Science.gov

Sample records for efeitos od laser

  1. Stabilization of 48- and 57-μ m CH3OD lasers for plasma diagnostics

    NASA Astrophysics Data System (ADS)

    Nakayama, K.; Okajima, S.; Akiyama, T.; Tanaka, K.; Kawahata, K.

    2015-12-01

    Simultaneously oscillated 48-μ m and 57-μ m CH3OD lasers pumped by a 9R(8) CO2 laser have been developed as optical sources of interferometer and polarimeter for fusion plasma diagnostics. The objective of this paper is to present a method for stabilizing the two-color far-infrared (FIR) laser outputs. A stable FIR laser requires a stable pump CO2 laser and a prevention of a back reflection from the FIR laser cavity. The frequency of the pump CO2 laser has been stabilized by an external Stark-cell modulation. The back reflection has been reduced by an optical isolator using a quarter-wave plate and an absorbing thin-film reflector. The two-color FIR laser outputs have been stabilized by controlling the cavity length. As a result of these measures, we have achieved output stabilities of ± 1.2%/h at the 48-μ m laser and ± 1.3%/h at the 57-μ m laser.

  2. Multi-frequency, 3D ODS measurement by continuous scan laser Doppler vibrometry

    NASA Astrophysics Data System (ADS)

    Weekes, Ben; Ewins, David

    2015-06-01

    Continuous scan laser Doppler vibrometry (CSLDV) is a technique which has been described and explored in the literature for over two decades, but remains niche compared to SLDV inspection by a series of discrete-point measurements. This is in part because of the unavoidable phenomenon of laser speckle, which deteriorates signal quality when velocity data is captured from a moving spot measurement. Further, applicability of CSLDV has typically been limited to line scans and rectangular areas by the application of sine, step, or ramp functions to the scanning mirrors which control the location of the measurement laser spot. In this paper it is shown that arbitrary functions to scan any area can easily be derived from a basic calibration routine, equivalent to the calibration performed in conventional discrete-point laser vibrometry. This is extended by performing the same scan path upon a test surface from three independent locations of the laser head, and decomposing the three sets of one-dimensional deflection shapes into a single set of three-dimensional deflection shapes. The test was performed with multi-sine excitation, yielding 34 operating deflection shapes from each scan.

  3. ODS iron aluminides

    SciTech Connect

    Wright, I.G.; Pint, B.A.; Ohriner, E.K.; Tortorelli, P.F.

    1996-08-01

    The overall goal of this program is to develop an oxide dispersion-strengthened (ODS) version of Fe{sub 3}Al that has sufficient creep strength and resistance to oxidation at temperatures in the range 1000 to 1200{degrees}C to be suitable for application as heat exchanger tubing in advanced power generation cycles. The program has two main thrusts: (a) alloy processing, which involves mechanical alloying and thermomechanical processing to achieve the desired size and distribution of the oxide dispersoid, and (b) optimization of the oxidation behavior to provide increased service life compared to ODS-FeCrAl alloys intended for the same applications. Control of the grain size and shape in the final alloy is very dependent on the homogeneity of the alloy powder, in terms of the size and distribution of the dispersed oxide particles, and on the level of strain and temperature applied in the recrystallization step. Studies of the effects of these variables are being made using mechanically-alloyed powder from two sources: a commercial powder metallurgy alloy vendor and an in-house, controlled environment high-energy mill. The effects of milling parameters on the microstructure and composition of the powder and consolidated alloy are described. Comparison of the oxidation kinetics of ODS-Fe{sub 3}Al alloys with commercial ODS-FeCrAl alloys in air at 1000-1300{degrees}C indicated that the best Fe{sub 3}Al-based alloys oxidized isothermally at the same rate as the ODS-FeCrAl alloys but, under thermal cycling conditions, the oxidation rate of ODS-Fe{sub 3}Al was faster. The main difference was that the ODS-Fe{sub 3}Al experienced significantly more scale spallation above 1000{degrees}C. The differences in oxidation behavior were translated into expected lifetimes which indicated that, for an alloy section thickness of 2.5 mm, the scale spallation of ODS-Fe{sub 3}Al leads to an expected service lifetime similar to that for the INCO alloy MA956 at 1100 to 1300{degrees}C.

  4. ODS iron aluminides

    SciTech Connect

    Wright, I.G.; Pint, B.A.; Tortorelli, P.F.; Ohriner, E.K.

