided here (both LM and SEM pictures) can be considered a practical tool for scientists who are not well acquainted with the morphology of D.gallinae, and who are involved with classical and molecular systematics, veterinary and human health aspects of poultry red mites. PMID:22647594

The real maccoyii: identifying tuna sushi with DNA barcodes--contrasting characteristic attributes and genetic distances.

PubMed

Lowenstein, Jacob H; Amato, George; Kolokotronis, Sergios-Orestis

2009-11-18

The use of DNA barcodes for the identification of described species is one of the least controversial and most promising applications of barcoding. There is no consensus, however, as to what constitutes an appropriate identification standard and most barcoding efforts simply attempt to pair a query sequence with reference sequences and deem identification successful if it falls within the bounds of some pre-established cutoffs using genetic distance. Since the Renaissance, however, most biological classification schemes have relied on the use of diagnostic characters to identify and place species. Here we developed a cytochrome c oxidase subunit I character-based key for the identification of all tuna species of the genus Thunnus, and compared its performance with distance-based measures for identification of 68 samples of tuna sushi purchased from 31 restaurants in Manhattan (New York City) and Denver, Colorado. Both the character-based key and GenBank BLAST successfully identified 100% of the tuna samples, while the Barcode of Life Database (BOLD) as well as genetic distance thresholds, and neighbor-joining phylogenetic tree building performed poorly in terms of species identification. A piece of tuna sushi has the potential to be an endangered species, a fraud, or a health hazard. All three of these cases were uncovered in this study. Nineteen restaurant establishments were unable to clarify or misrepresented what species they sold. Five out of nine samples sold as a variant of "white tuna" were not albacore (T. alalunga), but escolar (Lepidocybium flavorunneum), a gempylid species banned for sale in Italy and Japan due to health concerns. Nineteen samples were northern bluefin tuna (T. thynnus) or the critically endangered southern bluefin tuna (T. maccoyii), though nine restaurants that sold these species did not state these species on their menus. The Convention on International Trade Endangered Species (CITES) requires that listed species must be identifiable in trade. This research fulfills this requirement for tuna, and supports the nomination of northern bluefin tuna for CITES listing in 2010.

From Drinking Group Norms to Individual Drinking Consequences: A Moderated Mediation Model Examining the Role of Members' Status, Identification with the Group and with Emerging Adulthood.

PubMed

Dumas, Tara M; Davis, Jordan P; Maxwell-Smith, Matthew A; Bell, Angelica

2018-07-03

Emerging adults consume alcohol most often with their peer drinking groups. Yet, little is known about the role of drinking group norms on individual members' drinking consequences, nor about the mechanisms that underlie this association. We examined the indirect relationship between drinking group descriptive norms (perceived frequency of group heavy episodic drinking; HED) and individual drinking consequences via individual HED. We also examined key moderators, including the extent to which individuals occupied high status positions within their drinking groups, the strength of their identification with the group, and the degree to which they identified with emerging adulthood, a developmental period associated with heightened alcohol consumption. Participants were 280 and 340 (replication study) emerging adults (18-29 years) who were recruited via an online crowdsourcing site to complete a survey. Across studies, higher status was associated with more individual HED and drinking consequences. Further, group identification and identification with emerging adulthood strengthened the relation between group and individual HED. Finally, the indirect relation between group HED and individual drinking consequences was significant and stronger for individuals who identified more with their drinking groups and with emerging adulthood. Conclusions/Importance: Findings contribute to a more nuanced understanding of the impact of descriptive peer norms on heavy drinking and related consequences in emerging adulthood and help identify drinking group members most at risk for internalizing descriptive group norms for HED. Key implications for prevention and intervention programming are discussed.

Optimizing identification and management of COPD patients – reviewing the role of the community pharmacist

PubMed Central

van Boven, Job F. M.; Maguire, Terence; Goyal, Pankaj; Altman, Pablo

2016-01-01

The aim of this paper was to propose key steps for community pharmacist integration into a patient care pathway for chronic obstructive pulmonary disease (COPD) management. A literature search was conducted to identify publications focusing on the role of the community pharmacist in identification and management of COPD. The literature search highlighted evidence supporting an important role for pharmacists at each of the four key steps in the patient care pathway for COPD management. Step 1 (primary prevention): pharmacists are ideally placed to provide information on disease awareness and risk prevention campaigns, and to encourage lifestyle interventions, including smoking cessation. Step 2 (early detection/case finding): pharmacists are often the first point of contact between the patient and the healthcare system and can therefore play an important role in the early identification of patients with COPD. Step 3 (management and ongoing support): pharmacists can assist patients by providing advice and education on dosage, inhaler technique, treatment expectations and the importance of adherence, and by supporting self‐management, including recognition and treatment of COPD exacerbations. Step 4 (review and follow‐up): pharmacists can play an important role in monitoring adherence and ongoing inhaler technique in patients with COPD. In summary, pharmacists are ideally positioned to play a vital role in all key stages of an integrated COPD patient care pathway from early disease detection to the support of management plans, including advice and counselling regarding medications, inhaler technique and treatment adherence. Areas requiring additional consideration include pharmacist training, increasing awareness of the pharmacist role, administration and reimbursement, and increasing physician–pharmacist collaboration. PMID:27510273

A new species of the genus Acinopus Dejean, 1821 from west of Iran (Coleoptera; Carabidae; Harpalini) with a key to species of Iran.

PubMed

Azadbakhsh, Saeed; Wrase, David W

2016-08-08

A new species of the genus Acinopus Dejean, 1821, namely Acinopus (Acinopus) zagrosensis sp. n., is described on the basis of specimens collected from west Iran (type locality: Iran, Fars province, Zagros Mts., Sepidan env., 2060 m). The new species is compared with closely related species. A key for the identification of species of genus Acinopus in Iran is provided.

NASA Integrated Model Centric Architecture (NIMA) Model Use and Re-Use

NASA Technical Reports Server (NTRS)

Conroy, Mike; Mazzone, Rebecca; Lin, Wei

2012-01-01

This whitepaper accepts the goals, needs and objectives of NASA's Integrated Model-centric Architecture (NIMA); adds experience and expertise from the Constellation program as well as NASA's architecture development efforts; and provides suggested concepts, practices and norms that nurture and enable model use and re-use across programs, projects and other complex endeavors. Key components include the ability to effectively move relevant information through a large community, process patterns that support model reuse and the identification of the necessary meta-information (ex. history, credibility, and provenance) to safely use and re-use that information. In order to successfully Use and Re-Use Models and Simulations we must define and meet key organizational and structural needs: 1. We must understand and acknowledge all the roles and players involved from the initial need identification through to the final product, as well as how they change across the lifecycle. 2. We must create the necessary structural elements to store and share NIMA-enabled information throughout the Program or Project lifecycle. 3. We must create the necessary organizational processes to stand up and execute a NIMA-enabled Program or Project throughout its lifecycle. NASA must meet all three of these needs to successfully use and re-use models. The ability to Reuse Models a key component of NIMA and the capabilities inherent in NIMA are key to accomplishing NASA's space exploration goals. 11

Infrasound from the 2009 and 2017 DPRK rocket launches

NASA Astrophysics Data System (ADS)

Evers, L. G.; Assink, J. D.; Smets, P. SM

2018-06-01

Supersonic rockets generate low-frequency acoustic waves, that is, infrasound, during the launch and re-entry. Infrasound is routinely observed at infrasound arrays from the International Monitoring System, in place for the verification of the Comprehensive Nuclear-Test-Ban Treaty. Association and source identification are key elements of the verification system. The moving nature of a rocket is a defining criterion in order to distinguish it from an isolated explosion. Here, it is shown how infrasound recordings can be associated, which leads to identification of the rocket. Propagation modelling is included to further constrain the source identification. Four rocket launches by the Democratic People's Republic of Korea in 2009 and 2017 are analysed in which multiple arrays detected the infrasound. Source identification in this region is important for verification purposes. It is concluded that with a passive monitoring technique such as infrasound, characteristics can be remotely obtained on sources of interest, that is, infrasonic intelligence, over 4500+ km.

Hit identification and optimization in virtual screening: practical recommendations based on a critical literature analysis.

PubMed

Zhu, Tian; Cao, Shuyi; Su, Pin-Chih; Patel, Ram; Shah, Darshan; Chokshi, Heta B; Szukala, Richard; Johnson, Michael E; Hevener, Kirk E

2013-09-12

A critical analysis of virtual screening results published between 2007 and 2011 was performed. The activity of reported hit compounds from over 400 studies was compared to their hit identification criteria. Hit rates and ligand efficiencies were calculated to assist in these analyses, and the results were compared with factors such as the size of the virtual library and the number of compounds tested. A series of promiscuity, druglike, and ADMET filters were applied to the reported hits to assess the quality of compounds reported, and a careful analysis of a subset of the studies that presented hit optimization was performed. These data allowed us to make several practical recommendations with respect to selection of compounds for experimental testing, definition of hit identification criteria, and general virtual screening hit criteria to allow for realistic hit optimization. A key recommendation is the use of size-targeted ligand efficiency values as hit identification criteria.

Comparative Performance Analysis of Different Fingerprint Biometric Scanners for Patient Matching.

PubMed

Kasiiti, Noah; Wawira, Judy; Purkayastha, Saptarshi; Were, Martin C

2017-01-01

Unique patient identification within health services is an operational challenge in healthcare settings. Use of key identifiers, such as patient names, hospital identification numbers, national ID, and birth date are often inadequate for ensuring unique patient identification. In addition approximate string comparator algorithms, such as distance-based algorithms, have proven suboptimal for improving patient matching, especially in low-resource settings. Biometric approaches may improve unique patient identification. However, before implementing the technology in a given setting, such as health care, the right scanners should be rigorously tested to identify an optimal package for the implementation. This study aimed to investigate the effects of factors such as resolution, template size, and scan capture area on the matching performance of different fingerprint scanners for use within health care settings. Performance analysis of eight different scanners was tested using the demo application distributed as part of the Neurotech Verifinger SDK 6.0.

Integrated Decision Strategies for Skin Sensitization Hazard

EPA Science Inventory

One of the top priorities of the Interagency Coordinating Committee for the Validation of Alternative Methods (ICCVAM) is the identification and evaluation of non-animal alternatives for skin sensitization testing. Although skin sensitization is a complex process, the key biologi...

Validation and augmentation of Inrix arterial travel time data using independent sources.

DOT National Transportation Integrated Search

2015-02-01

Travel time data is a key input to Intelligent Transportation Systems (ITS) applications. Advancement in vehicle : tracking and identification technologies and proliferation of location-aware and connected devices has made network-wide travel time da...

Heterologous Expression in Remodeled C. elegans: A Platform for Monoaminergic Agonist Identification and Anthelmintic Screening.

PubMed

Law, Wenjing; Wuescher, Leah M; Ortega, Amanda; Hapiak, Vera M; Komuniecki, Patricia R; Komuniecki, Richard

2015-04-01

Monoamines, such as 5-HT and tyramine (TA), paralyze both free-living and parasitic nematodes when applied exogenously and serotonergic agonists have been used to clear Haemonchus contortus infections in vivo. Since nematode cell lines are not available and animal screening options are limited, we have developed a screening platform to identify monoamine receptor agonists. Key receptors were expressed heterologously in chimeric, genetically-engineered Caenorhabditis elegans, at sites likely to yield robust phenotypes upon agonist stimulation. This approach potentially preserves the unique pharmacologies of the receptors, while including nematode-specific accessory proteins and the nematode cuticle. Importantly, the sensitivity of monoamine-dependent paralysis could be increased dramatically by hypotonic incubation or the use of bus mutants with increased cuticular permeabilities. We have demonstrated that the monoamine-dependent inhibition of key interneurons, cholinergic motor neurons or body wall muscle inhibited locomotion and caused paralysis. Specifically, 5-HT paralyzed C. elegans 5-HT receptor null animals expressing either nematode, insect or human orthologues of a key Gαo-coupled 5-HT1-like receptor in the cholinergic motor neurons. Importantly, 8-OH-DPAT and PAPP, 5-HT receptor agonists, differentially paralyzed the transgenic animals, with 8-OH-DPAT paralyzing mutant animals expressing the human receptor at concentrations well below those affecting its C. elegans or insect orthologues. Similarly, 5-HT and TA paralyzed C. elegans 5-HT or TA receptor null animals, respectively, expressing either C. elegans or H. contortus 5-HT or TA-gated Cl- channels in either C. elegans cholinergic motor neurons or body wall muscles. Together, these data suggest that this heterologous, ectopic expression screening approach will be useful for the identification of agonists for key monoamine receptors from parasites and could have broad application for the identification of ligands for a host of potential anthelmintic targets.

Heterologous Expression in Remodeled C. elegans: A Platform for Monoaminergic Agonist Identification and Anthelmintic Screening

PubMed Central

Law, Wenjing; Wuescher, Leah M.; Ortega, Amanda; Hapiak, Vera M.; Komuniecki, Patricia R.; Komuniecki, Richard

2015-01-01

Monoamines, such as 5-HT and tyramine (TA), paralyze both free-living and parasitic nematodes when applied exogenously and serotonergic agonists have been used to clear Haemonchus contortus infections in vivo. Since nematode cell lines are not available and animal screening options are limited, we have developed a screening platform to identify monoamine receptor agonists. Key receptors were expressed heterologously in chimeric, genetically-engineered Caenorhabditis elegans, at sites likely to yield robust phenotypes upon agonist stimulation. This approach potentially preserves the unique pharmacologies of the receptors, while including nematode-specific accessory proteins and the nematode cuticle. Importantly, the sensitivity of monoamine-dependent paralysis could be increased dramatically by hypotonic incubation or the use of bus mutants with increased cuticular permeabilities. We have demonstrated that the monoamine-dependent inhibition of key interneurons, cholinergic motor neurons or body wall muscle inhibited locomotion and caused paralysis. Specifically, 5-HT paralyzed C. elegans 5-HT receptor null animals expressing either nematode, insect or human orthologues of a key Gαo-coupled 5-HT1-like receptor in the cholinergic motor neurons. Importantly, 8-OH-DPAT and PAPP, 5-HT receptor agonists, differentially paralyzed the transgenic animals, with 8-OH-DPAT paralyzing mutant animals expressing the human receptor at concentrations well below those affecting its C. elegans or insect orthologues. Similarly, 5-HT and TA paralyzed C. elegans 5-HT or TA receptor null animals, respectively, expressing either C. elegans or H. contortus 5-HT or TA-gated Cl- channels in either C. elegans cholinergic motor neurons or body wall muscles. Together, these data suggest that this heterologous, ectopic expression screening approach will be useful for the identification of agonists for key monoamine receptors from parasites and could have broad application for the identification of ligands for a host of potential anthelmintic targets. PMID:25928899

Rapid identification of Corynebacterium vaginale in non-purulent vaginitis.

PubMed Central

Wells, J I; Goei, S H

1981-01-01

A simple set of tests is proposed to give excellent probability for the identification of Corynebacterium vaginale from clinical material. Using these tests, 380 C vaginale were isolated from genital tract specimens from 1402 patients. Of these isolates 70 were from symptomatic patients. These 70 isolates were subjected to a further set of tests to confirm their identity. The advantage of these primary tests is that they can be completed on the day of isolation of the organism. Of these 70 isolates 66 were confirmed as C vaginale thus giving the primary set of tests a 94% rate of accurate identification. However this rate may be increased beyond 97% by the promotion of one of the key secondary tests to the primary set. PMID:7024317

Tag Content Access Control with Identity-based Key Exchange

NASA Astrophysics Data System (ADS)

Yan, Liang; Rong, Chunming

2010-09-01

Radio Frequency Identification (RFID) technology that used to identify objects and users has been applied to many applications such retail and supply chain recently. How to prevent tag content from unauthorized readout is a core problem of RFID privacy issues. Hash-lock access control protocol can make tag to release its content only to reader who knows the secret key shared between them. However, in order to get this shared secret key required by this protocol, reader needs to communicate with a back end database. In this paper, we propose to use identity-based secret key exchange approach to generate the secret key required for hash-lock access control protocol. With this approach, not only back end database connection is not needed anymore, but also tag cloning problem can be eliminated at the same time.

Asian pheretimoid earthworms in North America north of Mexico: An illustrated key to the genera Amynthas, Metaphire, Pithemera, and Polypheretima (Clitellata: Megascolecidae).

PubMed

Chang, Chih-Han; Snyder, Bruce A; Szlavecz, Katalin

2016-10-31

The invasion of the pheretimoid earthworms in North America, especially the genera Amynthas and Metaphire, has raised increasing concerns among ecologists and land managers, in turn increasing the need for proper identification. However, the commonly used keys to this group are more than 30 years old with outdated taxonomic information and are based primarily on internal morphology. The requirement of significant amount of taxonomic expertise and dissection, even from the first entry of the key, has prevented broader use of these keys. As a result, many publications in the United States have used Amynthas spp. to represent the group without identifying the species. We present here a new key and diagnoses for the 16 pheretimoid earthworm species recorded in North America north of Mexico, including four genera: Amynthas (10), Metaphire (4), Pithemera (1), and Polypheretima (1). The descriptions were based on published records with modifications following inspection of specimens archived at the National Museum of Natural History, Smithsonian Institution, Washington, D.C. Photos of external and internal characters, including male pores, spermathecal pores, genital markings, spermathecae, prostate glands, and intestinal caeca, are presented to help identification. A summary of current knowledge about the ecology and historical context is provided for each species. We also highlight the previously overlooked and potentially common and widespread co-occurrence of three species-A. agrestis, A. tokioensis, and M. hilgendorfi-and point out that many recent claims of invasion of A. agrestis need to be re-evaluated for potential misidentification.

Encryption key distribution via chaos synchronization

PubMed Central

Keuninckx, Lars; Soriano, Miguel C.; Fischer, Ingo; Mirasso, Claudio R.; Nguimdo, Romain M.; Van der Sande, Guy

2017-01-01

We present a novel encryption scheme, wherein an encryption key is generated by two distant complex nonlinear units, forced into synchronization by a chaotic driver. The concept is sufficiently generic to be implemented on either photonic, optoelectronic or electronic platforms. The method for generating the key bitstream from the chaotic signals is reconfigurable. Although derived from a deterministic process, the obtained bit series fulfill the randomness conditions as defined by the National Institute of Standards test suite. We demonstrate the feasibility of our concept on an electronic delay oscillator circuit and test the robustness against attacks using a state-of-the-art system identification method. PMID:28233876

Quality Management and Key Performance Indicators in Oncologic Esophageal Surgery.

PubMed

Gockel, Ines; Ahlbrand, Constantin Johannes; Arras, Michael; Schreiber, Elke Maria; Lang, Hauke

2015-12-01

Ranking systems and comparisons of quality and performance indicators will be of increasing relevance for complex "high-risk" procedures such as esophageal cancer surgery. The identification of evidence-based standards relevant for key performance indicators in esophageal surgery is essential for establishing monitoring systems and furthermore a requirement to enhance treatment quality. In the course of this review, we analyze the key performance indicators case volume, radicality of resection, and postoperative morbidity and mortality, leading to continuous quality improvement. Ranking systems established on this basis will gain increased relevance in highly complex procedures within the national and international comparison and furthermore improve the treatment of patients with esophageal carcinoma.

Eyewitness confidence in simultaneous and sequential lineups: a criterion shift account for sequential mistaken identification overconfidence.

PubMed

Dobolyi, David G; Dodson, Chad S

2013-12-01

Confidence judgments for eyewitness identifications play an integral role in determining guilt during legal proceedings. Past research has shown that confidence in positive identifications is strongly associated with accuracy. Using a standard lineup recognition paradigm, we investigated accuracy using signal detection and ROC analyses, along with the tendency to choose a face with both simultaneous and sequential lineups. We replicated past findings of reduced rates of choosing with sequential as compared to simultaneous lineups, but notably found an accuracy advantage in favor of simultaneous lineups. Moreover, our analysis of the confidence-accuracy relationship revealed two key findings. First, we observed a sequential mistaken identification overconfidence effect: despite an overall reduction in false alarms, confidence for false alarms that did occur was higher with sequential lineups than with simultaneous lineups, with no differences in confidence for correct identifications. This sequential mistaken identification overconfidence effect is an expected byproduct of the use of a more conservative identification criterion with sequential than with simultaneous lineups. Second, we found a steady drop in confidence for mistaken identifications (i.e., foil identifications and false alarms) from the first to the last face in sequential lineups, whereas confidence in and accuracy of correct identifications remained relatively stable. Overall, we observed that sequential lineups are both less accurate and produce higher confidence false identifications than do simultaneous lineups. Given the increasing prominence of sequential lineups in our legal system, our data argue for increased scrutiny and possibly a wholesale reevaluation of this lineup format. PsycINFO Database Record (c) 2013 APA, all rights reserved.

Plant phenolics – from field to fork

USDA-ARS?s Scientific Manuscript database

Plant secondary metabolites, such as phenolics, are important to human health and for the organoleptic properties they impart to fresh and processed foods. Consumers judge appearance, taste, and texture when making purchasing decisions. Thorough identification of phenolic compounds is key to discern...