    1996-06-01

    Interest in advanced cycles that involve indirectly-fired gas turbines, in which coal- or gas-fired high-temperature heat exchangers are used to heat a working fluid in a closed system, has led to investigation of materials for heat exchangers capable of operation at temperatures of the order of 1200 to 1300{degrees}C. The candidate materials are ceramics and, possibly, oxide dispersion-strengthened (ODS) alloys. An ODS FeCrAl alloy was found to meet the strength requirements for such an application, in which the working fluid at 0.9 MPa was to be heated from 800 to 1100{degrees}C over a tube length of 4 m. The oxidation life of ODS FeCrAl alloys is determined by their ability to form or reform a protective alumina scale, and can be related to the time for the aluminum content of the alloy to be depleted to some minimum level. As a result, the service life is a function of the available aluminum content of the alloys and the minimum aluminum level at which breakaway oxidation occurs, hence there is a limit on the minimum cross section which can be safely employed at temperatures above 1200{degrees}C. Because of their significantly higher aluminum content ({ge}28 atom %/{ge}16 wt. percent compared to {approx}9 atom %15 wt. percent), alloys based on Fe{sub 3}Al afford a potentially larger reservoir of aluminum to sustain oxidation resistance at higher temperatures and, therefore, offer a possible improvement over the currently-available ODS FeCrAl alloys, providing they can be strengthened in a similar manner.

  5. ODS iron aluminides

    SciTech Connect

    Wright, I.G.; McKamey, C.G.; Pint, B.A.

    1995-06-01

    There has been a recent increase of interest in advanced cycles that involve indirectly-fired gas turbines, in which coal- or gas-fired high-temperature heat exchangers are used to heat a working fluid in a closed system. In a program conducted as part of the European COST-501 Concerted Action Project, available alloys based on FeCrAl-Y{sub 2}O{sub 3} were evaluated for use in the main heat exchanger in a similar closed-cycle gas turbine application. One of the currently available ODS FeCrAl alloys was found to meet the strength requirements for this application, in which the working fluid at 0.9 MPa (131 psi) flowing at 5,889 kg/hr (12,955 lb/hr) was to be heated from 800 to 1100{degrees}C (1472 to 2012{degrees}F) over a tube length of 4 m (13 ft).

  6. The oxidation and corrosion of ODS alloys

    NASA Technical Reports Server (NTRS)

    Lowell, Carl E.; Barrett, Charles A.

    1990-01-01

    The oxidation and hot corrosion of high temperature oxide dispersion strengthened (ODS) alloys are reviewed. The environmental resistance of such alloys are classified by oxide growth rate, oxide volatility, oxide spalling, and hot corrosion limitations. Also discussed are environmentally resistant coatings for ODS materials. It is concluded that ODS NiCrAl and FeCrAl alloys are highly oxidation and corrosion resistant and can probably be used uncoated.

  7. Progress in ODS Alloys: A Synopsis of a 2010 Workshop on Fe- Based ODS Alloys

    SciTech Connect

    Kad, Bimal; Dryepondt, Sebastien N; Jones, Andy R.; Vito, Cedro III; Tatlock, Gordon J; Pint, Bruce A; Tortorelli, Peter F; Rawls, Patricia A.

    2012-01-01

    In Fall 2010, a workshop on the role and future of Fe-based Oxide Dispersion Strengthened (ODS) alloys gathered together ODS alloy suppliers, potential industrial end-users, and technical experts in relevant areas. Presentations and discussions focused on the current state of development of these alloys, their availability from commercial suppliers, past major evaluations of ODS alloy components in fossil and nuclear energy applications, and the technical and economic issues attendant to commercial use of ODS alloys. Significant progress has been achieved in joining ODS alloys, with creep resistant joints successfully made by inertia welding, friction stir welding and plasma-assisted pulse diffusion bonding, and in improving models for the prediction of lifetime components. New powder and alloy fabrication methods to lower cost or improve endproduct properties were also described. The final open discussion centered on challenges and pathways for further development and large-scale use of ODS alloys.

  8. SEDS Tether M/OD Damage Analyses

    NASA Technical Reports Server (NTRS)

    Hayashida, K. B.; Robinson, J. H.; Hill, S. A.

    1997-01-01

    The Small Expendable Deployer System (SEDS) was designed to deploy an endmass at the end of a 20-km-long tether which acts as an upper stage rocket, and the threats from the meteoroid and orbital debris (M/OD) particle environments on SEDS components are important issues for the safety and success of any SEDS mission. However, the possibility of severing the tether due to M/OD particle impacts is an even more serious concern, since the SEDS tether has a relatively large exposed area to the M/OD environments although its diameter is quite small. The threats from the M/OD environments became a very important issue for the third SEDS mission, since the project office proposed using the shuttle orbiter as a launch platform instead of the second stage of a Delta II expendable rocket, which was used for the first two SEDS missions. A series of hyper-velocity impact tests were performed at the Johnson Space Center and Arnold Engineering Development Center to help determine the critical particle sizes required to sever the tether. The computer hydrodynamic code or hydrocode called CTH, developed by the Sandia National Laboratories, was also used to simulate the damage on the SEDS tether caused by both the orbital debris and test particle impacts. The CTH hydrocode simulation results provided the much needed information to help determine the critical particle sizes required to sever the tether. The M/OD particle sizes required to sever the tether were estimated to be less than 0.1 cm in diameter from these studies, and these size particles are more abundant in low-Earth orbit than larger size particles. Finally, the authors performed the M/OD damage analyses for the three SEDS missions; i.e., SEDS-1, -2, and -3 missions, by using the information obtained from the hypervelocity impact test and hydrocode simulations results.