Benchmarking: A strategic overview of a key management tool

Treesearch

Chris Leclair

1999-01-01

Benchmarking is a continuous, systematic process for evaluating the products, services, and work processes of organizations in an effort to identifY best practices for possible adoption in support of the objectives of enhanced activity service delivery and organizational effectiveness.

Computational Embryology and Predictive Toxicology of Cleft Palate

EPA Science Inventory

Capacity to model and simulate key events in developmental toxicity using computational systems biology and biological knowledge steps closer to hazard identification across the vast landscape of untested environmental chemicals. In this context, we chose cleft palate as a model ...

The Bark Myxomycetes--Their Collection, Culture and Identification

ERIC Educational Resources Information Center

Mitchell, David W.

1977-01-01

Describes a technique for isolating slime molds from tree bark and outlines projects for working with slime molds in the laboratory. Diagrams of 26 of the more common British species and a key to the Orders of Myxomcetes are given. (CS)

Identification of Potential Chemical Carcinogens in Compendia of Gene Expression Profiles

EPA Science Inventory

Chemicals induce cancer through partially characterized adverse outcome pathways (AOPs) that include molecular initiating events (MIEs) and downstream key events (KEs). Microarray profiling of chemical-induced effects is being increasingly used in medium- and high-throughput form...

Identifying Hardwoods Growing on Pine Sites

Treesearch

Clair A. Brown; Harold E. Grelen

1977-01-01

This publication illustrates and describes 26 hardwood species or varieties, including 16 oaks and hickories with photographs of leaves, bark, buds, flowers, and fruits. Line drawings feature the winter silhouette of each species and a key is included to assist in identification.

Identification of SNP Haplotypes and Prospects of Association Mapping in Watermelon

USDA-ARS?s Scientific Manuscript database

Watermelon is the fifth most economically important vegetable crop cultivated world-wide. Implementing Single Nucleotide Polymorphism (SNP) marker technology in watermelon breeding and germplasm evaluation programs holds a key to improve horticulturally important traits. Next-generation sequencing...

Identification of Migratory Insects from their Physical Features using a Decision-Tree Support Vector Machine and its Application to Radar Entomology.

PubMed

Hu, Cheng; Kong, Shaoyang; Wang, Rui; Long, Teng; Fu, Xiaowei

2018-04-03

Migration is a key process in the population dynamics of numerous insect species, including many that are pests or vectors of disease. Identification of insect migrants is critically important to studies of insect migration. Radar is an effective means of monitoring nocturnal insect migrants. However, species identification of migrating insects is often unachievable with current radar technology. Special-purpose entomological radar can measure radar cross-sections (RCSs) from which the insect mass, wingbeat frequency and body length-to-width ratio (a measure of morphological form) can be estimated. These features may be valuable for species identification. This paper explores the identification of insect migrants based on the mass, wingbeat frequency and length-to-width ratio, and body length is also introduced to assess the benefit of adding another variable. A total of 23 species of migratory insects captured by a searchlight trap are used to develop a classification model based on decision-tree support vector machine method. The results reveal that the identification accuracy exceeds 80% for all species if the mass, wingbeat frequency and length-to-width ratio are utilized, and the addition of body length is shown to further increase accuracy. It is also shown that improving the precision of the measurements leads to increased identification accuracy.

When forensic odontology met biochemistry: Multidisciplinary approach in forensic human identification.

PubMed

Adserias-Garriga, Joe; Thomas, Christian; Ubelaker, Douglas H; C Zapico, Sara

2018-03-01

When human remains are found, the priority of the investigation is to ascertain the identity of the deceased. A positive identification is a key factor in providing closure for the family of the deceased; it is also required to issue the death certificate and therefore, to settle legal affairs. Moreover, it is difficult for any forensic investigation involving human remains to be solved without the determination of an identity. Therefore, personal identification is necessary for social, legal and forensic reasons. In the last thirty years forensic odontology has experienced an important transformation, from primarily involving occasional dental identification into a broader role, contributing to the determination of the biological profile. In the same way, "DNA fingerprinting" has evolved not only in terms of improving its technology, but also in its application beyond the "classical": helping with the estimation of sex, age and ancestry. As these two forensic disciplines have developed independently, their pathways have crossed several times through human identification operations, especially the ones that require a multidisciplinary approach. Thus, the aim of this review is to describe the contributions of both forensic odontology and molecular biology/biochemistry to human identification, demonstrating how a multidisciplinary approach can lead to a better and more efficient identification. Copyright © 2017 Elsevier Ltd. All rights reserved.

Rediscovery of Meristaspis lateralis (Kolenati) (Acari: Mesostigmata: Spinturnicidae) parasitizing the Egyptian fruit bat, Rousettus aegyptiacus (Geoffroy) (Mammalia: Chiroptera), with a key to mites of bats in Egypt.

PubMed

Negm, Mohamed W; Fakeer, Mahmoud M

2014-04-01

Faunistic information about bat mites in Egypt is scarce. Collection records of parasitic mites, Meristaspis lateralis (Kolenati, 1856) (Mesostigmata: Spinturnicidae), are reported from the Egyptian fruit bat, Rousettus aegyptiacus (Geoffroy, 1810) (Mammalia: Chiroptera) in Assiut Governorate, Egypt. Seven species of bat mites are recognized from Egypt to date. A host-parasite checklist and an identification key to these species are presented.

Post Landsat-D advanced concept evaluation /PLACE/

NASA Technical Reports Server (NTRS)

Alexander, L. D.; Alvarado, U. R.; Flatow, F. S.

1979-01-01

The aim of the Post Landsat-D Advanced Concept Evaluation (PLACE) program was to identify the key technology requirements of earth resources satellite systems for the 1985-2000 period. The program involved four efforts: (1) examination of future needs in the earth resources area, (2) creation of a space systems technology model capable of satisfying these needs, (3) identification of key technology requirements posed by this model, and (4) development of a methodology (PRISM) to assist in the priority structuring of the resulting technologies.

Recircumscription and taxonomic revision of Siderasis, with comments on the systematics of subtribe Dichorisandrinae (Commelinaceae)

PubMed Central

Pellegrini, Marco O. O.; Faden, Robert B.

2017-01-01

Abstract A new circumscription and a total of six microendemic species, four of them new to science, are herein presented for Siderasis, based on field and herbaria studies, and cultivated material. We provide an identification key to the species and a distribution map, description, comments, conservation assessment, and illustration for each species. Also, we present an emended key to the genera of subtribe Dichorisandrinae, and comments on the morphology and systematics of the subtribe. PMID:29033648

Ultrasonic determination of recrystallization

NASA Technical Reports Server (NTRS)

Generazio, E. R.

1986-01-01

Ultrasonic attenuation was measured for cold worked Nickel 200 samples annealed at increasing temperatures. Localized dislocation density variations, crystalline order and colume percent of recrystallized phase were determined over the anneal temperature range using transmission electron microscopy, X-ray diffraction, and metallurgy. The exponent of the frequency dependence of the attenuation was found to be a key variable relating ultrasonic attenuation to the thermal kinetics of the recrystallization process. Identification of this key variable allows for the ultrasonic determination of onset, degree, and completion of recrystallization.

Prosthodontics an “arsenal” in forensic dentistry

PubMed Central

Bathala, Lakshmana Rao; Rachuri, Narendra Kumar; Rayapati, Srinivas Rao; Kondaka, Sudheer

2016-01-01

After major disasters such as earthquakes, fires, floods, tsunami, bomb blasts or terrorist attacks, accurate, and early identification of the dead and injured becomes an utmost importance. Restorations, cariesteeth, missingteeth and/or prostheses are most useful aids for the dental identification. At times, only identifiable remains are a victim's partial or complete dentures. The central principle of dental identification is that postmortem dental remains can be compared with antemortem dental records which include, studycasts, radiographs, etc., to confirm the identity of the victims. Marking/labeling dentures have been considered an important aid in forensic dentistry. Other than finger printing, when compared with all the methods, the marking/labeling of dentures is an accurate and rapid method to identify the unknown victims. There are no standardized methods to follow, but dental practitioners needs to maintain some dental records of their patients. This may include documentation of the “marking of dentures.” The preparedness is the key to success in mass disaster identification. The aim of this review article is to discuss the methods of denture identification, advantages of denture labeling for the rapid identification during major disasters/accidents and the importance of maintaining the patient records. PMID:28123274

Talent identification in youth soccer.

PubMed

Unnithan, Viswanath; White, Jordan; Georgiou, Andreas; Iga, John; Drust, Barry

2012-01-01

The purpose of this review article was firstly to evaluate the traditional approach to talent identification in youth soccer and secondly present pilot data on a more holistic method for talent identification. Research evidence exists to suggest that talent identification mechanisms that are predicated upon the physical (anthropometric) attributes of the early maturing individual only serve to identify current performance levels. Greater body mass and stature have both been related to faster ball shooting speed and vertical jump capacity respectively in elite youth soccer players. This approach, however, may prematurely exclude those late maturing individuals. Multiple physiological measures have also been used in an effort to determine key predictors of performance; with agility and sprint times, being identified as variables that could discriminate between elite and sub-elite groups of adolescent soccer players. Successful soccer performance is the product of multiple systems interacting with one another. Consequently, a more holistic approach to talent identification should be considered. Recent work, with elite youth soccer players, has considered whether multiple small-sided games could act as a talent identification tool in this population. The results demonstrated that there was a moderate agreement between the more technically gifted soccer player and success during multiple small-sided games.

Influence of Biochemical Features of Burkholderia pseudomallei Strains on Identification Reliability by Vitek 2 System.

PubMed

Zakharova, Irina B; Lopasteyskaya, Yana A; Toporkov, Andrey V; Viktorov, Dmitry V

2018-01-01

Burkholderia pseudomallei is a Gram-negative saprophytic soil bacterium that causes melioidosis, a potentially fatal disease endemic in wet tropical areas. The currently available biochemical identification systems can misidentify some strains of B. pseudomallei . The aim of the present study was to identify the biochemical features of B. pseudomallei , which can affect its correct identification by Vitek 2 system. The biochemical patterns of 40 B. pseudomallei strains were obtained using Vitek 2 GN cards. The average contribution of biochemical tests in overall dissimilarities between correctly and incorrectly identified strains was assessed using nonmetric multidimensional scaling. It was found ( R statistic of 0.836, P = 0.001) that a combination of negative N-acetyl galactosaminidase, β-N-acetyl glucosaminidase, phosphatase, and positive D-cellobiase (dCEL), tyrosine arylamidase (TyrA), and L-proline arylamidase (ProA) tests leads to low discrimination of B. pseudomallei , whereas a set of positive dCEL and negative N-acetyl galactosaminidase, TyrA, and ProA determines the wrong identification of B. pseudomallei as Burkholderia cepacia complex. The further expansion of the Vitek 2 identification keys is needed for correct identification of atypical or regionally distributed biochemical profiles of B. pseudomallei .

Identifying Organizational Identification as a Basis for Attitudes and Behaviors: A Meta-Analytic Review.

PubMed

Lee, Eun-Suk; Park, Tae-Youn; Koo, Bonjin

2015-09-01

Organizational identification has been argued to have a unique value in explaining individual attitudes and behaviors in organizations, as it involves the essential definition of entities (i.e., individual and organizational identities). This review seeks meta-analytic evidence of the argument by examining how this identity-relevant construct functions in the nexus of attitudinal/behavioral constructs. The findings show that, first, organizational identification is significantly associated with key attitudes (job involvement, job satisfaction, and affective organizational commitment) and behaviors (in-role performance and extra-role performance) in organizations. Second, in the classic psychological model of attitude-behavior relations (Fishbein & Ajzen, 1975), organizational identification is positioned as a basis from which general sets of those attitudes and behaviors are engendered; organizational identification has a direct effect on general behavior above and beyond the effect of general attitude. Third, the effects of organizational identification are moderated by national culture, a higher-level social context wherein the organization is embedded, such that the effects are stronger in a collectivistic culture than in an individualistic culture. Theoretical and practical implications of the findings and future research directions are discussed. (c) 2015 APA, all rights reserved).

Laboratory Needs for Interstellar Ice Studies

NASA Astrophysics Data System (ADS)

Boogert, Abraham C. A.

2012-05-01

A large fraction of the molecules in dense interstellar and circumstellar environments is stored in icy grain mantles. The mantles are formed by a complex interplay between chemical and physical processes. Key questions on the accretion and desorption processes and the chemistry on the grain surfaces and within the icy mantles can only be answered by laboratory experiments. Recent infrared (2-30 micron) spectroscopic surveys of large samples of Young Stellar Objects (YSOs) and background stars tracing quiescent cloud material have shown that the ice band profiles and depths vary considerably as a function of environment. Using laboratory spectra in the identification process, it is clear that a rather complex mixture of simple species (CH3OH, CO2, H2O, CO) exists even in the quiescent cloud phase. Variations of the local physical conditions (CO freeze out) and time scales (CH3OH formation) appear to be key factors in the observed variations. Sublimation and thermal processing dominate as YSOs heat their environments. The identification of several ice absorption features is still disputed. I will outline laboratory work (e.g., on salts, PAHs, and aliphatic hydrocarbons) needed to further constrain the ice band identification as well as the thermal and chemical history of the carriers. Such experiments will also be essential to interpret future high spectral resolution SOFIA and JWST observations.

The tiger beetles (Coleoptera, Cicindelidae) of the southern Levant and adjacent territories: from cybertaxonomy to conservation biology.

PubMed

Assmann, Thorsten; Boutaud, Estève; Buse, Jörn; Gebert, Jörg; Drees, Claudia; Friedman, Ariel-Leib-Leonid; Khoury, Fares; Marcus, Tamar; Orbach, Eylon; Ittai Renan; Schmidt, Constantin; Zumstein, Pascale

2018-01-01

The tiger beetles of the southern Levant (Egypt: Sinai, Israel, Jordan) and adjacent regions of the neighboring countries Lebanon, Syria, Iraq, Saudi Arabia and Egypt are reviewed in terms of species taxonomy, ecological and distributional traits and conservation biology. An illustrated dichotomous identification key from the species of this region is provided. Based on the classical identification key, we developed a digital identification application for smartphones and tablets. The species status of Calomera aulicoides (J.R. Sahlberg, 1913) is (re-) established (stat. rest.) as this taxon can be found sympatrically and parapatrically together with Calomera littoralis winkleri (Mandl, 1934). Morphological character states are discussed to identify Cicindela javetii Chaudoir, 1861 and C. herbacea Klug, 1832. Calomera aphrodisia (Baudi di Selve, 1864) is recorded for the first time from Israel. The presence of Calomera aulica (Dejean, 1831) and Grammognatha euphratica (Dejean, 1822) is confirmed by new records. At least five taxa are threatened or extinct in Israel. For one of these species, Israel has a national responsibility for the conservation as the main part of the distribution range is within this country. The application TIGER BEETLE ID for Android devices can be freely downloaded at https://doi.org/10.3897/zookeys.734.21989.suppl1. See also disclaimer of warranties.

Identification of inhibitors using a cell-based assay for monitoring Golgi-resident protease activity.

PubMed

Coppola, Julia M; Hamilton, Christin A; Bhojani, Mahaveer S; Larsen, Martha J; Ross, Brian D; Rehemtulla, Alnawaz

2007-05-01

Noninvasive real-time quantification of cellular protease activity allows monitoring of enzymatic activity and identification of activity modulators within the protease's natural milieu. We developed a protease activity assay based on differential localization of a recombinant reporter consisting of a Golgi retention signal and a protease cleavage sequence fused to alkaline phosphatase (AP). When expressed in mammalian cells, this protein localizes to Golgi bodies and, on protease-mediated cleavage, AP translocates to the extracellular medium where its activity is measured. We used this system to monitor the Golgi-associated protease furin, a pluripotent enzyme with a key role in tumorigenesis, viral propagation of avian influenza, ebola, and HIV as well as in activation of anthrax, pseudomonas, and diphtheria toxins. This technology was adapted for high-throughput screening of 39,000-compound small molecule libraries, leading to identification of furin inhibitors. Furthermore, this strategy was used to identify inhibitors of another Golgi protease, the beta-site amyloid precursor protein (APP)-cleaving enzyme (BACE). BACE cleavage of the APP leads to formation of the Abeta peptide, a key event that leads to Alzheimer's disease. In conclusion, we describe a customizable noninvasive technology for real-time assessment of Golgi protease activity used to identify inhibitors of furin and BACE.

Key Questions for Translation of FFA Receptors: From Pharmacology to Medicines.

PubMed

Suckow, Arthur T; Briscoe, Celia P

2017-01-01

The identification of fatty acids as ligands for the G-protein coupled free fatty acid (FFA) receptor family over 10 years ago led to intensive chemistry efforts to find small-molecule ligands for this class of receptors. Identification of potent, selective modulators of the FFA receptors and their utility in medicine has proven challenging, in part due to their complex pharmacology. Nevertheless, ligands have been identified that are sufficient for exploring the therapeutic potential of this class of receptors in rodents and, in the case of FFA1, FFA2, FFA4, and GPR84, also in humans. Expression profiling, the phenotyping of FFA receptor knockout mice, and the results of studies exploring the effects of these ligands in rodents have uncovered a number of indications where engagement of one or a combination of FFA receptors might provide some clinical benefit in areas including diabetes, inflammatory bowel syndrome, Alzheimer's, pain, and cancer. In this chapter, we will review the clinical potential of modulating FFA receptors based on preclinical and in some cases clinical studies with synthetic ligands. In particular, key aspects and challenges associated with small-molecule ligand identification and FFA receptor pharmacology will be addressed with a view of the hurdles that need to be overcome to fully understand the potential of the receptors as therapeutic targets.

The tiger beetles (Coleoptera, Cicindelidae) of the southern Levant and adjacent territories: from cybertaxonomy to conservation biology

PubMed Central

Assmann, Thorsten; Boutaud, Estève; Buse, Jörn; Gebert, Jörg; Drees, Claudia; Friedman, Ariel-Leib-Leonid; Khoury, Fares; Marcus, Tamar; Orbach, Eylon; Ittai Renan; Schmidt, Constantin; Zumstein, Pascale

2018-01-01

Abstract The tiger beetles of the southern Levant (Egypt: Sinai, Israel, Jordan) and adjacent regions of the neighboring countries Lebanon, Syria, Iraq, Saudi Arabia and Egypt are reviewed in terms of species taxonomy, ecological and distributional traits and conservation biology. An illustrated dichotomous identification key from the species of this region is provided. Based on the classical identification key, we developed a digital identification application for smartphones and tablets. The species status of Calomera aulicoides (J.R. Sahlberg, 1913) is (re-) established (stat. rest.) as this taxon can be found sympatrically and parapatrically together with Calomera littoralis winkleri (Mandl, 1934). Morphological character states are discussed to identify Cicindela javetii Chaudoir, 1861 and C. herbacea Klug, 1832. Calomera aphrodisia (Baudi di Selve, 1864) is recorded for the first time from Israel. The presence of Calomera aulica (Dejean, 1831) and Grammognatha euphratica (Dejean, 1822) is confirmed by new records. At least five taxa are threatened or extinct in Israel. For one of these species, Israel has a national responsibility for the conservation as the main part of the distribution range is within this country. Availability: The application TIGER BEETLE ID for Android devices can be freely downloaded at https://doi.org/10.3897/zookeys.734.21989.suppl1. See also disclaimer of warranties. PMID:29674855

Identification of inhibitors using a cell based assay for monitoring golgi-resident protease activity

PubMed Central

Coppola, Julia M.; Hamilton, Christin A.; Bhojani, Mahaveer S.; Larsen, Martha J.; Ross, Brian D.; Rehemtulla, Alnawaz

2007-01-01

Non-invasive real time quantification of cellular protease activity allows monitoring of enzymatic activity and identification of activity modulators within the protease’s natural milieu. We developed a protease-activity assay based on differential localization of a recombinant reporter consisting of a Golgi retention signal and a protease cleavage sequence fused to alkaline phosphatase (AP). When expressed in mammalian cells, this protein localizes to Golgi bodies and, upon protease mediated cleavage, AP translocates to the extracellular medium where its activity is measured. We used this system to monitor the Golgi-associated protease furin, a pluripotent enzyme with a key role in tumorigenesis, viral propagation of avian influenza, ebola, and HIV, and in activation of anthrax, pseudomonas, and diphtheria toxins. This technology was adapted for high throughput screening of 30,000 compound small molecule libraries, leading to identification of furin inhibitors. Further, this strategy was utilized to identify inhibitors of another Golgi protease, the β-site APP-cleaving enzyme (BACE). BACE cleavage of the amyloid precursor protein leads to formation of the Aβ peptide, a key event that leads to Alzheimer’s disease. In conclusion, we describe a customizable, non-invasive technology for real time assessment of Golgi protease activity used to identify inhibitors of furin and BACE. PMID:17316541

Subpathway-GM: identification of metabolic subpathways via joint power of interesting genes and metabolites and their topologies within pathways

PubMed Central

Li, Chunquan; Han, Junwei; Yao, Qianlan; Zou, Chendan; Xu, Yanjun; Zhang, Chunlong; Shang, Desi; Zhou, Lingyun; Zou, Chaoxia; Sun, Zeguo; Li, Jing; Zhang, Yunpeng; Yang, Haixiu; Gao, Xu; Li, Xia

2013-01-01

Various ‘omics’ technologies, including microarrays and gas chromatography mass spectrometry, can be used to identify hundreds of interesting genes, proteins and metabolites, such as differential genes, proteins and metabolites associated with diseases. Identifying metabolic pathways has become an invaluable aid to understanding the genes and metabolites associated with studying conditions. However, the classical methods used to identify pathways fail to accurately consider joint power of interesting gene/metabolite and the key regions impacted by them within metabolic pathways. In this study, we propose a powerful analytical method referred to as Subpathway-GM for the identification of metabolic subpathways. This provides a more accurate level of pathway analysis by integrating information from genes and metabolites, and their positions and cascade regions within the given pathway. We analyzed two colorectal cancer and one metastatic prostate cancer data sets and demonstrated that Subpathway-GM was able to identify disease-relevant subpathways whose corresponding entire pathways might be ignored using classical entire pathway identification methods. Further analysis indicated that the power of a joint genes/metabolites and subpathway strategy based on their topologies may play a key role in reliably recalling disease-relevant subpathways and finding novel subpathways. PMID:23482392

Shell architecture: a novel proxy for paleotemperature reconstructions?