  9. Reduction in Defect Content of ODS Alloys

    SciTech Connect

    Ritherdon, J

    2001-05-15

    The work detailed within this report is a continuation of earlier work carried out under contract number 1DX-SY382V. The earlier work comprises a literature review of the sources and types of defects found principally in Fe-based ODS alloys as well as experimental work designed to identify defects in the prototype ODS-Fe{sub 3}Al alloy, deduce their origins and to recommend methods of defect reduction. The present work is an extension of the experimental work already reported and concentrates on means of reduction of defects already identified rather than the search for new defect types. This report also includes results gathered during powder separation trials, conducted by the University of Groningen, Netherlands and coordinated by the University of Liverpool, involving the separation of different metallic powders in terms of their differing densities. The scope and objectives of the present work were laid out in the technical proposal ''Reduction in Defect Content in ODS Alloys-III''. All the work proposed in the ''Statement of Work'' section of the technical proposal has been carried out and all work extra to the ''Statement of Work'' falls within the context of an ODS-Fe{sub 3}Al alloy of improved overall quality and potential creep performance in the consolidated form. The outturn of the experimental work performed is reported in the following sections.

  10. La Station Laser ultra mobile: de l'Obtention d'une Exactitude centimétrique des Mesures à des Applications en Océanographie et Géodésie Spatiales

    NASA Astrophysics Data System (ADS)

    Nicolas, Joëlle

    2000-12-01

    La Station Laser Ultra Mobile est la plus petite station de télémétrie laser au monde, ne pesant que 300 kg, dédiée à la poursuite de satellites équipés de rétroréflecteurs laser. Elle utilise un petit télescope de 13 cm de diamètre placé sur une monture issue d'un théodolite de précision et motorisé, un laser très compact et une photodiode à avalanche permettant la détection au niveau du simple photo-électron. Les premières expériences (Corse, fin 1996) ont révélé de nombreuses instabilités dans la qualité des mesures. Ce travail concerne l'étude et la mise en place de nombreuses modifications techniques afin d'atteindre une exactitude centimétrique des mesures et de pouvoir participer à la campagne de validation des orbites et d'étalonnage de l'altimètre du satellite océanographique JASON-1 (2001). La précision instrumentale souhaitée a été vérifiée avec succès en laboratoire. Outre cet aspect instrumental et métrologique, une analyse a été développée afin de pouvoir estimer l'exactitude et la stabilité des observations de la station mobile après intégration des modifications. A partir d'une expérience de co-localisation entre les deux stations laser fixe du plateau de Calern, l'analyse est basée sur l'ajustement, par station, de coordonnées et d'un biais instrumental moyen à partir d'une orbite de référence des satellites LAGEOS. Des variations saisonnières ont été mises en évidence dans les séries temporelles des différentes composantes. La comparaison locale des déformations de la croûte terrestre se traduisant par des variations d'altitude issues des données laser a montré une cohérence remarquable avec les mesures du gravimètre absolu transportable FG5. Des signaux de même amplitude ont aussi été observés par GPS. Ces variations sont également mises en évidence à l'échelle mondiale et leur interprétation géophysique est faite (combinaison des effets de marées terrestres et polaire

  11. Reduction in Defect Content in ODS Alloys

    SciTech Connect

    Jones, A.R.; Ritherdon, J.; Prior, D.J.

    2003-04-22

    In order to develop FeCrAl-based ODS alloy tubing with the coarse, high aspect ratio, appropriately oriented grain structures likely to deliver enhanced high temperature (11000C) hoop creep strength compared to conventionally formed ODS alloy tubing, flow forming techniques were explored in a European funded programme. The evolution of microstructure in PM2000 alloy tubing formed by warm flow forming techniques has been the subject of continuing investigation and more detailed study in the current work. The warm flow formed tubes investigated were produced by reverse flow forming using three, 1200 opposed rollers described around a tube preform supported on a driven mandrel. This produced a complex pattern of shape changing deformation, driven from the outer surface of the tube preforms. The grain size and shape together with the pattern of nucleation and growth of secondary recrystallization that developed through the thickness of the tube wall during the subsequent high temperature annealing (13800C) of these warm flow formed samples is described, as are the textures that formed. The unusual pattern and shape of secondary recrystallized grain structures that formed on the outer surfaces of the flow formed tubes closely follows the pattern and pitch of the flow forming rollers. The local texture, grain shape and pattern of misorientation in the surface of warm flow formed tubes that was associated with the development of these outer surface microstructures are described. Parallel studies have continued on the influence of microstructural inhomogeneities on the development of secondary recrystallized grain structures in ODS alloys. As part of this work, a separate variant of PM2000 alloy with additions of 1 wt.% ODS-free Fe powder have been manufactured as extruded bar by Plansee GmbH. The initial recrystallization behavior of the variant has been studied and cross-compared with the recrystallization behavior found in a prototype ODS-Fe3Al alloy, notably where the

  12. The Bgo-Od Experiment at Elsa

    NASA Astrophysics Data System (ADS)

    Bantes, B.; Bayadilov, D.; Beck, R.; Becker, M.; Bella, A.; Bieling, J.; Böse, S.; Braglieri, A.; Brinkmann, K.; Burdeynyi, D.; Curciarello, F.; de Leo, V.; di Salvo, R.; Dutz, H.; Elsner, D.; Fantini, A.; Frese, T.; Friedrick, S.; Frommberger, F.; Ganenko, V.; Gervino, G.; Ghio, F.; Giardina, G.; Girolami, B.; Glazier, D.; Goertz, S.; Gridnev, A.; Gutz, E.; Hammann, D.; Hannappel, J.; Hillert, W.; Ignatov, A.; Jahn, O.; Jahn, R.; Joosten, R.; Jude, T. C.; Klein, F.; Koop, K.; Krusche, B.; Lapik, A.; Levi Sandri, P.; Lopatin, I.; Mandaglio, G.; Messi, F.; Messi, R.; Metag, V.; Moricciani, D.; Nanova, M.; Nedorezov, V.; Noviskiy, D.; Pedroni, P.; Romaniuk, M.; Rostomyan, T.; Schaerf, C.; Schmieden, H.; Sumachev, V.; Tarakonov, V.; Vegna, V.; Vlasov, P.; Walther, D.; Watts, D.; Zaunick, H.-G.; Zimmermann, T.

    2014-01-01

    Meson photoproduction is a key tool for the experimental investigation of the nucleon excitation spectrum. To disentangle the specific couplings of resonances, in addition to the rather well measured pion and eta photoproduction channels it is mandatory to obtain information on channels involving strange and vector mesons and higher mass pseudoscalar mesons, and the associated multi-particle final states with both charged and neutral particles. In this respect, the new BGO-OD experiment at the ELSA accelerator of the University of Bonn's Physikalisches Institut provides unique instrumentation. We describe the experiment, present its status and the initial program of measurements.

  13. DEVELOPMENT OF ODS HEAT EXCHANGER TUBING

    SciTech Connect

    Mark A. Harper, Ph.D.

    2001-01-01

    The Vision 21 project titled ''Development of ODS Heat Exchanger Tubing'' has been initiated. A project kick-off meeting was held in Huntington, WV, the MA956 powder that will be used in the extrusion campaign has been obtained, and some of the MA956 tubing and rod required for joining trials has been shipped to the appropriate subcontractors. Acquisition of the MA956 alloy powder will allow the extrusion campaign to begin during the month of February. Also, tubing shipped to Edison Welding Institute and rod shipped to Michigan Technological University will allow joining trials to begin. In addition to these technical aspects, negotiations with all the subcontractors have been completed and the Project Management Plan and Project Work Plan have been prepared and submitted for approval.

  14. Joining Techniques for Ferritic ODS Alloys

    SciTech Connect

    V.G. Krishnardula; V.G. Krishnardula; D.E. Clark; T.C. Totemeier

    2005-06-01

    This report presents results of research on advanced joining techniques for ferritic oxide-dispersion strengthened alloys MA956 and PM2000. The joining techniques studied were resistance pressure welding (also known as pressure forge welding), transient liquid phase bonding, and diffusion bonding. All techniques were shown to produce sound joints in fine-grained, unrecrystallized alloys. Post-bond heat treatment to produce a coarse-grained, recrystallized microstructure resulted in grain growth across the bondline for transient liquid phase and diffusion bonds, giving microstructures essentially identical to that of the parent alloy in the recrystallized condition. The effects of bond orientation, boron interlayer thickness, and bonding parameters are discussed for transient liquid phase and diffusion bonding. The report concludes with a brief discussion of ODS joining techniques and their applicability to GEN IV reactor systems.

  15. Lasers.

    ERIC Educational Resources Information Center

    Schewe, Phillip F.

    1981-01-01

    Examines the nature of laser light. Topics include: (1) production and characteristics of laser light; (2) nine types of lasers; (3) five laser techniques including holography; (4) laser spectroscopy; and (5) laser fusion and other applications. (SK)

  16. Transient liquid-phase bonding of ODS steels

    NASA Astrophysics Data System (ADS)

    Noto, H.; Ukai, S.; Hayashi, S.