NASA Astrophysics Data System (ADS)

Milano, Stefania; Nehrke, Gernot; Wanamaker, Alan D., Jr.; Witbaard, Rob; Schöne, Bernd R.

2017-04-01

Mollusk shells are unique high-resolution paleoenvironmental archives. Their geochemical properties, such as oxygen isotope composition (δ18Oshell) and element-to-calcium ratios, are routinely used to estimate past environmental conditions. However, the existing proxies have certain drawbacks that can affect paleoreconstruction robustness. For instance, the estimation of water temperature of brackish and near-shore environments can be biased by the interdependency of δ18Oshell from multiple environmental variables (water temperature and δ18Owater). Likely, the environmental signature can be masked by physiological processes responsible for the incorporation of trace elements into the shell. The present study evaluated the use of shell structural properties as alternative environmental proxies. The sensitivity of shell architecture at µm and nm-scale to the environment was tested. In particular, the relationship between water temperature and microstructure formation was investigated. To enable the detection of potential structural changes, the shells of the marine bivalves Cerastoderma edule and Arctica islandica were analyzed with Scanning Electron Microscopy (SEM), nanoindentation and Confocal Raman Microscopy (CRM). These techniques allow a quantitative approach to the microstructural analysis. Our results show that water temperature induces a clear response in shell microstructure. A significant alteration in the morphometric characteristics and crystallographic orientation of the structural units was observed. Our pilot study suggests that shell architecture records environmental information and it has potential to be used as novel temperature proxy in near-shore and open ocean habitats.

Shellfish dredging pushes a flexible avian top predator out of a marine protected area.

PubMed

van Gils, Jan A; Piersma, Theunis; Dekinga, Anne; Spaans, Bernard; Kraan, Casper

2006-11-01

There is a widespread concern about the direct and indirect effects of industrial fisheries; this concern is particularly pertinent for so-called "marine protected areas" (MPAs), which should be safeguarded by national and international law. The intertidal flats of the Dutch Wadden Sea are a State Nature Monument and are protected under the Ramsar convention and the European Union's Habitat and Birds Directives. Until 2004, the Dutch government granted permission for ~75% of the intertidal flats to be exploited by mechanical dredgers for edible cockles (Cerastoderma edule). Here we show that dredged areas belonged to the limited area of intertidal flats that were of sufficient quality for red knots (Calidris canutus islandica), a long-distance migrant molluscivore specialist, to feed. Dredging led to relatively lower settlement rates of cockles and also reduced their quality (ratio of flesh to shell). From 1998 to 2002, red knots increased gizzard mass to compensate for a gradual loss in shellfish quality, but this compensation was not sufficient and led to decreases in local survival. Therefore, the gradual destruction of the necessary intertidal resources explains both the loss of red knots from the Dutch Wadden Sea and the decline of the European wintering population. This study shows that MPAs that do not provide adequate protection from fishing may fail in their conservation objectives.

Shellfish Dredging Pushes a Flexible Avian Top Predator out of a Marine Protected Area

PubMed Central

van Gils, Jan A; Piersma, Theunis; Dekinga, Anne; Spaans, Bernard; Kraan, Casper

2006-01-01

There is a widespread concern about the direct and indirect effects of industrial fisheries; this concern is particularly pertinent for so-called “marine protected areas” (MPAs), which should be safeguarded by national and international law. The intertidal flats of the Dutch Wadden Sea are a State Nature Monument and are protected under the Ramsar convention and the European Union's Habitat and Birds Directives. Until 2004, the Dutch government granted permission for ~75% of the intertidal flats to be exploited by mechanical dredgers for edible cockles (Cerastoderma edule). Here we show that dredged areas belonged to the limited area of intertidal flats that were of sufficient quality for red knots (Calidris canutus islandica), a long-distance migrant molluscivore specialist, to feed. Dredging led to relatively lower settlement rates of cockles and also reduced their quality (ratio of flesh to shell). From 1998 to 2002, red knots increased gizzard mass to compensate for a gradual loss in shellfish quality, but this compensation was not sufficient and led to decreases in local survival. Therefore, the gradual destruction of the necessary intertidal resources explains both the loss of red knots from the Dutch Wadden Sea and the decline of the European wintering population. This study shows that MPAs that do not provide adequate protection from fishing may fail in their conservation objectives. PMID:17105350

Role of acyl carrier protein isoforms in plant lipid metabolism: Progress report

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ohlrogge, J.B.

1989-01-01

Previous research from my lab has revealed that several higher plant species have multiple isoforms of acyl carrier protein (ACP) and therefore this trait appears highly conserved among higher plants. This level of conservation suggests that the existence of ACP isoforms is not merely the results of neutral gene duplications. We have developed techniques to examine a wider range of species. Acyl carrier proteins can be labelled very specifically and to high specific activity using H-palmitate and the E. coli enzyme acyl-ACP synthetase. Isoforms were then resolved by western blotting and native PAGE of H-palmitate labelled ACP's. Multiple isoforms ofmore » ACP were observed the leaf tissue of the monocots Avena sativa and Hordeum vulgare and dicots including Arabidopsis thallina, Cuphea wrightii, and Brassica napus. Lower vascular plants including the cycad, Dioon edule, Ginkgo biloba, the gymnosperm Pinus, the fern Anernia phyllitidis and Psilotum nudum, the most primitive known extant vascular plant, were also found to have multiple ACP isoforms as were the nonvascular liverwort, Marchantia and moss, Polytrichum. Therefore, the development of ACP isoforms occurred early in evolution. However, the uniellular alge Chlamydomonas and Dunaliella and the photosynthetic cyanobacteria Synechocystis and Agmnellum have only a single elecrophotetic form of ACP. Thus, multiple forms of ACP do not occur in all photosynthetic organisms but may be associated with multicellular plants.« less

Shifting baselines in the Ems Dollard estuary: A comparison across three decades reveals changing benthic communities

NASA Astrophysics Data System (ADS)

Compton, Tanya J.; Holthuijsen, Sander; Mulder, Maarten; van Arkel, Maarten; Schaars, Loran Kleine; Koolhaas, Anita; Dekinga, Anne; ten Horn, Job; Luttikhuizen, Pieternella C.; van der Meer, Jaap; Piersma, Theunis; van der Veer, Henk W.

2017-09-01

At a time when there is a growing discussion about the natural state of estuaries, a comparison of macrozoobenthos communities from two surveys conducted 30 years apart in the Ems Dollard estuary, in the eastern Wadden Sea, The Netherlands, provides a unique opportunity to compare changes over time. As expected, our comparison revealed a gradient in species composition from land (the Dollard) to sea (the Outer Ems) at both points in time, with brackish species in the Dollard and more marine species in the Outer Ems (Wadden Sea). Total richness increased over time; however, this mainly reflected the immigration of new species and sampling differences. In the Dollard, total biomass declined over time, most likely reflecting de-eutrophication in this area. Strikingly, at the meeting point between the sea and the brackish Dollard, i.e. the Inner Ems, the community composition changed from one dominated by bivalves (1970s) to one dominated by worms (since 2009). This change involved a reduction in total biomass, mainly of Mya arenaria, and immigration of polychaete worms (Marenzellaria viridis and Alitta succinea). In the Outer Ems, an increase in total biomass was observed, associated with the recent successful recruitment of Cerastoderma edule. This comparison highlights that historical data provides useful insights at large spatial scales. However, a full understanding of the complex dynamics of estuaries requires an analysis of continuous long-term monitoring series.

Mining a human transcriptome database for Nrf2 modulators

EPA Science Inventory

Nuclear factor erythroid-2 related factor 2 (Nrf2) is a key transcription factor important in the protection against oxidative stress. We developed computational procedures to enable the identification of chemical, genetic and environmental modulators of Nrf2 in a large database ...

Guide to the willows of Shoshone National Forest

Treesearch

Walter Fertig; Stuart Markow

2001-01-01

Correct identification of willow species is an important part of land management. This guide describes the 29 willows that are known to occur on the Shoshone National Forest, Wyoming. Keys to pistillate catkins and leaf morphology are included with illustrations and plant descriptions.

Building on the Cornerstone Mission: Focused LRO Workshops to Support Science Team Synergies

NASA Astrophysics Data System (ADS)

Keller, J. W.; Petro, N. E.

2017-10-01

During the Cornerstone Mission, the LRO instrument teams have identified a number of key science themes that drive their observations during the extended mission. These themes serve as a basis for the identification of the thematic workshops.

Organization Development. Symposium.

ERIC Educational Resources Information Center

2002

This document contains four papers on organization development and human resources. "Identification of Key Predictors of Rapid Change Adaptation in a Service Organization" (Constantine Kontoghiorghes, Carol Hansen) reports on the results of an exploratory study, which suggests that rapid change adaptation will be more likely to occur in…

The Development of Differential Use of Inner and Outer Face Features in Familiar Face Identification.

ERIC Educational Resources Information Center

Campbell, Ruth; And Others

1995-01-01

Studied 4- to 10-year-olds' familiarity judgments of peers. Found that, contrary to adults, external facial features were key. Also found that the switch to adult recognition pattern takes place after the ninth year. (ETB)

Multivariate models for skin sensitization hazard and potency

EPA Science Inventory

One of the top priorities being addressed by ICCVAM is the identification and validation of non-animal alternatives for skin sensitization testing. Although skin sensitization is a complex process, the key biological events have been well characterized in an adverse outcome pathw...

48 CFR 15.605 - Content of unsolicited proposals.

Code of Federal Regulations, 2012 CFR

2012-10-01

... mission; (3) Names and biographical information on the offeror's key personnel who would be involved... unsolicited proposals. Unsolicited proposals should contain the following information to permit consideration...; (3) Identification of proprietary data to be used only for evaluation purposes; (4) Names of other...

Use of Putative Adverse Outcome Pathways for Chemical Hazard Identification

EPA Science Inventory

The Adverse Outcome Pathway (AOP) framework provides a knowledge infrastructure for evaluating health effects of environmental chemicals. In this work we are examining proof-of-concept issues in the development and prospective application of AOPs in chemical safety. Key outputs i...

Identification of Bacterial DNA Markers for the Detection of Human and Cattle Fecal Pollution - SLIDES

EPA Science Inventory

Technological advances in DNA sequencing and computational biology allow scientists to compare entire microbial genomes. However, the use of these approaches to discern key genomic differences between natural microbial communities remains prohibitively expensive for most laborato...

IDENTIFICATION OF BACTERIAL DNA MARKERS FOR THE DETECTION OF HUMAN AND CATTLE FECAL POLLUTION

EPA Science Inventory

Technological advances in DNA sequencing and computational biology allow scientists to compare entire microbial genomes. However, the use of these approaches to discern key genomic differences between natural microbial communities remains prohibitively expensive for most laborato...

Global Inter-Laboratory Fecal Source Identification Methods Comparison Study

EPA Science Inventory

Source tracking is key to identifying sources of fecal contamination for remediation as well as risk assessment. Previous intra- and inter-lab studies have investigated the performance of human and cow-associated source tracking markers, as well as library-dependent fecal source ...

Statistical analysis of texture in trunk images for biometric identification of tree species.

PubMed

Bressane, Adriano; Roveda, José A F; Martins, Antônio C G

2015-04-01

The identification of tree species is a key step for sustainable management plans of forest resources, as well as for several other applications that are based on such surveys. However, the present available techniques are dependent on the presence of tree structures, such as flowers, fruits, and leaves, limiting the identification process to certain periods of the year. Therefore, this article introduces a study on the application of statistical parameters for texture classification of tree trunk images. For that, 540 samples from five Brazilian native deciduous species were acquired and measures of entropy, uniformity, smoothness, asymmetry (third moment), mean, and standard deviation were obtained from the presented textures. Using a decision tree, a biometric species identification system was constructed and resulted to a 0.84 average precision rate for species classification with 0.83accuracy and 0.79 agreement. Thus, it can be considered that the use of texture presented in trunk images can represent an important advance in tree identification, since the limitations of the current techniques can be overcome.

A Linnaeus NG (TM) interactive key to the Lithocolletinae of North-West Europe aimed at accelerating the accumulation of reliable biodiversity data (Lepidoptera, Gracillariidae).

PubMed

Doorenweerd, Camiel; van Haren, Merel M; Schermer, Maarten; Pieterse, Sander; van Nieukerken, Erik J

2014-01-01

We present an interactive key that is available online through any web browser without the need to install any additional software, making it an easily accessible tool for the larger public. The key can be found at http://identify.naturalis.nl/lithocolletinae. The key includes all 86 North-West European Lithocolletinae, a subfamily of smaller moths ("micro-moths") that is commonly not treated in field guides. The user can input data on several external morphological character systems in addition to distribution, host plant and even characteristics of the larval feeding traces to reach an identification. We expect that this will enable more people to contribute with reliable observation data on this group of moths and alleviate the workload of taxonomic specialists, allowing them to focus on other new keys or taxonomic work.

Optimizing identification and management of COPD patients - reviewing the role of the community pharmacist.

PubMed

van der Molen, Thys; van Boven, Job F M; Maguire, Terence; Goyal, Pankaj; Altman, Pablo

2017-01-01

The aim of this paper was to propose key steps for community pharmacist integration into a patient care pathway for chronic obstructive pulmonary disease (COPD) management. A literature search was conducted to identify publications focusing on the role of the community pharmacist in identification and management of COPD. The literature search highlighted evidence supporting an important role for pharmacists at each of the four key steps in the patient care pathway for COPD management. Step 1 (primary prevention): pharmacists are ideally placed to provide information on disease awareness and risk prevention campaigns, and to encourage lifestyle interventions, including smoking cessation. Step 2 (early detection/case finding): pharmacists are often the first point of contact between the patient and the healthcare system and can therefore play an important role in the early identification of patients with COPD. Step 3 (management and ongoing support): pharmacists can assist patients by providing advice and education on dosage, inhaler technique, treatment expectations and the importance of adherence, and by supporting self-management, including recognition and treatment of COPD exacerbations. Step 4 (review and follow-up): pharmacists can play an important role in monitoring adherence and ongoing inhaler technique in patients with COPD. In summary, pharmacists are ideally positioned to play a vital role in all key stages of an integrated COPD patient care pathway from early disease detection to the support of management plans, including advice and counselling regarding medications, inhaler technique and treatment adherence. Areas requiring additional consideration include pharmacist training, increasing awareness of the pharmacist role, administration and reimbursement, and increasing physician-pharmacist collaboration. © 2016 The Authors. British Journal of Clinical Pharmacology published by John Wiley & Sons Ltd on behalf of British Pharmacological Society.

Decision support environment for medical product safety surveillance.

PubMed

Botsis, Taxiarchis; Jankosky, Christopher; Arya, Deepa; Kreimeyer, Kory; Foster, Matthew; Pandey, Abhishek; Wang, Wei; Zhang, Guangfan; Forshee, Richard; Goud, Ravi; Menschik, David; Walderhaug, Mark; Woo, Emily Jane; Scott, John

2016-12-01

We have developed a Decision Support Environment (DSE) for medical experts at the US Food and Drug Administration (FDA). The DSE contains two integrated systems: The Event-based Text-mining of Health Electronic Records (ETHER) and the Pattern-based and Advanced Network Analyzer for Clinical Evaluation and Assessment (PANACEA). These systems assist medical experts in reviewing reports submitted to the Vaccine Adverse Event Reporting System (VAERS) and the FDA Adverse Event Reporting System (FAERS). In this manuscript, we describe the DSE architecture and key functionalities, and examine its potential contributions to the signal management process by focusing on four use cases: the identification of missing cases from a case series, the identification of duplicate case reports, retrieving cases for a case series analysis, and community detection for signal identification and characterization. Published by Elsevier Inc.

Identification of ATM Protein Kinase Phosphorylation Sites by Mass Spectrometry.

PubMed

Graham, Mark E; Lavin, Martin F; Kozlov, Sergei V

2017-01-01

ATM (ataxia-telangiectasia mutated) protein kinase is a key regulator of cellular responses to DNA damage and oxidative stress. DNA damage triggers complex cascade of signaling events leading to numerous posttranslational modification on multitude of proteins. Understanding the regulation of ATM kinase is therefore critical not only for understanding the human genetic disorder ataxia-telangiectasia and potential treatment strategies, but essential for deciphering physiological responses of cells to stress. These responses play an important role in carcinogenesis, neurodegeneration, and aging. We focus here on the identification of DNA damage inducible ATM phosphorylation sites to understand the importance of autophosphorylation in the mechanism of ATM kinase activation. We demonstrate the utility of using immunoprecipitated ATM in quantitative LC-MS/MS workflow with stable isotope dimethyl labeling of ATM peptides for identification of phosphorylation sites.

Updates on information about free-living marine nematodes in Brazil: new records and comments on problems in taxonomic studies.

PubMed

Venekey, Virág

2017-10-17

New records of nematode species in Brazil, which appeared after or were not mentioned in the last review, are shown in this paper. All environments were considered, including the continental margin. In addition, all studies on marine nematodes in Brazil, including grey literature, ecological papers and book chapters, are listed. Furthermore, information on genera/species richness, dominant genera, and densities is also presented. A total of 11 orders, 72 families, 372 genera, and 450 species of nematodes were recorded in Brazilian marine environments by April 2017. Following problems are discussed: taxonomic lists available only in grey literature, use of outdated identification keys (leading to incorrect identifications), and identifications mostly to putative species or to the genus level.

How the food supply harvestable by waders in the Wadden Sea depends on the variation in energy density, body weight, biomass, burying depth and behaviour of tidal-flat invertebrates

NASA Astrophysics Data System (ADS)

Zwarts, Leo; Wanink, Jan H.

For several reasons, waders in the Wadden Sea face a large seasonal and annual variation in their food supply. Observations on a tidal flat in the Dutch Wadden Sea have shown that: - (1) The average energy density of ten invertebrate prey species varies between 21 and 23 kJ·g -1 AFDW. In Scrobicularia plana and Mya arenaria, but not in Macoma balthica, the energy density is 10% lower in winter than in summer. - (2) Depending on the species, body weights of prey of similar size are 30 to 60% lower in winter than in summer. - (3) The year-to-year fluctuation in standing-crop biomass is larger in some species than in others, the difference depending mainly on the frequency of successful recruitment. The overall biomass of the macrobenthos in winter is half of that in summer, but the timing of the peak biomass differs per species. - (4) The burying depth varies per species: Cerastoderma edule live just beneath the surface, while M. balthica, S. plana, M. arenaria, Arenicola marina and Nereis diversicolor bury more deeply and the majority of these prey live out of reach of the bird's bill. In all six species, burying depth increases with size. There is no seasonal variation in depth of C. edule and M. arenaria, but the four other species live at most shallow depth in early summer and most deeply in midwinter. Burying depths in winter vary from year to year, but are unrelated to temperature. Neither has temperature any effect on depth within months. For knot Calidris canutus feeding on M. balthica, the fluctuation in the accessible fraction was the main source of variation in the biomass of prey that is actually harvestable, i.e. the biomass of prey of suitable size that is accessible. Accordingly, the paper reviews the available data on the temporal variations in accessibility, detectability, ingestibility, digestibility and profitability of prey for waders. Only a small part of the prey is harvestable since many accessible prey are ignored because of their low profitability, while many profitable prey are inaccessible. The profitability of prey depends on their size and weight but also on their depth in the mud, since handling time increases with burying depth. A simple biomechanical rule explains why the handling time of small prey increases with bill length and why large, long-billed waders ignore a disproportionately larger part of the small prey. The fraction detectable for visually feeding waders is usually very low, especially when the temperature of the substrate is below 3-6°C. Waders vary their prey choice over the year in response to the changes in the availability and profitability of their different prey species. The food supply harvestable by waders is much lower in winter than in summer. For waders wintering in the Wadden Sea, the food supply may be characterized as unpredictable and usually meagre. Waders wintering in NW Europe are concentrated in coastal sites where the average surface temperature is above 3°C. This probably cannot be explained by a greater burying depth, and only partly by a lower body condition, of prey in colder areas. Yet the harvestable fraction is lower in colder sites, especially for sight-feeding waders, as invertebrates are less active at low temperatures. However, the lower energetic cost of living and reduced chances of the prey being covered by ice may also contribute to the waders' preference for warmer sites.