    2011-10-01

    The use of transient liquid-phase bonding of 9CrODS steels using Fe-3B-2Si-0.5C filler was investigated for bonding temperature of 1180 °C and hold times of 0.5-4.0 h. The sequential process, consisting of isothermal melting, solidification and homogenization, was confirmed for bonding the 9CrODS steel. The precipitation of chromium boride found in 19CrODS steel is avoided in 9CrODS steel due to the lower Cr content. Silicon tends to be slightly enriched inside the bonding zone. Agglomeration and coarsening of Y 2O 3 particles in 9CrODS steel lead to softening inside the bonding zone formed by incipient melting of the foil bonding alloy, and in a diffusion affected zone (DAZ) adjacent to the bonding zone.

  17. Drug OD Deaths Have Nearly Tripled Since 1999: CDC

    MedlinePlus

    ... Drug OD Deaths Have Nearly Tripled Since 1999: CDC Whites, middle-aged adults hardest hit, new report ... Sinai Health System in New York City. The CDC report, released Feb. 24, found that drug overdose ...

  18. Inhibited Aluminization of an ODS FeCr Alloy

    SciTech Connect

    Vande Put Ep Rouaix, Aurelie; Pint, Bruce A

    2012-01-01

    Aluminide coatings are of interest for fusion energy applications both for compatibility with liquid Pb-Li and to form an alumina layer that acts as a tritium permeation barrier. Oxide dispersion strengthened (ODS) ferritic steels are a structural material candidate for commercial reactor concepts expected to operate above 600 C. Aluminizing was conducted in a laboratory scale chemical vapor deposition reactor using accepted conditions for coating Fe- and Ni-base alloys. However, the measured mass gains on the current batch of ODS Fe-14Cr were extremely low compared to other conventional and ODS alloys. After aluminizing at two different Al activities at 900 C and at 1100 C, characterization showed that the ODS Fe-14Cr specimens formed a dense, primarily AlN layer that prevented Al uptake. This alloy batch contained a higher (> 5000 ppma) N content than the other alloys coated and this is the most likely reason for the inhibited aluminization. Other factors such as the high O content, small ({approx} 140 nm) grain size and Y-Ti oxide nano-clusters in ODS Fe-14Cr also could have contributed to the observed behavior. Examples of typical aluminide coatings formed on conventional and ODS Fe- and Ni-base alloys are shown for comparison.

  19. The Optical Depth Sensor (ODS) for Mars atmosphere

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2015-10-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in both Martian and Earth environments. The principal goal of ODS is to carry out the opacity due to the Martian dust as well as to characterize the high altitude clouds at twilight, crucial parameters in understanding of Martian meteorology. The instrument was initially designed for the failed MARS96 Russian mission, and also was included in the payload of several other missions [1]. Until recently, it was selected (NASA/ESA AO) in the payload of the atmospheric package DREAMS onboard the MARS 2016 mission. But following a decision of the CNES, it is no more included in the payload. In order to study the performance of ODS under a wide range of conditions as well as its capable to provide daily measurements of both dust optical thickness and high altitude clouds properties, the instrument has participated in different terrestrial campaigns. A good performance of ODS prototype (Figure 1) on cirrus clouds detection and in dust opacity estimation was previously archived in Africa during 2004-2005 and in Brasil from 2012 to nowadays. Moreover, a campaign in the arctic is expected before 2016 where fifteen ODSs will be part of an integrated observing system over the Arctic Ocean, allowing test the ODS performance in extreme conditions. In this presentation we present main principle of the retrieval, the instrumental concept, the result of the tests performed and the principal objectives of ODS in Mars.

  20. Machinery alignment tables: Face-OD and reverse indicator methods

    SciTech Connect

    Buck, G.S.

    1984-01-01

    Many alignment techniques are too complex for practical use, and guessing never provides the needed precision. The face-OD (face-rim) and reverse indicator methods are the two most popular techniques experienced millwrights use, but both methods require time-consuming calculations. These tables replace the graphs, formulas, and calculations used to determine shim requirements. Contents: Face-OD method and reverse indicator method: Setting up Data forms. Equations and calculations. Examples. Alignment Tolerances. Errors in taking data. Typical alignment tolerances. Indicator sag. Cause of indicator sag. Correction of indicator sag. Typical values of indicator sag. Hot alignment. References.

  1. 46 CFR 280.4 - Standards governing payment of ODS.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... each service if, during the calendar year, at least 50 percent of the inbound and 50 percent of the outbound gross freight revenues earned on voyages terminated during the calendar year, for each service.... The amount of ODS payable for the inbound leg of a service for the calendar year shall be reduced...

  2. Development of ODS-Fe{sub 3}Al alloys

    SciTech Connect

    Wright, I.G.; Pint, B.A.; Tortorelli, P.F.; McKamey, C.G.