Identification of key characteristics of male reproductive toxicants as an approach for screening and sorting mechanistic evidence.

EPA Science Inventory

The application of systematic review practices in human health assessment includes integration of multi-disciplinary evidence from epidemiological, experimental, and mechanistic studies. Although mode of action analysis relies on the evaluation of mechanistic and toxicological ou...

Developing leadership talent in healthcare organizations.

PubMed

Wells, Wendy; Hejna, William

2009-01-01

Effective initiatives for developing and retaining leadership talent are built around five supporting elements: Identification of key leader competencies. Effective job design. A strong focus on leadership recruitment, development, and retention. Leadership training and development throughout all levels of the organization. Ongoing leadership assessment and performance management.

Review of the genus Ceresium Newman, 1842 (Coleoptera: Cerambycidae) in Fiji

USDA-ARS?s Scientific Manuscript database

A taxonomic review of the genus Ceresium (Coleoptera: Cerambycidae) found within the Fiji Islands is presented. A total of 17 species is treated. Full morphological descriptions and comparative images of each species are included, along with a dichotomous key for their identification....

Detection of wheat powdery mildew by differentiating background factors using hyperspectral imaging

USDA-ARS?s Scientific Manuscript database

Accurate assessment of crop disease severities is the key for precision application of pesticides to prevent disease infestation. In-situ hyperspectral imaging technology can provide high-resolution imagery with spectra for rapid identification of crop disease and determining disease infestation pat...

Identification of countermeasures for unsafe driving actions. Volume 2, A review of selected literature

DOT National Transportation Integrated Search

1981-02-01

Literature on decision-making and social control was reviewed to identify key principles of human behavior that have potential for reducing the incidence of speed-too-fast and other conscious and intentional unsafe driving actions (UDAs). The review ...

14 CFR 171.27 - Performance requirements.

Code of Federal Regulations, 2010 CFR

2010-01-01

...” (Annex 10 to the Convention on International Civil Aviation), except that identification by on-off keying... electronic engineering practices for the desired service. (c) Ground inspection consists of an examination of the design features of the equipment to determine (based on recognized and accepted good engineering...

Field guide to Intermountain sedges

Treesearch

Emerenciana G. Hurd; Nancy L. Shaw; Joy Mastrogiuseppe; Lynda C. Smithman; Sherel Goodrich

1998-01-01

Descriptions of morphological characteristics, habitat, and geographic distributions are provided for 114 sedges (Carex spp.) of the Intermountain area. A dichotomous key, color photographs, line drawings, and discussions highlighting differences among similar species aid identification. An illustrated morphology, glossary, and index of common names simplify use. The...

Migration towards fibre to the home: key cost factors

NASA Astrophysics Data System (ADS)

Zhou, L. W.; Mas Machuca, C.; Zhao, R.; Grunert, K.

2010-12-01

This paper presents a comprehensive cost model for migration towards FTTH, some case study results from different network area scenarios, as well as the identification of the most important cost factors to be considered by operators aiming at increasing the profitability of their networks.

A new genus of Neotropical Monoplatina (Coleoptera: Chrysomelidae: Galerucinae: Alticini) from leaf litter

USDA-ARS?s Scientific Manuscript database

A new genus (Andersonaltica) containing four new species from Central America is described and illustrated. It is compared to Aedmon Clark, Apleuraltica Bechyne, Distigmoptera Blake, Hypolampsis Clark, and Pseudolampsis Horn and a key to identification of these genera is provided...

Application of the wavelet transform for speech processing

NASA Technical Reports Server (NTRS)

Maes, Stephane

1994-01-01

Speaker identification and word spotting will shortly play a key role in space applications. An approach based on the wavelet transform is presented that, in the context of the 'modulation model,' enables extraction of speech features which are used as input for the classification process.

Characterization anatomical leaf blade five species Nepenthes from Kerinci Seblat National Park, Kerinci regency, Jambi Province

NASA Astrophysics Data System (ADS)

Al Farishy, D. D.; Nisyawati, Metusala, D.

2017-07-01

Nepenthes is one of carnivorous plant genera which have key characters on leaf and pitcher as the modification. However, wide varieties of morphological features on pitcher intraspecies and between species could be tough for identification process. The objective was to provide alternative characters for identification process by anatomical features. Kerinci Seblat National Park was chosen because lack of update data on wild type of species there. Whole five species were collected at Lingkat Lake and Gunung Tujuh Lake as representative lowland and highland species. Leaves collected fresh, flawless, and has grown pitcher. Each leaf was separated into the paradermal and transversal section, dehydrated by series alcohol, and stained by safranin and fast green. Sections observed by light microscope. Result show there were specific differences between species that could be potential to be key characters. That features are stomatal density, stomatal length, sessile glands surface shaped, sessile glands density, trichome distribution, adaxial cuticle thickness, adaxial hypodermic thickness, and the number of layers of adaxial hypodermis

Reprogramming cell fate with a genome-scale library of artificial transcription factors.

PubMed

Eguchi, Asuka; Wleklinski, Matthew J; Spurgat, Mackenzie C; Heiderscheit, Evan A; Kropornicka, Anna S; Vu, Catherine K; Bhimsaria, Devesh; Swanson, Scott A; Stewart, Ron; Ramanathan, Parameswaran; Kamp, Timothy J; Slukvin, Igor; Thomson, James A; Dutton, James R; Ansari, Aseem Z

2016-12-20

Artificial transcription factors (ATFs) are precision-tailored molecules designed to bind DNA and regulate transcription in a preprogrammed manner. Libraries of ATFs enable the high-throughput screening of gene networks that trigger cell fate decisions or phenotypic changes. We developed a genome-scale library of ATFs that display an engineered interaction domain (ID) to enable cooperative assembly and synergistic gene expression at targeted sites. We used this ATF library to screen for key regulators of the pluripotency network and discovered three combinations of ATFs capable of inducing pluripotency without exogenous expression of Oct4 (POU domain, class 5, TF 1). Cognate site identification, global transcriptional profiling, and identification of ATF binding sites reveal that the ATFs do not directly target Oct4; instead, they target distinct nodes that converge to stimulate the endogenous pluripotency network. This forward genetic approach enables cell type conversions without a priori knowledge of potential key regulators and reveals unanticipated gene network dynamics that drive cell fate choices.

Rocket Engine Health Management: Early Definition of Critical Flight Measurements

NASA Technical Reports Server (NTRS)

Christenson, Rick L.; Nelson, Michael A.; Butas, John P.

2003-01-01

The NASA led Space Launch Initiative (SLI) program has established key requirements related to safety, reliability, launch availability and operations cost to be met by the next generation of reusable launch vehicles. Key to meeting these requirements will be an integrated vehicle health management ( M) system that includes sensors, harnesses, software, memory, and processors. Such a system must be integrated across all the vehicle subsystems and meet component, subsystem, and system requirements relative to fault detection, fault isolation, and false alarm rate. The purpose of this activity is to evolve techniques for defining critical flight engine system measurements-early within the definition of an engine health management system (EHMS). Two approaches, performance-based and failure mode-based, are integrated to provide a proposed set of measurements to be collected. This integrated approach is applied to MSFC s MC-1 engine. Early identification of measurements supports early identification of candidate sensor systems whose design and impacts to the engine components must be considered in engine design.

Identification of Cost Indicators with Significant Economic Impact on the Total Treatment Costs of Chronic Heart Failure Patients - A Meta-Analysis.

PubMed

Hameed, Ahmed S; Modre-Osprian, Robert; Schreier, Günter

2017-01-01

Increasing treatment costs of HF patients affect the initiation of appropriate treatment method. Divergent approaches to measure the costs of treatment and the lack of common cost indicators impede the comparison of therapy settings. In the context of the present meta-analysis, key cost indicators from the perspective of healthcare providers are to be identified, described, analyzed and quantified. This review helps narrowing down the cost indicators, which have the most significant economic impact on the total treatment costs of HF patients. Telemedical services are to be compared to standard therapy methods. The identification process was based on several steps. For the quantitative synthesis, we used the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) statement. An additional set of criteria was defined for the following qualitative analysis. 5 key cost indicators were identified with significant economic impact on the treatment costs of HF patients. 95% of the reported treatment costs could be captured based on the identified cost indicators.

Optical penetration-based silkworm pupa gender sensor structure.

PubMed

Sumriddetchkajorn, Sarun; Kamtongdee, Chakkrit

2012-02-01

This paper proposes and experimentally demonstrates for what is believed to be the first time a highly sought-after optical structure for highly-accurate identification of the silkworm pupa gender. The key idea is to exploit a long wavelength optical beam in the red or near infrared spectrum that can effectively and safely penetrate the body of a silkworm pupa. Later on, simple image processing operations via image thresholding, blob filtering, and image inversion processes are applied in order to eliminate the unwanted image noises and at the same time highlight the gender gland. Experimental proof of concept using three 636 nm wavelength light emitting diodes, a two-dimensional web camera, an 8 bit microcontroller board, and a notebook computer shows a very high 95.6% total accuracy in identifying the gender of 45 silkworm pupae with a measured fast identification time of 96.6 ms. Other key features include low cost, low component counts, and ease of implementation and control.

Efficient and Provable Secure Pairing-Free Security-Mediated Identity-Based Identification Schemes

PubMed Central

Chin, Ji-Jian; Tan, Syh-Yuan; Heng, Swee-Huay; Phan, Raphael C.-W.

2014-01-01

Security-mediated cryptography was first introduced by Boneh et al. in 2001. The main motivation behind security-mediated cryptography was the capability to allow instant revocation of a user's secret key by necessitating the cooperation of a security mediator in any given transaction. Subsequently in 2003, Boneh et al. showed how to convert a RSA-based security-mediated encryption scheme from a traditional public key setting to an identity-based one, where certificates would no longer be required. Following these two pioneering papers, other cryptographic primitives that utilize a security-mediated approach began to surface. However, the security-mediated identity-based identification scheme (SM-IBI) was not introduced until Chin et al. in 2013 with a scheme built on bilinear pairings. In this paper, we improve on the efficiency results for SM-IBI schemes by proposing two schemes that are pairing-free and are based on well-studied complexity assumptions: the RSA and discrete logarithm assumptions. PMID:25207333

Efficient and provable secure pairing-free security-mediated identity-based identification schemes.

PubMed

Chin, Ji-Jian; Tan, Syh-Yuan; Heng, Swee-Huay; Phan, Raphael C-W

2014-01-01

Security-mediated cryptography was first introduced by Boneh et al. in 2001. The main motivation behind security-mediated cryptography was the capability to allow instant revocation of a user's secret key by necessitating the cooperation of a security mediator in any given transaction. Subsequently in 2003, Boneh et al. showed how to convert a RSA-based security-mediated encryption scheme from a traditional public key setting to an identity-based one, where certificates would no longer be required. Following these two pioneering papers, other cryptographic primitives that utilize a security-mediated approach began to surface. However, the security-mediated identity-based identification scheme (SM-IBI) was not introduced until Chin et al. in 2013 with a scheme built on bilinear pairings. In this paper, we improve on the efficiency results for SM-IBI schemes by proposing two schemes that are pairing-free and are based on well-studied complexity assumptions: the RSA and discrete logarithm assumptions.

Identification of interleukin genes in Pogona vitticeps using a de novo transcriptome assembly from RNA-seq data.

PubMed

Livernois, Alexandra; Hardy, Kristine; Domaschenz, Renae; Papanicolaou, Alexie; Georges, Arthur; Sarre, Stephen D; Rao, Sudha; Ezaz, Tariq; Deakin, Janine E

2016-10-01

Interleukins are a group of cytokines with complex immunomodulatory functions that are important for regulating immunity in vertebrate species. Reptiles and mammals last shared a common ancestor more than 350 million years ago, so it is not surprising that low sequence identity has prevented divergent interleukin genes from being identified in the central bearded dragon lizard, Pogona vitticeps, in its genome assembly. To determine the complete nucleotide sequences of key interleukin genes, we constructed full-length transcripts, using the Trinity platform, from short paired-end read RNA sequences from stimulated spleen cells. De novo transcript reconstruction and analysis allowed us to identify interleukin genes that are missing from the published P. vitticeps assembly. Identification of key cytokines in P. vitticeps will provide insight into the essential molecular mechanisms and evolution of interleukin gene families and allow for characterization of the immune response in a lizard for comparison with mammals.

Genetic and environmental pathways to complex diseases.

PubMed

Gohlke, Julia M; Thomas, Reuben; Zhang, Yonqing; Rosenstein, Michael C; Davis, Allan P; Murphy, Cynthia; Becker, Kevin G; Mattingly, Carolyn J; Portier, Christopher J

2009-05-05

Pathogenesis of complex diseases involves the integration of genetic and environmental factors over time, making it particularly difficult to tease apart relationships between phenotype, genotype, and environmental factors using traditional experimental approaches. Using gene-centered databases, we have developed a network of complex diseases and environmental factors through the identification of key molecular pathways associated with both genetic and environmental contributions. Comparison with known chemical disease relationships and analysis of transcriptional regulation from gene expression datasets for several environmental factors and phenotypes clustered in a metabolic syndrome and neuropsychiatric subnetwork supports our network hypotheses. This analysis identifies natural and synthetic retinoids, antipsychotic medications, Omega 3 fatty acids, and pyrethroid pesticides as potential environmental modulators of metabolic syndrome phenotypes through PPAR and adipocytokine signaling and organophosphate pesticides as potential environmental modulators of neuropsychiatric phenotypes. Identification of key regulatory pathways that integrate genetic and environmental modulators define disease associated targets that will allow for efficient screening of large numbers of environmental factors, screening that could set priorities for further research and guide public health decisions.

Reprogramming cell fate with a genome-scale library of artificial transcription factors

PubMed Central

Eguchi, Asuka; Wleklinski, Matthew J.; Spurgat, Mackenzie C.; Heiderscheit, Evan A.; Kropornicka, Anna S.; Vu, Catherine K.; Bhimsaria, Devesh; Swanson, Scott A.; Stewart, Ron; Ramanathan, Parameswaran; Kamp, Timothy J.; Slukvin, Igor; Thomson, James A.; Dutton, James R.; Ansari, Aseem Z.

2016-01-01

Artificial transcription factors (ATFs) are precision-tailored molecules designed to bind DNA and regulate transcription in a preprogrammed manner. Libraries of ATFs enable the high-throughput screening of gene networks that trigger cell fate decisions or phenotypic changes. We developed a genome-scale library of ATFs that display an engineered interaction domain (ID) to enable cooperative assembly and synergistic gene expression at targeted sites. We used this ATF library to screen for key regulators of the pluripotency network and discovered three combinations of ATFs capable of inducing pluripotency without exogenous expression of Oct4 (POU domain, class 5, TF 1). Cognate site identification, global transcriptional profiling, and identification of ATF binding sites reveal that the ATFs do not directly target Oct4; instead, they target distinct nodes that converge to stimulate the endogenous pluripotency network. This forward genetic approach enables cell type conversions without a priori knowledge of potential key regulators and reveals unanticipated gene network dynamics that drive cell fate choices. PMID:27930301

Identification of Key Odorants in Withering-Flavored Green Tea by Aroma Extract Dilution Analysis

NASA Astrophysics Data System (ADS)

Mizukami, Yuzo; Yamaguchi, Yuichi

This research aims to identify key odorants in withering-flavored green tea. Application of the aroma extract dilution analysis using the volatile fraction of green tea and withering-flavored green tea revealed 25 and 35 odor-active peaks with the flavor dilution factors of≥4, respectively. 4-mercapto-4-methylpentan-2-one, (E)-2-nonenal, linalool, (E,Z)-2,6-nonadienal and 3-methylnonane-2,4-dione were key odorants in green tea with the flavor dilution factor of≥16. As well as these 5 odorants, 1-octen-3-one, β-damascenone, geraniol, β-ionone, (Z)-methyljasmonate, indole and coumarine contributed to the withering flavor of green tea.

funRNA: a fungi-centered genomics platform for genes encoding key components of RNAi.

PubMed

Choi, Jaeyoung; Kim, Ki-Tae; Jeon, Jongbum; Wu, Jiayao; Song, Hyeunjeong; Asiegbu, Fred O; Lee, Yong-Hwan

2014-01-01

RNA interference (RNAi) is involved in genome defense as well as diverse cellular, developmental, and physiological processes. Key components of RNAi are Argonaute, Dicer, and RNA-dependent RNA polymerase (RdRP), which have been functionally characterized mainly in model organisms. The key components are believed to exist throughout eukaryotes; however, there is no systematic platform for archiving and dissecting these important gene families. In addition, few fungi have been studied to date, limiting our understanding of RNAi in fungi. Here we present funRNA http://funrna.riceblast.snu.ac.kr/, a fungal kingdom-wide comparative genomics platform for putative genes encoding Argonaute, Dicer, and RdRP. To identify and archive genes encoding the abovementioned key components, protein domain profiles were determined from reference sequences obtained from UniProtKB/SwissProt. The domain profiles were searched using fungal, metazoan, and plant genomes, as well as bacterial and archaeal genomes. 1,163, 442, and 678 genes encoding Argonaute, Dicer, and RdRP, respectively, were predicted. Based on the identification results, active site variation of Argonaute, diversification of Dicer, and sequence analysis of RdRP were discussed in a fungus-oriented manner. funRNA provides results from diverse bioinformatics programs and job submission forms for BLAST, BLASTMatrix, and ClustalW. Furthermore, sequence collections created in funRNA are synced with several gene family analysis portals and databases, offering further analysis opportunities. funRNA provides identification results from a broad taxonomic range and diverse analysis functions, and could be used in diverse comparative and evolutionary studies. It could serve as a versatile genomics workbench for key components of RNAi.

Workplace exposure to engineered nanomaterials: the Italian path for the definition of occupational health and safety policies.

PubMed

Mirabile, Marco; Boccuni, Fabio; Gagliardi, Diana; Rondinone, Bruna Maria; Iavicoli, Sergio

2014-07-01

This study explores the way the publication of a National White Book on health and safety risks that affect workers in jobs involving Nanotechnologies and Nanomaterials influenced the key Italian stakeholders attitude toward this issue and identifies the standpoints and priorities shared among researchers and stakeholders to develop a policy framework to address this issue. The study not only highlights some important assumptions (i.e. the acknowledgment by the key stakeholders of the need for actions and the identification of objectives which can gain a wide consensus) for the establishment of a policy community that sustains the development of a policymaking process on the issue but, through the interaction between stakeholders and OSH researchers, it also identifies some in nuce proposals that represent the starting point for policy interventions aimed at meeting the needs of both stakeholders and scientific community. Results obtained in terms of clarification of interests at stake, identification of potential areas of consensus and level of key national actors' engagement achieved, show the potentialities of adopting a knowledge based and inclusive approach to policy-making to address the issue of prevention and management of health and safety risks related to technological innovation within a framework of scientific uncertainty. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

The specific diagnosis of gastrointestinal nematode infections in livestock: larval culture technique, its limitations and alternative DNA-based approaches.

PubMed

Roeber, Florian; Kahn, Lewis

2014-10-15

The specific diagnosis of gastrointestinal nematode infections in ruminants is routinely based on larval culture technique and on the morphological identification of developed third-stage larvae. However, research on the ecology and developmental requirements of different species suggests that environmental conditions (e.g., temperature and humidity) for optimal development to occur vary between the different species. Thus, employing a common culture protocol for all species will favour the development of certain species over others and can cause a biased result in particular when species proportions in a mixed infection are to be determined. Furthermore, the morphological identification of L3 larvae is complicated by a lack of distinctive, obvious features that would allow the identification of all key species. In the present paper we review in detail the potential limitations of larval culture technique and morphological identification and provide account to some modern molecular alternatives to the specific diagnosis of gastrointestinal nematode infection in ruminants. Copyright © 2014 Elsevier B.V. All rights reserved.

Forensic odontology: A prosthodontic view

PubMed Central

Gosavi, Sulekha; Gosavi, Siddharth

2012-01-01

The most common role of the forensic dentist is the identification of deceased individuals. Dental identifications have always played a key role in natural and manmade disaster situations, and in particular, the mass casualties normally associated with aviation disasters. Because of the lack of a comprehensive fingerprint database, dental identification continues to be crucial in the world. An all-acrylic resin appliance such as a full denture or an all-acrylic partial denture (or orthodontic appliance), prior to delivery, could be inscribed with the patient's full name on a substrate (paper, metal) and sealed inconspicuously into the surface of a denture by various processes. It has been noted by several authors that in many cases of air disaster where the limbs are completely burnt off, some denture materials survive, especially the posterior part of acrylic dentures and metal-based dentures. Thus, marked dental prostheses (full and partial dentures, mouthguards and removal orthodontic appliances) would lead to rapid identification in the event of accidents and disaster. PMID:23087581

Hit Identification and Optimization in Virtual Screening: Practical Recommendations Based Upon a Critical Literature Analysis

PubMed Central

Zhu, Tian; Cao, Shuyi; Su, Pin-Chih; Patel, Ram; Shah, Darshan; Chokshi, Heta B.; Szukala, Richard; Johnson, Michael E.; Hevener, Kirk E.

2013-01-01

A critical analysis of virtual screening results published between 2007 and 2011 was performed. The activity of reported hit compounds from over 400 studies was compared to their hit identification criteria. Hit rates and ligand efficiencies were calculated to assist in these analyses and the results were compared with factors such as the size of the virtual library and the number of compounds tested. A series of promiscuity, drug-like, and ADMET filters were applied to the reported hits to assess the quality of compounds reported and a careful analysis of a subset of the studies which presented hit optimization was performed. This data allowed us to make several practical recommendations with respect to selection of compounds for experimental testing, defining hit identification criteria, and general virtual screening hit criteria to allow for realistic hit optimization. A key recommendation is the use of size-targeted ligand efficiency values as hit identification criteria. PMID:23688234

Identification of JAK/STAT pathway regulators—Insights from RNAi screens

PubMed Central

Müller, Patrick; Boutros, Michael; Zeidler, Martin P.

2008-01-01

While many core JAK/STAT pathway components have been discovered in Drosophila via classical genetic approaches, the identification of pathway regulators has been more challenging. Recently two cell-based RNAi screens for JAK/STAT pathway regulators have been undertaken using libraries of double-stranded RNAs targeting a large proportion of the predicted Drosophila transcriptome. While both screens identified multiple regulators, only relatively few loci are common to both data sets. Here we compare the two screens and discuss these differences. Although many factors are likely to be contributory, differences in the assay design are of key importance. Low levels of stimulation favouring the identification of negative pathway regulators and high levels of stimulation favouring the identification of positively acting factors. Ultimately, the results from both screens are likely to be largely complementary and have identified a range of novel candidate regulators of JAK/STAT pathway activity as a starting point for new research directions in the future. PMID:18586112

A TaqMan real-time PCR-based assay for the identification of Fasciola spp.

PubMed

Alasaad, Samer; Soriguer, Ramón C; Abu-Madi, Marawan; El Behairy, Ahmed; Jowers, Michael J; Baños, Pablo Díez; Píriz, Ana; Fickel, Joerns; Zhu, Xing-Quan

2011-06-30

Real time quantitative PCR (qPCR) is one of the key technologies of the post-genome era, with clear advantages compared to normal end-point PCR. In this paper, we report the first qPCR-based assay for the identification of Fasciola spp. Based on sequences of the second internal transcribed spacers (ITS-2) of the ribosomal rRNA gene, we used a set of genus-specific primers for Fasciola ITS-2 amplification, and we designed species-specific internal TaqMan probes to identify F. hepatica and F. gigantica, as well as the hybrid 'intermediate'Fasciola. These primers and probes were used for the highly specific, sensitive, and simple identification of Fasciola species collected from different animal host from China, Spain, Niger and Egypt. The novel qPCR-based technique for the identification of Fasciola spp. may provide a useful tool for the epidemiological investigation of Fasciola infection, including their intermediate snail hosts. Copyright © 2011 Elsevier B.V. All rights reserved.

Data-driven mono-component feature identification via modified nonlocal means and MEWT for mechanical drivetrain fault diagnosis

NASA Astrophysics Data System (ADS)

Pan, Jun; Chen, Jinglong; Zi, Yanyang; Yuan, Jing; Chen, Binqiang; He, Zhengjia

2016-12-01

It is significant to perform condition monitoring and fault diagnosis on rolling mills in steel-making plant to ensure economic benefit. However, timely fault identification of key parts in a complicated industrial system under operating condition is still a challenging task since acquired condition signals are usually multi-modulated and inevitably mixed with strong noise. Therefore, a new data-driven mono-component identification method is proposed in this paper for diagnostic purpose. First, the modified nonlocal means algorithm (NLmeans) is proposed to reduce noise in vibration signals without destroying its original Fourier spectrum structure. During the modified NLmeans, two modifications are investigated and performed to improve denoising effect. Then, the modified empirical wavelet transform (MEWT) is applied on the de-noised signal to adaptively extract empirical mono-component modes. Finally, the modes are analyzed for mechanical fault identification based on Hilbert transform. The results show that the proposed data-driven method owns superior performance during system operation compared with the MEWT method.

A Novel Binarization Algorithm for Ballistics Firearm Identification

NASA Astrophysics Data System (ADS)

Li, Dongguang

The identification of ballistics specimens from imaging systems is of paramount importance in criminal investigation. Binarization plays a key role in preprocess of recognizing cartridges in the ballistic imaging systems. Unfortunately, it is very difficult to get the satisfactory binary image using existing binary algorithms. In this paper, we utilize the global and local thresholds to enhance the image binarization. Importantly, we present a novel criterion for effectively detecting edges in the images. Comprehensive experiments have been conducted over sample ballistic images. The empirical results demonstrate the proposed method can provide a better solution than existing binary algorithms.

Identification of potent, nonabsorbable agonists of the calcium-sensing receptor for GI-specific administration.

PubMed

Sparks, Steven M; Spearing, Paul K; Diaz, Caroline J; Cowan, David J; Jayawickreme, Channa; Chen, Grace; Rimele, Thomas J; Generaux, Claudia; Harston, Lindsey T; Roller, Shane G

2017-10-15

Modulation of gastrointestinal nutrient sensing pathways provides a promising a new approach for the treatment of metabolic diseases including diabetes and obesity. The calcium-sensing receptor has been identified as a key receptor involved in mineral and amino acid nutrient sensing and thus is an attractive target for modulation in the intestine. Herein we describe the optimization of gastrointestinally restricted calcium-sensing receptor agonists starting from a 3-aminopyrrolidine-containing template leading to the identification of GI-restricted agonist 19 (GSK3004774). Copyright © 2017 Elsevier Ltd. All rights reserved.

The Real maccoyii: Identifying Tuna Sushi with DNA Barcodes – Contrasting Characteristic Attributes and Genetic Distances

PubMed Central

Lowenstein, Jacob H.; Amato, George; Kolokotronis, Sergios-Orestis

2009-01-01

Background The use of DNA barcodes for the identification of described species is one of the least controversial and most promising applications of barcoding. There is no consensus, however, as to what constitutes an appropriate identification standard and most barcoding efforts simply attempt to pair a query sequence with reference sequences and deem identification successful if it falls within the bounds of some pre-established cutoffs using genetic distance. Since the Renaissance, however, most biological classification schemes have relied on the use of diagnostic characters to identify and place species. Methodology/Principal Findings Here we developed a cytochrome c oxidase subunit I character-based key for the identification of all tuna species of the genus Thunnus, and compared its performance with distance-based measures for identification of 68 samples of tuna sushi purchased from 31 restaurants in Manhattan (New York City) and Denver, Colorado. Both the character-based key and GenBank BLAST successfully identified 100% of the tuna samples, while the Barcode of Life Database (BOLD) as well as genetic distance thresholds, and neighbor-joining phylogenetic tree building performed poorly in terms of species identification. A piece of tuna sushi has the potential to be an endangered species, a fraud, or a health hazard. All three of these cases were uncovered in this study. Nineteen restaurant establishments were unable to clarify or misrepresented what species they sold. Five out of nine samples sold as a variant of “white tuna” were not albacore (T. alalunga), but escolar (Lepidocybium flavorunneum), a gempylid species banned for sale in Italy and Japan due to health concerns. Nineteen samples were northern bluefin tuna (T. thynnus) or the critically endangered southern bluefin tuna (T. maccoyii), though nine restaurants that sold these species did not state these species on their menus. Conclusions/Significance The Convention on International Trade Endangered Species (CITES) requires that listed species must be identifiable in trade. This research fulfills this requirement for tuna, and supports the nomination of northern bluefin tuna for CITES listing in 2010. PMID:19924239

78 FR 66698 - Pesticides; Repellency Awareness Graphic; Notice of Availability

Federal Register 2010, 2011, 2012, 2013, 2014

2013-11-06

... information you consider to be Confidential Business Information (CBI) or other information whose disclosure... products for quick and easy identification by the consumer. Prototypes of this graphic were presented to... from several key stakeholder groups. Starting in May 2012, EPA presented the concept, draft guidance...

Assessing the Effectiveness of the International Counterproliferation Program

DTIC Science & Technology

2011-01-01

a box labeled “Ongoing needs assessment.” Within this box are the two key planning actions that contribute to this type of assessment: identification ...nation, all participating countries tend to receive a fairly standardized set of courses. This course lineup is determined largely by the ICP

Root parasites of southern forests

Treesearch

Lytton J. Musselman; William F. Mann

1978-01-01

The five families of root parasites of the South are discussed relative to selection of hosts, ecology, and potential for damage to commercial species. An identification key to all genera of root parasites is included. Plants and flowers of 29 species are illustrated and their distribution in the South mapped.

New Dicranoptycha Osten Sacken, 1859 Crane flies (Diptera: Limoniidae) of North and South Korea.

PubMed

Podenas, Sigitas; Byun, Hye-Woo; Kim, Sam-Kyu

2015-02-27

Two new species of Dicranoptycha Osten Sacken, 1859, crane flies (Diptera, Limoniidae) from the Korean peninsula are described, illustrated and compared with already known and related species. An identification key and check-list of all Korean Dicranoptycha is presented.

Taxonomic concepts and practice with complex microbial communities

USDA-ARS?s Scientific Manuscript database

This brief review discusses the main points of the Keynote Lecture to be given at the 3rd International Conference on Microbial Diversity, October 27-29, 2015, Perugia, Italy. Key points include the necessity of molecular identification of microorganisms in order to understand their ecology. DNA-bas...

Documenting taxonomic data quality for field fish identifications: a proposal for national surveys

EPA Science Inventory

The U.S. Environmental Protection Agency is in the midst of a multiyear series of natinal surveys of water resource conditions. Because communicating ecological condition is the primary objective of the surveys, quantitative biological indicators are key. Thus, if raw taxonomic d...

NG9-1-1 transition issues report.

DOT National Transportation Integrated Search

2008-02-01

A key outcome of the U.S. Department of Transportation (USDOT) Next Generation 9-1-1 : (NG9-1-1) Initiative is the identification of well-supported options and crucial transition issues : for migrating from todays 9-1-1 system to a NG9-1-1 system ...

Generic Skills. Keys to Job Performance.

ERIC Educational Resources Information Center

Smith, Arthur De W.

The generic skills studies in Canada have as their objectives the formulation of generic skills, the identification of their uses for certain occupational groups, and the preparation of specifications for instructional modules in an attempt to provide greater flexibility to workers, employers, and vocational training programs. Another objective of…

Material Analysis and Identification

NASA Technical Reports Server (NTRS)

2004-01-01

KeyMaster Technologies, Inc., develops and markets specialized, hand-held X-ray fluorescence (XRF) instruments and unique tagging technology used to identify and authenticate materials or processes. NASA first met with this Kennewick, Washington-based company as the Agency began seeking companies to develop a hand-held instrument that would detect data matrix symbols on parts covered by paint and other coatings. Since the Federal Aviation Administration was also searching for methods to detect and eliminate the use of unapproved parts, it recommended that NASA and KeyMaster work together to develop a technology that would benefit both agencies.

Multi-cultural components and keys for European worldwide space programs

NASA Astrophysics Data System (ADS)

Pinotti, Roberto

1991-12-01

The role of different cultures in space missions is considered with regard to NASA and ESA astronauts and Russian cosmonauts. The identification of all the psychological and socio-anthropological components in the behavior of human groups in space is extremely important to understand and solve different problems and obtain the mission's success. In this light, the creation of a multicultural atmosphere aboard is considered a positive aspect for future space programs, and the synthesis of European cultural elements is a definite key to develop morale and productivity.

Ultrasonic attenuation measurements determine onset, degree, and completion of recrystallization

NASA Technical Reports Server (NTRS)

Generazio, E. R.

1988-01-01

Ultrasonic attenuation was measured for cold worked Nickel 200 samples annealed at increasing temperatures. Localized dislocation density variations, crystalline order and volume percent of recrystallized phase were determined over the anneal temperature range using transmission electron microscopy, X-ray diffraction, and metallurgy. The exponent of the frequency dependence of the attenuation was found to be a key variable relating ultrasonic attenuation to the thermal kinetics of the recrystallization process. Identification of this key variable allows for the ultrasonic determination of onset, degree, and completion of recrystallization.

Mobile-PKI Service Model for Ubiquitous Environment

NASA Astrophysics Data System (ADS)

Jeun, Inkyung; Chun, Kilsoo

One of the most important things in PKI(Public Key Infrastructure) is the private key management issue. The private key must be deal with safely for secure PKI service. Even though PKI service is usually used for identification and authentication of user in e-commerce, PKI service has many inconvenient factors. Especially, the fact that storage media of private key for PKI service is limited to PC hard disk drive or smart card users must always carry, gives an inconvenience to user and is not suitable in ubiquitous network. This paper suggests the digital signature service using a mobile phone(m-PKI service) which is suitable in future network. A mobile phone is the most widely used for personal communication means and has a characteristic of high movability. We can use the PKI service anytime and anywhere using m-PKI.

Target identification for small bioactive molecules: finding the needle in the haystack.

PubMed

Ziegler, Slava; Pries, Verena; Hedberg, Christian; Waldmann, Herbert

2013-03-04

Identification and confirmation of bioactive small-molecule targets is a crucial, often decisive step both in academic and pharmaceutical research. Through the development and availability of several new experimental techniques, target identification is, in principle, feasible, and the number of successful examples steadily grows. However, a generic methodology that can successfully be applied in the majority of the cases has not yet been established. Herein we summarize current methods for target identification of small molecules, primarily for a chemistry audience but also the biological community, for example, the chemist or biologist attempting to identify the target of a given bioactive compound. We describe the most frequently employed experimental approaches for target identification and provide several representative examples illustrating the state-of-the-art. Among the techniques currently available, protein affinity isolation using suitable small-molecule probes (pulldown) and subsequent mass spectrometric analysis of the isolated proteins appears to be most powerful and most frequently applied. To provide guidance for rapid entry into the field and based on our own experience we propose a typical workflow for target identification, which centers on the application of chemical proteomics as the key step to generate hypotheses for potential target proteins. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Influence of Biochemical Features of Burkholderia pseudomallei Strains on Identification Reliability by Vitek 2 System

PubMed Central

Zakharova, Irina B; Lopasteyskaya, Yana A; Toporkov, Andrey V; Viktorov, Dmitry V

2018-01-01

Background: Burkholderia pseudomallei is a Gram-negative saprophytic soil bacterium that causes melioidosis, a potentially fatal disease endemic in wet tropical areas. The currently available biochemical identification systems can misidentify some strains of B. pseudomallei. The aim of the present study was to identify the biochemical features of B. pseudomallei, which can affect its correct identification by Vitek 2 system. Materials and Methods: The biochemical patterns of 40 B. pseudomallei strains were obtained using Vitek 2 GN cards. The average contribution of biochemical tests in overall dissimilarities between correctly and incorrectly identified strains was assessed using nonmetric multidimensional scaling. Results: It was found (R statistic of 0.836, P = 0.001) that a combination of negative N-acetyl galactosaminidase, β-N-acetyl glucosaminidase, phosphatase, and positive D-cellobiase (dCEL), tyrosine arylamidase (TyrA), and L-proline arylamidase (ProA) tests leads to low discrimination of B. pseudomallei, whereas a set of positive dCEL and negative N-acetyl galactosaminidase, TyrA, and ProA determines the wrong identification of B. pseudomallei as Burkholderia cepacia complex. Conclusion: The further expansion of the Vitek 2 identification keys is needed for correct identification of atypical or regionally distributed biochemical profiles of B. pseudomallei. PMID:29563716

A network identity authentication system based on Fingerprint identification technology

NASA Astrophysics Data System (ADS)

Xia, Hong-Bin; Xu, Wen-Bo; Liu, Yuan

2005-10-01

Fingerprint verification is one of the most reliable personal identification methods. However, most of the automatic fingerprint identification system (AFIS) is not run via Internet/Intranet environment to meet today's increasing Electric commerce requirements. This paper describes the design and implementation of the archetype system of identity authentication based on fingerprint biometrics technology, and the system can run via Internet environment. And in our system the COM and ASP technology are used to integrate Fingerprint technology with Web database technology, The Fingerprint image preprocessing algorithms are programmed into COM, which deployed on the internet information server. The system's design and structure are proposed, and the key points are discussed. The prototype system of identity authentication based on Fingerprint have been successfully tested and evaluated on our university's distant education applications in an internet environment.

Early identification and interventions for students with mathematics difficulties.

PubMed

Gersten, Russell; Jordan, Nancy C; Flojo, Jonathan R

2005-01-01

This article highlights key findings from the small body of research on mathematics difficulties (MD) relevant to early identification and early intervention. The research demonstrates that (a) for many children, mathematics difficulties are not stable over time; (b) the presence of reading difficulties seems related to slower progress in many aspects of mathematics; (c) almost all students with MD demonstrate problems with accurate and automatic retrieval of basic arithmetic combinations, such as 6 + 3. The following measures appear to be valid and reliable indicators of potential MD in kindergartners: (a) magnitude comparison (i.e., knowing which digit in a pair is larger), (b) sophistication of counting strategies, (c) fluent identification of numbers, and (d) working memory (as evidenced by reverse digit span). These are discussed in terms of the components of number sense. Implications for early intervention strategies are explored.

Why eyewitnesses fail

PubMed Central

Albright, Thomas D.

2017-01-01

Eyewitness identifications play an important role in the investigation and prosecution of crimes, but it is well known that eyewitnesses make mistakes, often with serious consequences. In light of these concerns, the National Academy of Sciences recently convened a panel of experts to undertake a comprehensive study of current practice and use of eyewitness testimony, with an eye toward understanding why identification errors occur and what can be done to prevent them. The work of this committee led to key findings and recommendations for reform, detailed in a consensus report entitled Identifying the Culprit: Assessing Eyewitness Identification. In this review, I focus on the scientific issues that emerged from this study, along with brief discussions of how these issues led to specific recommendations for additional research, best practices for law enforcement, and use of eyewitness evidence by the courts. PMID:28739937

Synopsis of the cyclocephaline scarab beetles (Coleoptera, Scarabaeidae, Dynastinae)

PubMed Central

Moore, Matthew R.; Cave, Ronald D.; Branham, Marc A.

2018-01-01

Abstract The cyclocephaline scarabs (Scarabaeidae: Dynastinae: Cyclocephalini) are a speciose tribe of beetles that include species that are ecologically and economically important as pollinators and pests of agriculture and turf. We provide an overview and synopsis of the 14 genera of Cyclocephalini that includes information on: 1) the taxonomic and nomenclatural history of the group; 2) diagnosis and identification of immature life-stages; 3) economic importance in agroecosystems; 4) natural enemies of these beetles; 5) use as food by humans; 6) the importance of adults as pollination mutualists; 7) fossil cyclocephalines and the evolution of the group; 8) generic-level identification of adults. We provide an expanded identification key to genera of world Cyclocephalini and diagnoses for each genus. Character illustrations and generic-level distribution maps are provided along with discussions on the relationships of the tribe’s genera. PMID:29670448

Synopsis of the cyclocephaline scarab beetles (Coleoptera, Scarabaeidae, Dynastinae).

PubMed

Moore, Matthew R; Cave, Ronald D; Branham, Marc A

2018-01-01

The cyclocephaline scarabs (Scarabaeidae: Dynastinae: Cyclocephalini) are a speciose tribe of beetles that include species that are ecologically and economically important as pollinators and pests of agriculture and turf. We provide an overview and synopsis of the 14 genera of Cyclocephalini that includes information on: 1) the taxonomic and nomenclatural history of the group; 2) diagnosis and identification of immature life-stages; 3) economic importance in agroecosystems; 4) natural enemies of these beetles; 5) use as food by humans; 6) the importance of adults as pollination mutualists; 7) fossil cyclocephalines and the evolution of the group; 8) generic-level identification of adults. We provide an expanded identification key to genera of world Cyclocephalini and diagnoses for each genus. Character illustrations and generic-level distribution maps are provided along with discussions on the relationships of the tribe's genera.

Preliminary studies of cotton non-lint content identification by near-infrared spectroscopy

USDA-ARS?s Scientific Manuscript database

The high demand for cotton production worldwide has presented a need for its standardized classification. There currently exists trained classers and instrumentation to distinguish key cotton quality parameters, such as some trash types and content. However, it is of interest to develop a universal...

Identification and Addressing Reduction-Related Misconceptions

ERIC Educational Resources Information Center

Gal-Ezer, Judith; Trakhtenbrot, Mark

2016-01-01

Reduction is one of the key techniques used for problem-solving in computer science. In particular, in the theory of computation and complexity (TCC), mapping and polynomial reductions are used for analysis of decidability and computational complexity of problems, including the core concept of NP-completeness. Reduction is a highly abstract…

Review of the genus Ceresium Newman, 1842 (Coleoptera, Cerambycidae) in Fiji

PubMed Central

Waqa-Sakiti, Hilda; Winder, Linton; Lingafelter, Steven W.

2015-01-01

Abstract A taxonomic review of the genus Ceresium (Coleoptera: Cerambycidae) found within the Fiji Islands is presented. A total of 17 species is treated. Full morphological descriptions and comparative images of each species are included, along with a dichotomous key for their identification. PMID:26692805

New Visions, New Voices: Future Directions in the Care and Education of Young Children.

ERIC Educational Resources Information Center

Williams, Leslie R.