    1997-12-01

    The overall goal of this program is to develop an oxide dispersion-strengthened (ODS) version of Fe{sub 3}Al that has sufficient creep strength and resistance to oxidation at temperatures in the range 1000 to 1200 C to be suitable for application as heat exchanger tubing in advanced power generation cycles. The main areas being addressed are: (a) alloy processing to achieve the desired alloy grain size and shape, and (b) optimization of the oxidation behavior to provide increased service life compared to semi-commercial ODS-FeCrAl alloys intended for the same applications. The recent studies have focused on mechanically-alloyed powder from a commercial alloy vendor. These starting alloy powders were very clean in terms of oxygen content compared to ORNL-produced powders, but contained similar levels of carbon picked up during the milling process. The specific environment used in milling the powder appears to exert a considerable influence on the post-consolidation recrystallization behavior of the alloy. A milling environment which produced powder particles having a high surface carbon content resulted in a consolidated alloy which readily recrystallized, whereas powder with a low surface carbon level after milling resulted in no recrystallization even at 1380 C. A feature of these alloys was the appearance of voids or porosity after the recrystallization anneal, as had been found with ORNL-produced alloys. Adjustment of the recrystallization parameters did not reveal any range of conditions where recrystallization could be accomplished without the formation of voids. Initial creep tests of specimens of the recrystallized alloys indicated a significant increase in creep strength compared to cast or wrought Fe{sub 3}Al, but the specimens failed prematurely by a mechanism that involved brittle fracture of one of the two grains in the test cross section, followed by ductile fracture of the remaining grain. The reasons for this behavior are not yet understood. The

  3. Mechanical testing of anisotropy in ODS steel tubes

    NASA Astrophysics Data System (ADS)

    Špirit, Z.; Chocholoušek, M.; Šíma, M.

    2017-02-01

    Anisotropy of fuel claddings made from Fe-9Cr and Fe-14Cr ODS (oxide dispersion-strengthened) steel for Generation IV reactors with coolants based on liquid metals was examined. Basic mechanical tests were performed at temperatures of 30 °C, 500 °C and 625 °C on ODS steel thin-walled tubes. Tensile tests were performed in axial and tangential directions in a vacuum to avoid oxidation of the small specimens. A scanning electron microscope with a small in-situ tensile testing device was used to conduct the tests. The result of this paper describes the basic mechanical properties of thin-walled tubes as ultimate tensile strength, yield strength, tensile modulus, etc. depending on the direction of loading.

  4. Residual ferrite formation in 12CrODS steels

    NASA Astrophysics Data System (ADS)

    Ukai, S.; Kudo, Y.; Wu, X.; Oono, N.; Hayashi, S.; Ohtsuka, S.; Kaito, T.

    2014-12-01

    Increasing Cr content from 9 to 12 mass% leads to superior corrosion and high-temperature oxidation resistances, and usually changes microstructure from martensite to a ferrite. To make transformable martensitic type of 12CrODS steels that have superior processing capability by using α/γ phase transformation, alloy design was conducted through varying nickel content. The structure of 12CrODS steels was successfully modified from full ferrite to a transformable martensite-base matrix containing ferrite. This ferrite consists of both equilibrium ferrite and a metastable residual ferrite. It was shown that the fraction of the equilibrium ferrite is predictable by computed phase diagram and formation of the residual ferrite was successfully evaluated through pinning of α/γ interfacial boundaries by oxide particles.

  5. Direct frequency comb measurement of OD + CO → DOCO kinetics.

    PubMed

    Bjork, B J; Bui, T Q; Heckl, O H; Changala, P B; Spaun, B; Heu, P; Follman, D; Deutsch, C; Cole, G D; Aspelmeyer, M; Okumura, M; Ye, J

    2016-10-28

    The kinetics of the hydroxyl radical (OH) + carbon monoxide (CO) reaction, which is fundamental to both atmospheric and combustion chemistry, are complex because of the formation of the hydrocarboxyl radical (HOCO) intermediate. Despite extensive studies of this reaction, HOCO has not been observed under thermal reaction conditions. Exploiting the sensitive, broadband, and high-resolution capabilities of time-resolved cavity-enhanced direct frequency comb spectroscopy, we observed deuteroxyl radical (OD) + CO reaction kinetics and detected stabilized trans-DOCO, the deuterated analog of trans-HOCO. By simultaneously measuring the time-dependent concentrations of the trans-DOCO and OD species, we observed unambiguous low-pressure termolecular dependence of the reaction rate coefficients for N2 and CO bath gases. These results confirm the HOCO formation mechanism and quantify its yield.

  6. Evaluation of Oxide Dispersion Strengthened (ODS) Molybdenum Alloys

    DTIC Science & Technology

    1997-01-01

    containing 4 parts concentrated sulfuric acid and 1 part distilled water using a Type 304 stainless steel cathode and a direct current accelerating...Ductile-to-Brittle Transition Temperature ( DBTT ): The following mechanical properties were measured from the ODS molybdenum alloy rods: (a) 0.2...and to determine the DBTT . Elevated Temperature Tensile Tests: Elevated temperature tensile specimens of each as- swaged alloy were equilibrated

  7. Mechanical properties of oxide dispersion strengthened (ODS) molybdenum alloys

    SciTech Connect

    Bianco, R.; Buckman, R.W. Jr.