1989-01-01

This article outlines key issues in early childhood education related to (1) identification and characterization of the populations to be served, (2) definition of the goals of services, (3) preparation of early childhood specialists, and (4) optimal settings for delivery of service. (IAH)

Performance Indicators in Math: Implications for Brief Experimental Analysis of Academic Performance

ERIC Educational Resources Information Center

VanDerheyden, Amanda M.; Burns, Matthew K.

2009-01-01

Brief experimental analysis (BEA) can be used to specify intervention characteristics that produce positive learning gains for individual students. A key challenge to the use of BEA for intervention planning is the identification of performance indicators (including topography of the skill, measurement characteristics, and decision criteria) that…

Aspen community types of the Intermountain Region

Treesearch

Walter F. Mueggler

1988-01-01

This vegetation classification is based upon existing community structure and composition in the aspen-dominated forests of the Intermountain Region of the Forest Service. The 56 community types occur within eight tree-cover types. A diagnostic key using indicator species facilitates field identification of the community types. Vegetational composition, productivity,...

Issues Involved in the Evaluation of Gifted Programmes.

ERIC Educational Resources Information Center

Ali, A. Sidiq

2001-01-01

This article discusses the purpose of gifted program evaluation and identifies some of the pertinent issues involved in evaluating gifted programs. The gifted program delivered by the Peel District Board of Education in Ontario, Canada, is used to illustrate key evaluation considerations, including gifted identification procedures and gifted…

Metabolomics for Undergraduates: Identification and Pathway Assignment of Mitochondrial Metabolites

ERIC Educational Resources Information Center

Marques, Ana Patrícia; Serralheiro, Maria Luisa; Ferreira, António E. N.; Freire, Ana Ponces; Cordeiro, Carlos; Silva, Marta Sousa

2016-01-01

Metabolomics is a key discipline in systems biology, together with genomics, transcriptomics, and proteomics. In this omics cascade, the metabolome represents the biochemical products that arise from cellular processes and is often regarded as the final response of a biological system to environmental or genetic changes. The overall screening…

International Teachers' Judgment of Gifted Mathematics Student Characteristics

ERIC Educational Resources Information Center

Ficici, Abdullah; Siegle, Del

2008-01-01

Teachers play a key role in the identification and training of talented mathematicians, and their attitudes are important in improving math instruction for gifted students. We surveyed secondary mathematics teachers from South Korea, Turkey, and the United States. These teachers completed a survey instrument called the Teachers' Judgments of…

INTEGRATING FIELD-BASED SAMPLING AND LANDSCAPE DATA FOR REGIONAL SCALE ASSESSMENTS: EXAMPLES FROM THE UNITED STATES MID-ATLANTIC REGION

EPA Science Inventory

Spatially explicit identification of status and changes in ecological conditions over large, regional areas is key to targeting and prioritizing areas for potential further study and environmental protection and restoration. A critical limitation to this point has been our abili...

Host-pathogen interactions: A cholera surveillance system

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wright, Aaron T.

2016-02-22

Bacterial pathogen-secreted proteases may play a key role in inhibiting a potentially widespread host-pathogen interaction. Activity-based protein profiling enabled the identification of a major Vibrio cholerae serine protease that limits the ability of a host-derived intestinal lectin to bind to the bacterial pathogen in vivo.

Identification of Nutritional Stress-Responsive miRNAs in Phaseolus vulgaris

USDA-ARS?s Scientific Manuscript database

MicroRNAs (miRNAs) are key regulators for Arabidopsis development and stress responses. A hybridization approach using miRNAs-macroarrays was used to identify miRNAs that respond to nutritional stress in Phaseolus vulgaris. miRNAs-macroarrays were prepared by printing nylon filters with DNA syntheti...

Sexual Harassment Identification and Prevention.

ERIC Educational Resources Information Center

Anderson, Patricia L.

1993-01-01

School administrators should develop a clear policy statement prohibiting sexual harassment; create guidelines to implement the policy; and designate a key administrator to oversee and ensure compliance with laws related to sexual harassment. Lists steps for dealing with a claim, what teachers can do to protect themselves from claims, and what a…

Performance Measurement for Public Services in Academic and Research Libraries. Occasional Paper Number #9.

ERIC Educational Resources Information Center

Cronin, Mary J.

This paper defines performance measurement as the clarification of objectives and standards, identification of key activities, data collection and analysis, and formative evaluation of services. It then examines some of the factors involved in using performance measurement to evaluate public services activities, and analyzes performance…

Field guide to forest plants of northern Idaho

Treesearch

Patricia A. Patterson; Kenneth E. Neiman; Jonalea K. Tonn

1985-01-01

This field guide -- designed for use by people with minimal botanical training -- is an identification aid for nearly 200 plant species having ecological indicator value in northern Idaho forest habitat types. It contains line drawings, simplified taxonomic descriptions , characteristics tables, conspectuses, and keys. It emphasizes characteristics useful for field...

THE CONSEQUENCES OF LANDSCAPE CHANGE ON ECOLOGICAL RESOURCES: AN ASSESSMENT OF THE UNITED STATES MID-ATLANTIC REGION

EPA Science Inventory

Spatially explicit identification of changes in ecological conditions over large areas is key to targeting and prioritizing areas for environmental protection and restoration by managers at watershed, basin, and regional scales. A critical limitation to this point has bee...

Cost of Pre-School Education Provision.

ERIC Educational Resources Information Center

Gilder, Paula; Jardine, Paul; Guerin, Sinead

1998-01-01

This study examined the current costs of preschool education in Scotland. Eleven preschool centers were studied in order to facilitate identification of key issues and to assist in designing the main questionnaire. Study findings indicated that main issues were the extent of between-center differences, information availability, and the use of…

SPATIAL PATTERN OF FUTURE VULNERABILITY OF STREAM EUTROPHICATION IN THE MID-ATLANTIC REGION OF THE UNITED STATES

EPA Science Inventory

Spatially explicit identification of changes in ecological conditions over large areas is key to targeting and prioritizing areas for environmental protection and restoration by managers at watershed, basin, and regional scales. A critical limitation to this point has been the d...

Taxonomic revision of the Afrotropical bee genus Serapista Cockerell (Hymenoptera: Apoidea: Megachilidae: Megachilinae: Anthidiini)

USDA-ARS?s Scientific Manuscript database

The southern African bee genus Serapista Cockerell is revised. It comprises four previously described species and one new species, Serapista aspernigra sp. nov. One new synonymy is proposed, namely Serapista rhodesiana is synonymised with Serapista serrata. Keys for the identification of the species...

Commentary: Using Potential Outcomes to Understand Causal Mediation Analysis

ERIC Educational Resources Information Center

Imai, Kosuke; Jo, Booil; Stuart, Elizabeth A.

2011-01-01

In this commentary, we demonstrate how the potential outcomes framework can help understand the key identification assumptions underlying causal mediation analysis. We show that this framework can lead to the development of alternative research design and statistical analysis strategies applicable to the longitudinal data settings considered by…

Continuing Medical Education, Needs Assessment, and Program Development: Theoretical Constructs.

ERIC Educational Resources Information Center

Aherne, Michael; Lamble, Wayne; Davis, Paul

2001-01-01

Continuing medical education needs assessment should be reconceived for a changing health-care environment. The physician-patient relationship is being changed by empowerment of health consumers and public policy concerns regarding the health care system. Needs assessment should focus on environmental scanning, identification of key forces, use of…

The Prioninae (Coleoptera: Cerambycidae) of Hispaniola with diagnoses, descriptions of new species, distribution records, and key for identification

USDA-ARS?s Scientific Manuscript database

The Prioninae (Cerambycidae) of Hispaniola are reviewed. Tweny-seven species are known from the island, including five new ones and a new genus described herein: Elateropsis dichroma Lingafelter, new species, Elateropsis woodleyi Lingafelter, new species, Solenoptera tomentosa Lingafelter, new spec...

EVALUATION OF HOST SPECIFIC PCR-BASED METHODS FOR THE IDENTIFICATION OF FECAL POLLUTION

EPA Science Inventory

Microbial Source Tracking (MST) is an approach to determine the origin of fecal pollution impacting a body of water. MST is based on the assumption that, given the appropriate method and indicator, the source of microbial pollution can be identified. One of the key elements of...

40 CFR 264.19 - Construction quality assurance program.

Code of Federal Regulations, 2013 CFR

2013-07-01

.... Compliance with the hydraulic conductivity requirements must be verified by using in-situ testing on the... specifications in the permit. The program must be developed and implemented under the direction of a CQA officer... description of how they will be constructed. (2) Identification of key personnel in the development and...

40 CFR 264.19 - Construction quality assurance program.

Code of Federal Regulations, 2010 CFR

2010-07-01

.... Compliance with the hydraulic conductivity requirements must be verified by using in-situ testing on the... specifications in the permit. The program must be developed and implemented under the direction of a CQA officer... description of how they will be constructed. (2) Identification of key personnel in the development and...

Principles of visual key construction-with a visual identification key to the Fagaceae of the southeastern United States.

PubMed

Kirchoff, Bruce K; Leggett, Roxanne; Her, Va; Moua, Chue; Morrison, Jessica; Poole, Chamika

2011-01-01

Advances in digital imaging have made possible the creation of completely visual keys. By a visual key we mean a key based primarily on images, and that contains a minimal amount of text. Characters in visual keys are visually, not verbally defined. In this paper we create the first primarily visual key to a group of taxa, in this case the Fagaceae of the southeastern USA. We also modify our recently published set of best practices for image use in illustrated keys to make them applicable to visual keys. Photographs of the Fagaceae were obtained from internet and herbarium databases or were taken specifically for this project. The images were printed and then sorted into hierarchical groups. These hierarchical groups of images were used to create the 'couplets' in the key. A reciprocal process of key creation and testing was used to produce the final keys. Four keys were created, one for each of the parts-leaves, buds, fruits and bark. Species description pages consisting of multiple images were also created for each of the species in the key. Creation and testing of the key resulted in a modified list of best practices for image use visual keys. The inclusion of images into paper and electronic keys has greatly increased their ease of use. However, virtually all of these keys are still based upon verbally defined, atomistic characters. The creation of primarily visual keys allows us to overcome the well-known limitations of linguistic-based characters and create keys that are much easier to use, especially for botanical novices.

Optical key system

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hagans, K.G.; Clough, R.E.

2000-04-25

An optical key system comprises a battery-operated optical key and an isolated lock that derives both its operating power and unlock signals from the correct optical key. A light emitting diode or laser diode is included within the optical key and is connected to transmit a bit-serial password. The key user physically enters either the code-to-transmit directly, or an index to a pseudorandom number code, in the key. Such person identification numbers can be retained permanently, or ephemeral. When a send button is pressed, the key transmits a beam of light modulated with the password information. The modulated beam ofmore » light is received by a corresponding optical lock with a photovoltaic cell that produces enough power from the beam of light to operate a password-screen digital logic. In one application, an acceptable password allows a two watt power laser diode to pump ignition and timing information over a fiberoptic cable into a sealed engine compartment. The receipt of a good password allows the fuel pump, spark, and starter systems to each operate. Therefore, bypassing the lock mechanism as is now routine with automobile thieves is pointless because the engine is so thoroughly disabled.« less

Optical key system

DOEpatents

Hagans, Karla G.; Clough, Robert E.

2000-01-01

An optical key system comprises a battery-operated optical key and an isolated lock that derives both its operating power and unlock signals from the correct optical key. A light emitting diode or laser diode is included within the optical key and is connected to transmit a bit-serial password. The key user physically enters either the code-to-transmit directly, or an index to a pseudorandom number code, in the key. Such person identification numbers can be retained permanently, or ephemeral. When a send button is pressed, the key transmits a beam of light modulated with the password information. The modulated beam of light is received by a corresponding optical lock with a photovoltaic cell that produces enough power from the beam of light to operate a password-screen digital logic. In one application, an acceptable password allows a two watt power laser diode to pump ignition and timing information over a fiberoptic cable into a sealed engine compartment. The receipt of a good password allows the fuel pump, spark, and starter systems to each operate. Therefore, bypassing the lock mechanism as is now routine with automobile thieves is pointless because the engine is so thoroughly disabled.

Perception of touch quality in piano tones.

PubMed

Goebl, Werner; Bresin, Roberto; Fujinaga, Ichiro

2014-11-01

Both timbre and dynamics of isolated piano tones are determined exclusively by the speed with which the hammer hits the strings. This physical view has been challenged by pianists who emphasize the importance of the way the keyboard is touched. This article presents empirical evidence from two perception experiments showing that touch-dependent sound components make sounds with identical hammer velocities but produced with different touch forms clearly distinguishable. The first experiment focused on finger-key sounds: musicians could identify pressed and struck touches. When the finger-key sounds were removed from the sounds, the effect vanished, suggesting that these sounds were the primary identification cue. The second experiment looked at key-keyframe sounds that occur when the key reaches key-bottom. Key-bottom impact was identified from key motion measured by a computer-controlled piano. Musicians were able to discriminate between piano tones that contain a key-bottom sound from those that do not. However, this effect might be attributable to sounds associated with the mechanical components of the piano action. In addition to the demonstrated acoustical effects of different touch forms, visual and tactile modalities may play important roles during piano performance that influence the production and perception of musical expression on the piano.

Demonstration of a single-wavelength spectral-imaging-based Thai jasmine rice identification

NASA Astrophysics Data System (ADS)

Suwansukho, Kajpanya; Sumriddetchkajorn, Sarun; Buranasiri, Prathan

2011-07-01

A single-wavelength spectral-imaging-based Thai jasmine rice breed identification is demonstrated. Our nondestructive identification approach relies on a combination of fluorescent imaging and simple image processing techniques. Especially, we apply simple image thresholding, blob filtering, and image subtracting processes to either a 545 or a 575nm image in order to identify our desired Thai jasmine rice breed from others. Other key advantages include no waste product and fast identification time. In our demonstration, UVC light is used as our exciting light, a liquid crystal tunable optical filter is used as our wavelength seclector, and a digital camera with 640activepixels×480activepixels is used to capture the desired spectral image. Eight Thai rice breeds having similar size and shape are tested. Our experimental proof of concept shows that by suitably applying image thresholding, blob filtering, and image subtracting processes to the selected fluorescent image, the Thai jasmine rice breed can be identified with measured false acceptance rates of <22.9% and <25.7% for spectral images at 545 and 575nm wavelengths, respectively. A measured fast identification time is 25ms, showing high potential for real-time applications.

The neural substrates of action identification.

PubMed

Marsh, Abigail A; Kozak, Megan N; Wegner, Daniel M; Reid, Marguerite E; Yu, Henry H; Blair, R J R

2010-12-01

Mentalization is the process by which an observer views a target as possessing higher cognitive faculties such as goals, intentions and desires. Mentalization can be assessed using action identification paradigms, in which observers choose mentalistic (goals-focused) or mechanistic (action-focused) descriptions of targets' actions. Neural structures that play key roles in inferring goals and intentions from others' observed or imagined actions include temporo-parietal junction, ventral premotor cortex and extrastriate body area. We hypothesized that these regions play a role in action identification as well. Data collected using functional magnetic resonance imaging (fMRI) confirmed our predictions that activity in ventral premotor cortex and middle temporal gyrus near the extrastriate body area varies both as a function of the valence of the target and the extent to which actions are identified as goal-directed. In addition, the inferior parietal lobule is preferentially engaged when participants identify the actions of mentalized targets. Functional connectivity analyses suggest support from other regions, including the medial prefrontal cortex and amygdala, during mentalization. We found correlations between action identification and Autism Quotient scores, suggesting that understanding the neural correlates of action identification may enhance our understanding of the underpinnings of essential social cognitive processes.

Identification of environmental sounds and melodies in syndromes of anterior temporal lobe degeneration.

PubMed

Golden, Hannah L; Downey, Laura E; Fletcher, Philip D; Mahoney, Colin J; Schott, Jonathan M; Mummery, Catherine J; Crutch, Sebastian J; Warren, Jason D

2015-05-15

Recognition of nonverbal sounds in semantic dementia and other syndromes of anterior temporal lobe degeneration may determine clinical symptoms and help to define phenotypic profiles. However, nonverbal auditory semantic function has not been widely studied in these syndromes. Here we investigated semantic processing in two key nonverbal auditory domains - environmental sounds and melodies - in patients with semantic dementia (SD group; n=9) and in patients with anterior temporal lobe atrophy presenting with behavioural decline (TL group; n=7, including four cases with MAPT mutations) in relation to healthy older controls (n=20). We assessed auditory semantic performance in each domain using novel, uniform within-modality neuropsychological procedures that determined sound identification based on semantic classification of sound pairs. Both the SD and TL groups showed comparable overall impairments of environmental sound and melody identification; individual patients generally showed superior identification of environmental sounds than melodies, however relative sparing of melody over environmental sound identification also occurred in both groups. Our findings suggest that nonverbal auditory semantic impairment is a common feature of neurodegenerative syndromes with anterior temporal lobe atrophy. However, the profile of auditory domain involvement varies substantially between individuals. Copyright © 2015. Published by Elsevier B.V.

[Discussion on appraisal methods and key technologies of arbuscular mycorrhizal fungi and medicinal plant symbiosis system].

PubMed

Chen, Meilan; Guo, Lanping; Yang, Guang; Chen, Min; Yang, Li; Huang, Luqi

2011-11-01

Applications of arbuscular mycorrhizal fungi in research of medicinal plant cultivation are increased in recent years. Medicinal plants habitat is complicated and many inclusions are in root, however crop habitat is simple and few inclusions in root. So appraisal methods and key technologies about the symbiotic system of crop and arbuscular mycorrhizal fungi can't completely suitable for the symbiotic system of medicinal plants and arbuscular mycorrhizal fungi. This article discuss the appraisal methods and key technologies about the symbiotic system of medicinal plant and arbuscular mycorrhizal fungi from the isolation and identification of arbuscular mycorrhiza, and the appraisal of colonization intensity. This article provides guidance for application research of arbuscular mycorrhizal fungi in cultivation of medicinal plants.

Space station data system analysis/architecture study. Task 3: Trade studies, DR-5, volume 1

NASA Technical Reports Server (NTRS)

1985-01-01

The primary objective of Task 3 is to provide additional analysis and insight necessary to support key design/programmatic decision for options quantification and selection for system definition. This includes: (1) the identification of key trade study topics; (2) the definition of a trade study procedure for each topic (issues to be resolved, key inputs, criteria/weighting, methodology); (3) conduct tradeoff and sensitivity analysis; and (4) the review/verification of results within the context of evolving system design and definition. The trade study topics addressed in this volume include space autonomy and function automation, software transportability, system network topology, communications standardization, onboard local area networking, distributed operating system, software configuration management, and the software development environment facility.

Key enablers to facilitate healthy behavior change: workshop summary.

PubMed

Teyhen, Deydre S; Aldag, Matt; Centola, Damon; Edinborough, Elton; Ghannadian, Jason D; Haught, Andrea; Jackson, Theresa; Kinn, Julie; Kunkler, Kevin J; Levine, Betty; Martindale, Valerie E; Neal, David; Snyder, Leslie B; Styn, Mindi A; Thorndike, Frances; Trabosh, Valerie; Parramore, David J

2014-05-01

The increases in preventable chronic diseases and the rising costs of health care are unsustainable. The US Army Surgeon General's vision to transition from a health care system to a system of health requires the identification of key health enablers to facilitate the adoption of healthy behaviors. In support of this vision, the US Army Telemedicine and Advanced Technology Research Center hosted a workshop in April 2013 titled "Incentives to Create and Sustain Change for Health." Members of government and academia participated to identify key health enablers that could ultimately be leveraged by technology. The key health enablers discussed included (1) public health messaging, (2) changing health habits and the environmental influence on health, (3) goal setting and tracking, (4) the role of incentives in behavior-change intervention, and (5) the role of peer and social networks on change. This report summarizes leading evidence and the group consensus on evidence-based practices with respect to the key enablers in creating healthy behavior change.

Nutrition, frailty, and sarcopenia.

PubMed

Cruz-Jentoft, Alfonso J; Kiesswetter, Eva; Drey, Michael; Sieber, Cornel C

2017-02-01

Frailty and sarcopenia are important concepts in the quest to prevent physical dependence, as geriatrics are shifting towards identifications of early stages of disability. Definitions of both sarcopenia and frailty are still developing, and both concepts clearly overlap in their physical aspects. Malnutrition (both undernutrition and obesity) plays a key role in the pathogenesis of frailty and sarcopenia. The quality of the diet along the lifespan has a close relation with the incidence of both entities, and nutritional interventions may be able to reduce the incidence or revert either of them. This brief review explores the role of energy and protein intake and other key nutrients on muscle function. Nutrition may be a key element of multimodal interventions for frailty and sarcopenia. The results of the "Sarcopenia and Physical fRailty IN older people: multi-componenT Treatment strategies" (SPRINTT) trial will offer key insights on the effect of such interventions in frail, sarcopenic older individuals.

A pavement Moisture Accelerated Distress (MAD) identification system, volume 2

NASA Astrophysics Data System (ADS)

Carpenter, S. H.; Darter, M. I.; Dempsey, B. J.

1981-09-01

A users manual is designed which provides the engineer with a rational method of examining a pavement and determining rehabilitation needs that are related to the causes of the existing distress, particularly moisture related distress. The key elements in this procedure are the MAD Index developed in Volume 1, the Pavement Condition Index (PCI) and the Moisture Distress Index (MDI). Step by step procedures are presented for calculating each parameter. Complete distress identification manuals are included for asphalt surfaced highways and jointed reinforced concrete highways with pictures and descriptions of all major distress types. Descriptions of the role moisture plays in the development of each distress type are included.

A digital reference collection for aquatic macroinvertebrates of North America

USGS Publications Warehouse

Walters, David; Ford, Morgan A; Zuellig, Robert E.

2017-01-01

Aquatic invertebrates are a key component of freshwater ecosystems, and understanding aquatic invertebrate taxonomy is a cornerstone of freshwater science. Physical reference collections of expertly identified voucher specimens are the ‘gold-standard’ used to confirm specimen identifications. However, most biologists lack access to such collections, which themselves tend to be highly regionalized and somewhat limited in terms of taxonomic scope. The North American Aquatic Macroinvertebrate Digital Reference Collection (NAAMDRC; https://sciencebase.usgs.gov/naamdrc) was developed by the US Geological Survey (USGS) to overcome these limitations of physical collections. NAAMDRC provides users with public-domain, high-quality digital photographs to help verify specimen identifications.

Optics and materials research for controlled radiant energy transfer in buildings

NASA Astrophysics Data System (ADS)

Goldner, R. B.

1983-11-01

The overall objective of the Tufts research program was to identify and attempt to solve some of the key materials problems associated with practical approaches for achieving controlled radiant energy transfer (CRET) through building windows and envelopes, so as to decrease heating and cooling loads in buildings. Major accomplishments included: the identification of electrochromic (EC)-based structures as the preferred structures for achieving CRET; the identification of modulated reflectivity as the preferred mode of operation for EC-based structures; demonstration of the feasibility of operating EC-materials in a modulated R(lambda) mode; and demonstration of the applicability of free electron model to colored polycrystalline WO3 films.

Optimizing the Performance of Radionuclide Identification Software in the Hunt for Nuclear Security Threats

DOE Office of Scientific and Technical Information (OSTI.GOV)

Fotion, Katherine A.

2016-08-18

The Radionuclide Analysis Kit (RNAK), my team’s most recent nuclide identification software, is entering the testing phase. A question arises: will removing rare nuclides from the software’s library improve its overall performance? An affirmative response indicates fundamental errors in the software’s framework, while a negative response confirms the effectiveness of the software’s key machine learning algorithms. After thorough testing, I found that the performance of RNAK cannot be improved with the library choice effect, thus verifying the effectiveness of RNAK’s algorithms—multiple linear regression, Bayesian network using the Viterbi algorithm, and branch and bound search.

Systematic Localization and Identification of SUMOylation Substrates in Knock-In Mice Expressing Affinity-Tagged SUMO1.

PubMed

Tirard, Marilyn; Brose, Nils

2016-01-01

Protein SUMOylation is a posttranslational protein modification that is emerging as a key regulatory process in neurobiology. To date, however, SUMOylation in vivo has only been studied cursorily. Knock-in mice expressing His6-HA-SUMO1 from the Sumo1 locus allow for the highly specific localization and identification of endogenous SUMO1 substrates under physiological and pathophysiological conditions. By making use of the HA-tag and using wild-type mice for highly stringent negative control samples, SUMO1 targets can be specifically localized in and purified from cultured mouse nerve cells and mouse tissues.

Smart phones: platform enabling modular, chemical, biological, and explosives sensing

NASA Astrophysics Data System (ADS)

Finch, Amethist S.; Coppock, Matthew; Bickford, Justin R.; Conn, Marvin A.; Proctor, Thomas J.; Stratis-Cullum, Dimitra N.

2013-05-01

Reliable, robust, and portable technologies are needed for the rapid identification and detection of chemical, biological, and explosive (CBE) materials. A key to addressing the persistent threat to U.S. troops in the current war on terror is the rapid detection and identification of the precursor materials used in development of improvised explosive devices, homemade explosives, and bio-warfare agents. However, a universal methodology for detection and prevention of CBE materials in the use of these devices has proven difficult. Herein, we discuss our efforts towards the development of a modular, robust, inexpensive, pervasive, archival, and compact platform (android based smart phone) enabling the rapid detection of these materials.

Water-clover ferns, Marsilea, in the Southeastern United States

USGS Publications Warehouse

Jacono, Colette C.; Johnson, David M.

2006-01-01

A surge in the collection of exotic Marsilea, M. mutica, M. minuta and M. hirsuta in the southeastern United States has prompted the need for updated identification aids. This study provides an annotated key to all water-clover ferns occurring in the region. It describes and illustrates recently documented exotic species and a previously misidentified western introduction. It details the rediscovery of M. ancylopoda, presumed extinct, and confirms its identification as the western species M. oligospora. Finally it clarifies the status and distribution of two additional western North American species introduced to the southeast, M. vestita and M. macropoda.

Endodontic management of mandibular first molars with mid mesial canal: A case series.

PubMed

Nagmode, Pradnya Sunil; Patel, Ankit Vasant; Satpute, Archana Bhaskar; Gupta, Pooja L

2017-01-01

The purpose of this study is to demonstrate the importance of knowledge of the internal anatomy of root canals for the success of endodontic treatment. Lack of knowledge of anatomic variations and their characteristics in different teeth has been pointed out as one of the main cause of endodontic therapy failure. Dental operating microscope plays a key role in the identification of canal and success of endodontic treatment. This case series describes the endodontic treatment of mandibular first molars with extra root canals, evaluate the occurrence of this extra canal, and discuss the importance of their identification and treatment.

[Identification characters of leaf morphological and venation pattern of Houttuynia cordata with its confused herb Gymnotheca chinensis].

PubMed

Lu, Hai-Lin; Guo, Min; Liao, Yue-Kui; Huang, Ding-Ying; Huang, Chun-Ni; Wu, Xiao-Chen; He, Bao-Zuo

2012-11-01

To study the identification characters of Houttuynia cordata and its confused herb Gymnotheca chinensis and establish an identification method. LMVP (leaf morphological-venation pattern for identification Chinese herbs), and QAERM (quantitatively analyze and evaluate reliability for the method of identification Chinese herbs) were applied for the study. Both venations were brochidodromous-acrodromous and arising from the mid-petiole or the upper section of petiole. The main characteristic of the leaf of Houttuynia cordata: surface with small gray-white stoma protuberances; Ligulate process of stipule-petiole sheath were clear; Primary veins 7 or 5; The innermost pair of primary vein closed up the top of the sinus at blade base or above sinus, and the section of closed vein was straight; Emitted a smell of fish when fresh leaf was kneaded into pieces. The main feature of the leaf of Gymnotheca chinensis: no small gray-white stoma protuberances; Ligulate process of stipule-petiole sheath were not clear; Primary veins 5; The innermost pair of primary vein closed into the sinus at blade base, and the section of closed vein was slightly curve; No smell of fish. With the mentioned key differences, the both plants could be successfully identified from each other. The accuracy of identification results (AC) was 100%, the repeatability of identification results: agreement rate for observation (ARO) was 100% and Kappa value was 1.00. The established method is simple, rapid, economic and reliable.

Identification of Microorganisms by High Resolution Tandem Mass Spectrometry with Accurate Statistical Significance

NASA Astrophysics Data System (ADS)

Alves, Gelio; Wang, Guanghui; Ogurtsov, Aleksey Y.; Drake, Steven K.; Gucek, Marjan; Suffredini, Anthony F.; Sacks, David B.; Yu, Yi-Kuo

2016-02-01

Correct and rapid identification of microorganisms is the key to the success of many important applications in health and safety, including, but not limited to, infection treatment, food safety, and biodefense. With the advance of mass spectrometry (MS) technology, the speed of identification can be greatly improved. However, the increasing number of microbes sequenced is challenging correct microbial identification because of the large number of choices present. To properly disentangle candidate microbes, one needs to go beyond apparent morphology or simple `fingerprinting'; to correctly prioritize the candidate microbes, one needs to have accurate statistical significance in microbial identification. We meet these challenges by using peptidome profiles of microbes to better separate them and by designing an analysis method that yields accurate statistical significance. Here, we present an analysis pipeline that uses tandem MS (MS/MS) spectra for microbial identification or classification. We have demonstrated, using MS/MS data of 81 samples, each composed of a single known microorganism, that the proposed pipeline can correctly identify microorganisms at least at the genus and species levels. We have also shown that the proposed pipeline computes accurate statistical significances, i.e., E-values for identified peptides and unified E-values for identified microorganisms. The proposed analysis pipeline has been implemented in MiCId, a freely available software for Microorganism Classification and Identification. MiCId is available for download at http://www.ncbi.nlm.nih.gov/CBBresearch/Yu/downloads.html.

Modelling benthic macrofauna and seagrass distribution patterns in a North Sea tidal basin in response to 2050 climatic and environmental scenarios

NASA Astrophysics Data System (ADS)

Singer, Anja; Millat, Gerald; Staneva, Joanna; Kröncke, Ingrid

2017-03-01

Small-scale spatial distribution patterns of seven macrofauna species, seagrass beds and mixed mussel/oyster reefs were modelled for the Jade Bay (North Sea, Germany) in response to climatic and environmental scenarios (representing 2050). For the species distribution models four presence-absence modelling methods were merged within the ensemble forecasting platform 'biomod2'. The present spatial distribution (representing 2009) was modelled by statistically related species presences, true species absences and six high-resolution environmental grids. The future spatial distribution was then predicted in response to expected climate change-induced ongoing (1) sea-level rise and (2) water temperature increase. Between 2009 and 2050, the present and future prediction maps revealed a significant range gain for two macrofauna species (Macoma balthica, Tubificoides benedii), whereas the species' range sizes of five macrofauna species remained relatively stable across space and time. The predicted probability of occurrence (PO) of two macrofauna species (Cerastoderma edule, Scoloplos armiger) decreased significantly under the potential future habitat conditions. In addition, a clear seagrass bed extension (Zostera noltii) on the lower intertidal flats (mixed sediments) and a decrease in the PO of mixed Mytilus edulis/Crassostrea gigas reefs was predicted for 2050. Until the mid-21st century, our future climatic and environmental scenario revealed significant changes in the range sizes (gains-losses) and/or the PO (increases-decreases) for seven of the 10 modelled species at the study site.

Azoxyglycoside content and beta-glycosidase activities in leaves of various cycads.

PubMed

Yagi, Fumio

2004-12-01

Azoxyglycoside contents in leaves of 32 cycad species belonging to 10 cycad genera and the seeds of 4 Encephalartos species were analyzed by HPLC with a YMC-PA03 amide column. Azoxyglycosides were detected in mature leaves of 14 cycad species including 2 Bowenia, 2 Lepidozamia, 1 Microcycas, and 1 Stangeria species, but not in mature leaves of 18 other cycad species; 2 of 3 Ceratozamia, 1 of 3 Cycas, 3 of 3 Dioon, 10 of 11 Encephalartos, 1 of 3 Macrozamia and 1 of 3 Zamia species analyzed. The ratios of beta-glycosidase activity toward cycasin and macrozamin in extracts from the leaves of 9 species belonging to 9 genera were measured. The hydrolysis of cycasin was higher in the leaf extracts of Cycas revoluta, Bowenia spectabilis, Stangeria eriopus and Ceratozamia mexicana, whereas in Lepidozamia hopei, the hydrolysis levels of cycasin and macrozamin were similar. On the other hand, activity toward macrozamin was higher in Dioon edule, Encephalartos villosus, Macrozamia miquelii and Zamia fischeri. The hydrolytic activities in most species were estimated to be sufficient for the release of methylazoxymethanol in leaves analogous to the cyanogenesis of cyanogenic plants. Therefore, hydrolysis of azoxyglycosides by endogenous glycosidase in leaves seems to occur by accidental injury of leaves. However, in M. miquelii leaf extract, hydrolytic activity toward macrozamin was high and the activity toward cycasin was very low, though only cycasin was found in the leaves of this species.

Evolutionary and tissue-specific control of expression of multiple acyl-carrier protein isoforms in plants and bacteria.

PubMed

Battey, J F; Ohlrogge, J B

1990-02-01

We have examined the occurrence of multiple acyl-carrier protein (ACP), isoforms in evolutionarily diverse species of higher and lower plants. Isoforms were resolved by native polyacrylamide gel electrophoresis (PAGE), and were detected by Western blotting or fluorography of [(3)H]-palmitate-labelled ACPs. Multiple isoforms of ACP were found in leaf tissue of the monocotyledons Avena sativa and Hordeum vulgare and dicotyledons Arabidopsis thaliana, Cuphea wrightii, and Brassica napus. Lower vascular plants including the lycopod Selaginella krausseriana, the gymnosperms Ephedra sp. and Dioon edule, the ferns Davallia feejensis and Marsilea sp. and the most primitive known extant vascular plant, Psilotum nudum, were all found to have multiple ACP isoforms, as were the nonvascular liverworts, Lunularia sp. and Marchantia sp. and the moss, Polytrichum sp. Therefore, the development of ACP isoforms appears to have occurred early in plant evolution. However, we could detect only a single electrophoretic form of ACP in the unicellular algae Chlamydomonas reinhardtii and Dunaliella tertiolecta and the photosynthetic cyanobacteria Synechocystis strain 6803 and Agmnellum quadruplicatum. Thus, multiple forms of ACP do not occur in all photosynthetic organisms but may be associated with multicellular plants. We have also examined tissue specificity and light control over the expression of ACP isoforms. The relative abundance of multiple forms of ACP in leaf of Spinacia and Avena was altered very little by light. Rather, the different patterns of ACP isoforms were primarily dependent on the tissue type.

Effects of complex carbon addition to soil CO2 efflux and isotopic composition to soils near dead and live piñon pine trees

NASA Astrophysics Data System (ADS)

Powers, H.; McDowell, N.; Breecker, D. O.

2010-12-01

We test the hypothesis that soils collected near dead and living pinus edulous (piñon pine) trees should show a difference in their capacities to decompose complex carbon compounds. Since soils near dead trees have a large amount of cellulose and other complex carbon, the soil microbial community should be selected to metabolize cellulose. We collected soils from both live and dead piñon trees, added cellulose to half of the replicates, and placed them in microcosms for incubation. The microcosms were periodically sampled by a trace gas analyzer (TGA100, Campbell Scientific, USA) for CO2 concentration and δ13C and δ18O analysis. We found that CO2 evolution rates from live soils were significantly higher than rates from dead soils (1.1 and 0.6 ug CO2 g-1 soil s-1 respectively); soils with added cellulose displayed higher rates (1.1 and 0.8 and ug CO2 g-1 soil s-1). We did not see any significant differences in δ13C values between treatments, but there was a difference in δ18O between soils treated with cellulose and soils with no cellulose. Soils from both dead and live trees showed an increase in CO2 efflux when cellulose was added; however there was no distinguishable difference in efflux rate between live and dead soils in the cellulose added treatments.

Biology of Anastrepha grandis (Diptera: Tephritidae) in Different Cucurbits.

PubMed

Bolzan, Anderson; Nava, Dori E; Garcia, Flávio R M; Valgas, Ricardo A; Smaniotto, Giovani

2015-06-01

Anastrepha grandis (Macquart) (Diptera: Tephritidae) is one of the main pests of cucurbits in Brazil. Losses occur due to the damage caused to the fruits and the embargo on exports, as A. grandis is considered a quarantine pest in countries that import Brazilian cucurbits. This study aimed to evaluate the development of A. grandis in hosts of the Cucurbitaceae family. The hosts used were stem squash (Cucurbita pepo L.), squash (Cucurbita moschata Duchesne), chayote [Sechium edule (Jacq.) Swartz], mini watermelon [Citrullus lanatus (Thunb.) Matsum & Nakai], Spanish melon (Cucumis melo L.), hybrid squash "Tetsukabuto" (C. moschata×Cucurbita maxima Duchesne), and salad cucumber (Cucumis sativus L.). We evaluated the viability and duration of egg-to-pupa period, pupal weight, sex ratio, and average number of pupae per fruit under controlled conditions of temperature, relative humidity, and photophase. The preoviposition and oviposition periods, fecundity, fertility, and longevity of females were determined for adults. Hosts of the genus Cucurbita provided a better development of A. grandis in comparison with other hosts, and presented a greater number of insects on fruit as well as higher infestation rate. Fecundity and longevity were also higher for females that developed in hosts of the genus Cucurbita, although values of these biological parameters varied between stem squash, squash, hybrid squash "Tetsukabuto." © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Identification of a key structural element for protein folding within beta-hairpin turns.

PubMed

Kim, Jaewon; Brych, Stephen R; Lee, Jihun; Logan, Timothy M; Blaber, Michael

2003-05-09

Specific residues in a polypeptide may be key contributors to the stability and foldability of the unique native structure. Identification and prediction of such residues is, therefore, an important area of investigation in solving the protein folding problem. Atypical main-chain conformations can help identify strains within a folded protein, and by inference, positions where unique amino acids may have a naturally high frequency of occurrence due to favorable contributions to stability and folding. Non-Gly residues located near the left-handed alpha-helical region (L-alpha) of the Ramachandran plot are a potential indicator of structural strain. Although many investigators have studied mutations at such positions, no consistent energetic or kinetic contributions to stability or folding have been elucidated. Here we report a study of the effects of Gly, Ala and Asn substitutions found within the L-alpha region at a characteristic position in defined beta-hairpin turns within human acidic fibroblast growth factor, and demonstrate consistent effects upon stability and folding kinetics. The thermodynamic and kinetic data are compared to available data for similar mutations in other proteins, with excellent agreement. The results have identified that Gly at the i+3 position within a subset of beta-hairpin turns is a key contributor towards increasing the rate of folding to the native state of the polypeptide while leaving the rate of unfolding largely unchanged.

UHPLC-QqQ-MS/MS identification, quantification of polyphenols from Passiflora subpeltata fruit pulp and determination of nutritional, antioxidant, α-amylase and α-glucosidase key enzymes inhibition properties.

PubMed

Shanmugam, Saravanan; Gomes, Isla Alcântara; Denadai, Marina; Dos Santos Lima, Bruno; de Souza Araújo, Adriano Antunes; Narain, Narendra; Neta, Maria Terezinha Santos Leite; Serafini, Mairim Russo; Quintans-Júnior, Lucindo José; Thangaraj, Parimelazhagan

2018-06-01

The diabetic key enzymes inhibition, nutritional, antioxidant activity and bioactive compounds identification of Passiflora subpeltata fruit pulp were investigated. Fifteen polyphenolic compounds including protocatechuic acid, ferulic acid, vanillic acid, epicatechin, p-coumaric acid, cinnamic acid, eriodictyol and quercetin-3-glucoside were identified in the pulp of this species by using UHPLC-QqQ-MS/MS analysis. The total carbohydrates and crude protein contents in fruit pulp were 2.62 mg glucose equivalent/g sample fruit pulp and 8.80 mg BSA equivalent/g sample fruit pulp, respectively. The fresh fruit pulp of P. subpeltata contained high total phenolic (724.76 mg GAE/g sample) content and it revealed very high DPPH • (IC 50 of 5.667 μg/mL) and ABTS +• (6794.96 μM trolox equivalent/g sample) scavenging activities. In the key enzymes assays useful for diabetic inhibition the fresh fruit pulp characterized maximum inhibition of α-amylase and α-glucosidase IC 50 of 18.69 and 32.63 μg/mL, respectively. Thus, these results lead to conclude that this fruit specie could be very useful source in nutraceutical products preparations for Type 2 diabetic suffering humans. Copyright © 2018 Elsevier Ltd. All rights reserved.

Visualization and Enabling Science at PO.DAAC

NASA Astrophysics Data System (ADS)

Tauer, E.; To, C.

2017-12-01

Facilitating the identification of appropriate data for scientific inquiry is important for efficient progress, but mechanisms for that identification vary, as does the effectiveness of those mechanisms. Appropriately crafted visualizations provide the means to quickly assess science data and scientific features, but providing the right visualization to the right application can present challenges. Even greater is the challenge of generating and/or re-constituting visualizations on the fly, particularly for large datasets. One avenue to mitigate the challenge is to arrive at an optimized intermediate data format that is tuned for rapid processing without sacrificing the provenance trace back to the original source data. This presentation will discuss the results of trading several current approaches towards an intermediate data format, and suggest a list of key attributes that will facilitate rapid visualization, and in the process, facilitate the identification of the right data for a given application.