    1998-03-01

    Oxide dispersion strengthened molybdenum, Mo-ODS, developed by a proprietary powder metallurgy process, exhibits a creep rupture life at 0.65T{sub m} (1,600 C) of three to five orders of magnitude greater than unalloyed molybdenum, while maintaining ductile fracture behavior at temperatures significantly below room temperature. In comparison, the creep rupture life of the Mo-50Re solid solution strengthened alloy at 1,600 C is only an order of magnitude greater than unalloyed molybdenum. The results of microstructural characterization and thermal stability and mechanical property testing are discussed.

  8. Oxide Evolution in ODS Steel Resulting From Friction Stir Welding

    DTIC Science & Technology

    2014-06-01

    Master’s Thesis 4 . TITLE AND SUBTITLE OXIDE EVOLUTION IN ODS STEEL RESULTING FROM FRICTION STIR WELDING 5. FUNDING NUMBERS 6 . AUTHOR(S...temperatures, from [5]. ........... 6   Figure 4 .  The phase diagram for aluminum and yttrium oxide, from [13]. ......................8  Figure 5...millimeters per minute. FSW Conditions RPM IPM MMPM Heat Index 400 7 175 2.3 300 4 100 3 200 2 50 4 400 4 100 4 300 2 50 6 400 2 50 8 500 1 25

  9. Loss of DNC from ionized 4-hydroxypyridine-OD

    NASA Astrophysics Data System (ADS)

    Jobst, Karl J.; Khan, Tanya R.; Terlouw, Johan K.

    2007-07-01

    Low energy 4-hydroxypyridine ions (HP-1) decarbonylate but also readily lose hydrogen (iso)cyanide. Surprisingly, this reaction leads to a specific loss of the label from the OD-labelled isotopomer. Our tandem mass spectrometry experiments show that ionized vinylketene, CH2CHCHCO+ (1), is the product ion. This ion is also generated by the decarbonylation of 4-cyclopentene-1,3-dione ions (CP-1) and a computational analysis using the CBS-QB3 model chemistry indicates that these seemingly unrelated ionic systems share similar dissociation mechanisms. In this study, a mechanism is presented for the decarbonylation of metastable ions CP-1 that satisfies the energy requirement dictated by its appearance energy. Our computational analysis further shows that ions HP-1 may isomerize into the (iso)imino analogues of CP-1, by consecutive H-shift, ring-opening and cyclization steps. The CP-1 analogues serve as the immediate precursors for the specific loss of DNC (rather than DCN) from OD-labelled HP-1 and also its decarbonylation into the vinyl(iso)ketenimine ions CH2CHCHNCH+ (3) and CH2CHCHCNH+ (4).

  10. ODS Characterization Progress Report 06/27/08

    SciTech Connect

    El-Dasher, B

    2008-11-25

    This progress report is intended to help keep track of the work that has been performed in characterizing ODS steels for the LIFE project. This specific report details the current status of the characterization of a 24% Cr, 1% Y{sub 2}O{sub 3} ODS steel obtained from Wayne King via Geoff Campbell. Since no pedigree of the material could be obtained, a baseline characterization was necessary prior to studying processing, welding, and corrosion behavior. This document details the results obtained from analysis performed using scanning electron microscopy (SEM), electron backscatter diffraction (EBSD) and energy dispersive spectroscopy (EDS). At the time of writing, transmission electron microscopy (TEM) and microhardness measurements have not been completed, and will be included in a future report. The results are presented in two sections: microstructure, and phase identification. As the names suggest, the first section will report on the microstructure in the general sense and include details such as grain size and texture, and the second section will include the identification of the phases present in the baseline material.

  11. Precipitates and boundaries interaction in ferritic ODS steels

    NASA Astrophysics Data System (ADS)

    Sallez, Nicolas; Hatzoglou, Constantinos; Delabrouille, Fredéric; Sornin, Denis; Chaffron, Laurent; Blat-Yrieix, Martine; Radiguet, Bertrand; Pareige, Philippe; Donnadieu, Patricia; Bréchet, Yves

    2016-04-01

    In the course of a recrystallization study of Oxide Dispersion Strengthened (ODS) ferritic steels during extrusion, particular interest was paid to the (GB) Grain Boundaries interaction with precipitates. Complementary and corresponding characterization experiments using Transmission Electron Microscopy (TEM), Energy Dispersive X-ray spectroscopy (EDX) and Atom Probe Tomography (APT) have been carried out on a voluntarily interrupted extrusion or extruded samples. Microscopic observations of Precipitate Free Zones (PFZ) and precipitates alignments suggest precipitate interaction with migrating GB involving dissolution and Oswald ripening of the precipitates. This is consistent with the local chemical information gathered by EDX and APT. This original mechanism for ODS steels is similar to what had been proposed in the late 80s for similar observation made on Ti alloys reinforced by nanosized yttrium oxides: An interaction mechanism between grain boundaries and precipitates involving a diffusion controlled process of precipitates dissolution at grain boundaries. It is believed that this mechanism can be of primary importance to explain the mechanical behaviour of such steels.