A Corticothalamic Circuit Model for Sound Identification in Complex Scenes

PubMed Central

Otazu, Gonzalo H.; Leibold, Christian

2011-01-01

The identification of the sound sources present in the environment is essential for the survival of many animals. However, these sounds are not presented in isolation, as natural scenes consist of a superposition of sounds originating from multiple sources. The identification of a source under these circumstances is a complex computational problem that is readily solved by most animals. We present a model of the thalamocortical circuit that performs level-invariant recognition of auditory objects in complex auditory scenes. The circuit identifies the objects present from a large dictionary of possible elements and operates reliably for real sound signals with multiple concurrently active sources. The key model assumption is that the activities of some cortical neurons encode the difference between the observed signal and an internal estimate. Reanalysis of awake auditory cortex recordings revealed neurons with patterns of activity corresponding to such an error signal. PMID:21931668

A subsystem identification method based on the path concept with coupling strength estimation

NASA Astrophysics Data System (ADS)

Magrans, Francesc Xavier; Poblet-Puig, Jordi; Rodríguez-Ferran, Antonio

2018-02-01

For complex geometries, the definition of the subsystems is not a straightforward task. We present here a subsystem identification method based on the direct transfer matrix, which represents the first-order paths. The key ingredient is a cluster analysis of the rows of the powers of the transfer matrix. These powers represent high-order paths in the system and are more affected than low-order paths by damping. Once subsystems are identified, the proposed approach also provides a quantification of the degree of coupling between subsystems. This information is relevant to decide whether a subsystem may be analysed in a computer model or measured in the laboratory independently of the rest or subsystems or not. The two features (subsystem identification and quantification of the degree of coupling) are illustrated by means of numerical examples: plates coupled by means of springs and rooms connected by means of a cavity.

Ingroup friendship and political mobilization among the disadvantaged.

PubMed

Sengupta, Nikhil K; Milojev, Petar; Barlow, Fiona K; Sibley, Chris G

2015-07-01

This study investigated the effects of ingroup contact in a large, national sample of Māori (a disadvantaged ethnic group; N = 940) on political attitudes relevant to decreasing ethnic inequality in New Zealand. We tested the role of 2 mediating mechanisms-ethnic identification and system justification-to explain the effects of ingroup contact on the dependent variables. Time spent with ingroup friends predicted increased support for the Māori Party and support for symbolic and resource-specific reparative policies benefiting Māori. These effects were partially mediated by increased ethnic identification. Although ingroup contact also reduced levels of system justification among Māori, its effects on policy attitudes and party preference were not mediated by system justification. This suggests that a key antecedent to system challenging political attitudes is an increased sense of identification with a disadvantaged group resulting, in part, from interactions with ingroup friends. (c) 2015 APA, all rights reserved).

Identification of Organic Iodine Compounds and Their Transformation Products in Edible Iodized Salt Using Liquid Chromatography-High Resolution Mass Spectrometry.

PubMed

Yun, Lifen; Peng, Yue'e; Chang, Qing; Zhu, Qingxin; Guo, Wei; Wang, Yanxin

2017-07-05

The consumption of edible iodized salt is a key strategy to control and eliminate iodine deficiency disorders worldwide. We herein report the identification of the organic iodine compounds present in different edible iodized salt products using liquid chromatography combined with high resolution mass spectrometry. A total of 38 organic iodine compounds and their transformation products (TPs) were identified in seaweed iodine salt from China. Our experiments confirmed that the TPs were generated by the replacement of I atoms from organic iodine compounds with Cl atoms. Furthermore, the organic iodine compound contents in 4 seaweed iodine salt samples obtained from different manufacturers were measured, with significant differences in content being observed. We expect that the identification of organic iodine compounds in salt will be important for estimating the validity and safety of edible iodized salt products.

TRIP-ID: A tool for a smart and interactive identification of Magic Formula tyre model parameters from experimental data acquired on track or test rig

NASA Astrophysics Data System (ADS)

Farroni, Flavio; Lamberti, Raffaele; Mancinelli, Nicolò; Timpone, Francesco

2018-03-01

Tyres play a key role in ground vehicles' dynamics because they are responsible for traction, braking and cornering. A proper tyre-road interaction model is essential for a useful and reliable vehicle dynamics model. In the last two decades Pacejka's Magic Formula (MF) has become a standard in simulation field. This paper presents a Tool, called TRIP-ID (Tyre Road Interaction Parameters IDentification), developed to characterize and to identify with a high grade of accuracy and reliability MF micro-parameters from experimental data deriving from telemetry or from test rig. The tool guides interactively the user through the identification process on the basis of strong diagnostic considerations about the experimental data made evident by the tool itself. A motorsport application of the tool is shown as a case study.

Developmental Dyslexia: Early Precursors, Neurobehavioral Markers, and Biological Substrates

ERIC Educational Resources Information Center

Benasich, April A., Ed.; Fitch, R. Holly, Ed.

2012-01-01

Understanding the precursors and early indicators of dyslexia is key to early identification and effective intervention. Now there's a single research volume that brings together the very latest knowledge on the earliest stages of dyslexia and the diverse genetic, neurobiological, and cognitive factors that may contribute to it. Based on findings…

Social Competencies Identification for Realization of Successful Engineering Practice

ERIC Educational Resources Information Center

Ivanova, Malinka

2012-01-01

Purpose: The aim of this paper is to identify the main social competencies that future engineers need to become recognized professionals. In the paper the key competencies for contemporary engineers are examined and the focus is given on the importance of social competencies for professional development. A competency research model is developed…

Chapter 6: Hair collection

Treesearch

Katherine C. Kendall; Kevin S. McKelvey

2008-01-01

The identification of species from hair samples is probably as old as humanity, but did not receive much scientific attention until efficient and relatively inexpensive methods for amplifying DNA became available. Prior to this time, keys were used to identify species through the microscopic analysis of hair shaft morphology (Moore et al. 1974; also see Raphael 1994...

Optical Coherence Tomography in Glaucoma

NASA Astrophysics Data System (ADS)

Berisha, Fatmire; Hoffmann, Esther M.; Pfeiffer, Norbert

Retinal nerve fiber layer (RNFL) thinning and optic nerve head cupping are key diagnostic features of glaucomatous optic neuropathy. The higher resolution of the recently introduced SD-OCT offers enhanced visualization and improved segmentation of the retinal layers, providing a higher accuracy in identification of subtle changes of the optic disc and RNFL thinning associated with glaucoma.

An Examination of Construct Validity for the EARLI Numeracy Skill Measures

ERIC Educational Resources Information Center

Cheng, Weiyi; Lei, Pui-Wa; DiPerna, James C.

2017-01-01

The purpose of the current study was to examine dimensionality and concurrent validity evidence of the EARLI numeracy measures (DiPerna, Morgan, & Lei, 2007), which were developed to assess key skills such as number identification, counting, and basic arithmetic. Two methods (NOHARM with approximate chi-square test and DIMTEST with DETECT…

Optimizing L2 Curriculum for China Post-Secondary Education

ERIC Educational Resources Information Center

Guadagni, Donald

2015-01-01

This instructional paper examines the lack of L2 English skills demonstrated by Chinese post-secondary education students and the results of empiric testing to determine what key language functions were missing from a student's tool box when exiting their primary education phase.The identification of these skills and ability gaps allowed for…

PictureAustralia--Participating in a Collaborative Digital Project.

ERIC Educational Resources Information Center

Campbell, Deborah

The PictureAustralia service is a collaboration between cultural agencies to bring their digital pictorial collections together at the one web site, hosted by the National Library of Australia. It was developed through the identification of a need for a national image discovery service. The key to the service is its cross-sectoral nature,…

Revision of Canadian Eurytomidae (Hymenoptera, Chalcidoidea) associated with galls induced by cynipid wasps of the genus Diplolepis Geoffroy (Hymenoptera, Cynipidae)

USDA-ARS?s Scientific Manuscript database

Eurytomids are small parasitic wasps associated with many communities of phytophagous insects. In most cases, the accurate identification of eurytomids is impeded by inadequate species descriptions that do not include figures of diagnostic features, and keys that are difficult to use. Here, diagnost...

Neither Too Young nor Too Old: A Comparison of Visitor Characteristics.

ERIC Educational Resources Information Center

Hood, Marilyn G.; Roberts, Lisa C.

1994-01-01

Identification and Characteristics of 2 key visitor groups, seniors aged 55 and older and younger guests aged 18-34, emerged from a visitor study at Chicago's Botanic Garden. Discusses their differing leisure preferences, expectations of the garden, psychographics, demographics, and the impact their distinct leisure interests and values have on…

Stevesaltica, a new genus of moss and leaf-litter inhabiting flea beetles from Bolivia (Coleoptera: Chrysomelidae: Galerucinae: Alticini)

USDA-ARS?s Scientific Manuscript database

A new genus (Stevesaltica) with two new species (S. normi and S. perdita) from Bolivia is described and illustrated. It is similar to Exoceras Jacoby. An identification key for all flea beetle genera known to occur in mosses in the Western Hemisphere is provided....

Sensitivity and accuracy of DNA based methods used to describe aquatic communities for early detection of invasive fish species

EPA Science Inventory

For biomonitoring efforts aimed at early detection of aquatic invasive species (AIS), the ability to detect rare individuals is key and requires accurate species level identification to maintain a low occurrence probability of non-detection errors (failure to detect a present spe...

Two new species of Nomuraius Hlaváč (Coleoptera: Staphylinidae: Pselaphinae) from southern China.

PubMed

Huang, Meng-Chi; Yin, Zi-Wei

2018-03-22

Two new Chinese species of the tyrine genus Nomuraius Hlaváč, N. excavatus Huang Yin, sp. n. (Guangxi), and N. nanlingensis Huang Yin, sp. n. (Guangdong), are described and illustrated. The identification key and distributional map of the genus are updated to include the new data.

Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.

USDA-ARS?s Scientific Manuscript database

Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ~4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification pr...

77 FR 16228 - Key Hyundai of Manchester, LLC; Analysis of Proposed Consent Order To Aid Public Comment

Federal Register 2010, 2011, 2012, 2013, 2014

2012-03-20

... Social Security number, date of birth, driver's license number or other state identification number or... information such as costs, sales statistics, inventories, formulas, patterns, devices, manufacturing processes... consumer credit. It also requires that if any finance charge is advertised, the rate be stated as an...

Putative phage-display epitopes of the porcine epidemic diarrhea virus S1 protein and their anti-viral activity

USDA-ARS?s Scientific Manuscript database

Porcine epidemic diarrhea virus (PEDV) is a pathogen of swine that causes severe diarrhea and dehydration resulting in substantial morbidity and mortality in newborn piglets. Phage display is a technique with wide application, in particular, the identification of key antigen epitopes for the develop...

Trends in Teacher Certification: Equipping Teachers to Prepare Proficient Readers

ERIC Educational Resources Information Center

Rowland, Julie

2015-01-01

Ensuring that students are reading proficiently by third grade is a key component of keeping students on track to graduate high school and pursue college and careers. Because of the magnitude of this academic milestone, states typically pursue policies that promote early identification and intervention for struggling readers. However, teachers are…

Identification of host fruit volatiles from snowberry (Symphoricarpos albus), attractive to Rhagoletis zephyria flies from Western United States

USDA-ARS?s Scientific Manuscript database

Gas chromatography coupled with electroantennogram detection (GC-EAD) was used to identify volatiles from the fruit of Snowberry, Symphoricarpos albus laevigatus, as key attractants for Rhagoletis zephyria flies reared from snowberry fruit. A nine-component blend containing 3-methylbutan-1-ol (3%), ...

Two New Species of Xenotarsonemus (Acari: Tarsonemidae) from the Atlantic Forest, Brazil.

PubMed

Lofego, A C; Cavalcante, A C C; Demite, P R

2018-04-01

Two new species, Xenotarsonemus quiriri n. sp. and Xenotarsonemus scorpius n. sp., are described and illustrated in this paper based on specimens collected on Myrtaceae plants in Atlantic Forest areas of the states of Bahia and Santa Catarina, Brazil. A key to identification of Xenotarsonemus species reported from Brazil is provided.

Smart Systems for Logistics Command and Control (SSLC2)

DTIC Science & Technology

2004-06-01

design options 12 AFRL Risk Abatement (continued) • Awareness of key development projects: • AF Portal • GCSS-AF • TBMCS-UL • Enterprise Data Warehouse ... Logistics Enterprise Architecture • Early identification of Transition Agents 13 Collaboration Partners • AF-ILMM • AMC/A-4 • AFC2ISRC • AFMC LSO

Identification and Classification of Orthogonal Frequency Division Multiple Access (OFDMA) Signals Used in Next Generation Wireless Systems

DTIC Science & Technology

2012-03-01

advanced antenna systems AMC adaptive modulation and coding AWGN additive white Gaussian noise BPSK binary phase shift keying BS base station BTC ...QAM-16, and QAM-64, and coding types include convolutional coding (CC), convolutional turbo coding (CTC), block turbo coding ( BTC ), zero-terminating

Nonshared Environmental Influences on Teacher-Reported Behaviour Problems: Monozygotic Twin Differences in Perceptions of the Classroom

ERIC Educational Resources Information Center

Oliver, Bonamy R.; Pike, Alison; Plomin, Robert

2008-01-01

Background: The identification of specific nonshared environments responsible for the variance in behaviour problems is a key challenge. Methods: Nonshared environmental influences on teacher-reported behaviour problems were explored independently of genetics using the monozygotic (MZ) twin differences design. Six aspects of classroom environment…

Aquatic and wetland vascular plants of the northern Great Plains

Treesearch

Gary E. Larson

1993-01-01

A taxonomic treatment of aquatic and wetland vascular plants has been developed as a tool for identifying over 500 plant species inhabiting wetlands of the northern Great Plains region. The treatment provides dichotomous keys and botanical descriptions to facilitate identification of all included taxa. Illustrations are also provided for selected species. Geographical...

MetaCoMET: a web platform for discovery and visualization of the core microbiome

USDA-ARS?s Scientific Manuscript database

A key component of the analysis of microbiome datasets is the identification of OTUs shared between multiple experimental conditions, commonly referred to as the core microbiome. Results: We present a web platform named MetaCoMET that enables the discovery and visualization of the core microbiome an...

CGI-58, a key regulator of lipid homeostasis and signaling in plants, also regulates polyamine metabolism

USDA-ARS?s Scientific Manuscript database

Comparative Gene Identification-58 (CGI-58) is an alpha/beta hydrolase-type protein that regulates lipid homeostasis and signaling in eukaryotes by interacting with and stimulating the activity of several different types of proteins, including a lipase in mammalian cells and a peroxisomal ABC transp...

Seventh-Day Adventist Teachers' Perceptions of Inclusion Classrooms and Identification of Challenges to Their Implementation

ERIC Educational Resources Information Center

Sargeant, Marcel A. A.; Berkner, Donna

2015-01-01

This qualitative study investigated the perceptions and challenges of Seventh-day Adventist teachers towards inclusion classrooms in the United States. For this study, 17 participants were interviewed using two 12-item interview protocols. The analysis of the teachers' responses revealed five key perceptions. First, teachers have positive…

Rapid and non-destructive detection and identification two strains of Wolbachia in Aedes aegypti by near-infrared spectroscopy

USDA-ARS?s Scientific Manuscript database

We investigated the potential of using near-infrared spectroscopy (NIRS) to detect the presence of Wolbachia pipientis (wMel) in male and female laboratory-reared Aedes aegypti mosquitoes. The release of Wolbachia transinfected mosquitoes is likely to form a key component of disease control strategi...

Well-Being in Italian Regions. Measures, Civil Society Consultation and Evidence

ERIC Educational Resources Information Center

Segre, Elisabetta; Rondinella, Tommaso; Mascherini, Massimiliano

2011-01-01

Efforts recently attempted to integrate various aspects of economic progress, environmental sustainability and social welfare into an aggregate measure of well-being share one major weakness concerning the identification of key aspects of well-being and of weights to aggregate these dimensions, they all suffer from lack of legitimacy. In this…

A conspectus on the Canacidae (Diptera) of Brazil

PubMed Central

Mathis, Wayne N.; Marinoni, Luciane

2012-01-01

Abstract Species of Canacidae sensu lato of Brazil are reviewed, including the subfamilies Canacinae and Tethininae. Included are seven species in five genera with two species, Nocticanace austra and Nocticanace packhamorum, from southern Brazil being newly described. To facilitate identification, we have included keys and diagnose to taxa at all levels. PMID:22303126

Identification of Key Indicators of Quality in Afterschool Programs. CRESST Report 748

ERIC Educational Resources Information Center

Huang, Denise; La Torre, Deborah; Harven, Aletha; Huber, Lindsay Perez; Jiang, Lu; Leon, Seth; Oh, Christine

2008-01-01

Researchers and policymakers are increasingly interested in the issue of school accountability. Despite this, program standards for afterschool programs are not as fully developed as they are in other fields. This study bridges that gap and presents the results from a study that identifies benchmarks and indicators for high quality afterschool…

Grassland and shrubland habitat types of western Montana

Treesearch

W. F. Mueggler; W. L. Stewart

1978-01-01

A classification system based upon potential natural vegetation is presented for the grasslands and shrublands of the mountainous western third of Montana. The classification was developed by analyzing data from 580 stands. Twenty-nine habitat types in 13 climax series are defined and a diagnostic key provided for field identification. Environment, vegetative...

School Engagement among Urban Youth of Color: Criterion Pattern Effects of Vocational Exploration and Racial Identity

ERIC Educational Resources Information Center

Perry, Justin C.

2008-01-01

School engagement is a multifaceted psychosocial process that functions as a key mediator of academic achievement, motivation, and school dropout. This study investigated the effects of vocational exploration and racial identity on behavioral (attendance, attention, time spent on class work) and psychological (identification with school) factors…

How Virtual Community Participation Influences Consumer Loyalty Intentions in Online Shopping Contexts: An Investigation of Mediating Factors

ERIC Educational Resources Information Center

Pai, Pei-Yu; Tsai, Hsien-Tung

2011-01-01

Extant studies generally recognise that virtual community building is an effective marketing programme for forging deep and enduring affective bonds with consumers. This study extends previous research by proposing and testing a model that investigates key mediating processes (via trust, satisfaction and identification) that underlie the…

Genome-wide identification of microRNAs in pomegranate (Punica granatum L.) by high-throughput sequencing

USDA-ARS?s Scientific Manuscript database

Background: MicroRNAs (miRNAs), a class of small non-coding endogenous RNAs that regulate gene expression post-transcriptionally, play multiple key roles in plant growth and development and in biotic and abiotic stress response. Knowledge and roles of miRNAs in pomegranate fruit development have not...

A Guide to the Common Diatoms at Water Pollution Surveillance System Stations.

ERIC Educational Resources Information Center

Weber, Cornelius I.

This guide was developed by the United States Environmental Protection Agency (EPA) as a taxonomic reference for the identification of diatoms. The taxonomic information included consists of a generic key to the common genera of diatoms, a section illustrating 164 diatom species representing 43 common genera found at the Water Pollution…

Workbook on the Identification of Anopheles Larvae. Preliminary Issue.

ERIC Educational Resources Information Center

Pratt, Harry D.; Stojanovich, Chester J.

This self-instructional booklet is designed to enable malarial control workers to identify the larvae of "Anopheles" species that are important malaria vectors. The morphological features of the larvae are illustrated in a programed booklet, which also contains an illustrated taxonomic key to 25 species of anopheline larvae. A glossary and a short…

Workbook on the Identification of Anopheles Adults. Preliminary Issue.

ERIC Educational Resources Information Center

Pratt, Harry D.; Stojanovich, Chester J.

This self-instructional workbook is designed to enable malaria control workers to identify adults of "Anopheles" species that are important malaria vectors. The morphological features of the adults are illustrated in a programed booklet, which also contains an illustrated taxonomic key to adult females of 29 anopheline species. A glossary and a…

40 CFR 265.19 - Construction quality assurance program.

Code of Federal Regulations, 2013 CFR

2013-07-01

... conductivity requirements must be verified by using in-situ testing on the constructed test fill. The test fill... specifications in the permit. The program must be developed and implemented under the direction of a CQA officer... applicable units, and a description of how they will be constructed. (2) Identification of key personnel in...

40 CFR 265.19 - Construction quality assurance program.

Code of Federal Regulations, 2010 CFR

2010-07-01

... conductivity requirements must be verified by using in-situ testing on the constructed test fill. The test fill... specifications in the permit. The program must be developed and implemented under the direction of a CQA officer... applicable units, and a description of how they will be constructed. (2) Identification of key personnel in...

ON THE QUANTITATIVE EVALUATION OF THE TERMINOLOGY OF A VOCABULARY.

ERIC Educational Resources Information Center

KRAVETS, L.G.

THE CREATION OF AN INDUSTRIAL SYSTEM OF MACHINE TRANSLATION WITH AUTOMATIC INDEXING OF THE TRANSLATED MATERIALS PRESUMES THE DEVELOPMENT OF DICTIONARIES WHICH PROVIDE FOR THE IDENTIFICATION OF KEY WORDS AND WORD COMBINATIONS, FOLLOWED BY THEIR TRANSLATION INTO THE DESCRIPTORS OF THE SEARCH LANGUAGE. THREE SIGNS WHICH SHOW THAT A GIVEN WORD IS A…

A Model for the Education of Gifted Learners in Lebanon

ERIC Educational Resources Information Center

Sarouphim, Ketty M.

2010-01-01

The purpose of this paper is to present a model for developing a comprehensive system of education for gifted learners in Lebanon. The model consists of three phases and includes key elements for establishing gifted education in the country, such as raising community awareness, adopting valid identification measures, and developing effective…

SoMART, a web server for miRNA, tasiRNA and target gene analysis in Solanaceae plants

USDA-ARS?s Scientific Manuscript database

Plant micro(mi)RNAs and trans-acting small interfering (tasi)RNAs mediate posttranscriptional silencing of genes and play important roles in a variety of biological processes. Although bioinformatics prediction and small (s)RNA cloning are the key approaches used for identification of miRNAs, tasiRN...