  12. Lasers.

    PubMed

    Passeron, T

    2012-12-01

    Lasers are a very effective approach for treating many hyperpigmented lesions. They are the gold standard treatment for actinic lentigos and dermal hypermelanocytosis, such as Ota nevus. Becker nevus, hyperpigmented mosaicisms, and lentigines can also be successfully treated with lasers, but they could be less effective and relapses can be observed. However, lasers cannot be proposed for all types of hyperpigmentation. Thus, freckles and café-au-lait macules should not be treated as the relapses are nearly constant. Due to its complex pathophysiology, melasma has a special place in hyperpigmented dermatoses. Q-switched lasers (using standard parameters or low fluency) should not be used because of consistent relapses and the high risk of post-inflammatory hyperpigmentation. Paradoxically, targeting the vascular component of the melasma lesion with lasers could have a beneficial effect. However, these results have yet to be confirmed. In all cases, a precise diagnosis of the type of hyperpigmentation is mandatory before any laser treatment, and the limits and the potential side effects of the treatment must be clearly explained to patients.

  13. [Lasers].

    PubMed

    Passeron, T

    2012-11-01

    Lasers are a very effective approach for treating many hyperpigmented lesions. They are the gold standard treatment for actinic lentigos and dermal hypermelanocytosis, such as Ota nevus. Becker nevus, hyperpigmented mosaicisms, and lentigines can also be successfully treated with lasers, but they could be less effective and relapses can be observed. However, lasers cannot be proposed for all types of hyperpigmentation. Thus, freckles and café-au-lait macules should not be treated as the relapses are nearly constant. Due to its complex pathophysiology, melasma has a special place in hyperpigmented dermatoses. Q-switched lasers (using standard parameters or low fluency) should not be used because of consistent relapses and the high risk of post-inflammatory hyperpigmentation. Paradoxically, targeting the vascular component of the melasma lesion with lasers could have a beneficial effect. However, these results have yet to be confirmed. In all cases, a precise diagnosis of the type of hyperpigmentation is mandatory before any laser treatment, and the limits and the potential side effects of the treatment must be clearly explained to patients.

  14. Microstructure and impact properties of ferritic ODS ODM401 (14%Cr-ODS of MA957 type)

    NASA Astrophysics Data System (ADS)

    Hadraba, Hynek; Kazimierzak, Bohumil; Stratil, Ludek; Dlouhy, Ivo

    2011-10-01

    The oxide dispersion strengthened (ODS) steel ODM401 is one of the ODS steels developed during the 1960-1970s as a structural tubing material for fast breeder reactors, mainly because of their high-temperature strength and swelling resistance under irradiation. Nowadays, these steels are taken under consideration as a structural material for blanket and heat exchanger components in fusion reactors. The aim of the work was to describe fracture behaviour of ODM401 steel in connection to the microstructure. The microstructure of as-extruded ODM401 steel has fine grains elongated in the extrusion direction. The two population of Y-Ti-O particles sizes were found in the microstructure of size about 10-20 nm and 2-3 nm. Temperature dependence of KLST impact energy was measured and transition temperature tDBTT evaluated about -110 °C. The fracture surface was formed by alternated cleavage areas connected by inclined areas fractured by dimple micro mechanism proportional to the impact energy.

  15. The crystal structure of Sr(OD) 2

    NASA Astrophysics Data System (ADS)

    Partin, D. E.; O'Keeffe, M.

    1995-10-01

    The crystal structure of Sr(OD) 2 has been determined from a Reitveld refinement of time-of-flight neutron diffraction data, and the deuterium atom positions have been determined for the first time. The structure is orthorhombic: Pnma, a = 9.8269(5) Å, b = 3.9051(2) Å, c = 6.0733(3) Å, V = 233.06 Å 3, D x = 3.466 g cm -3, Rwp = 3.93%, Rp = 2.95%, reduced X2 = 4.774 for 81 variables. Although the data were collected at 12 K, the H atoms have large thermal parameters suggesting the possibility of some disorder. Relationships of the structure to the structures of YOOH, SrBr 2, SrI 2, and SrBr 2 · H 2O are discussed.

  16. 46 CFR 280.9 - Special rules for last year of ODS agreement.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ...) of this section, if on a cumulative basis for each quarter of the calendar year: (1) Less than 50... ODS payable for the preceding calendar year as required by paragraph (b) (3) of § 280.4. (b) Amount..., the amount payable on the ODS voucher for the last month of any quarter of the last calendar year...

  17. Ultra-high temperature tensile properties of ODS steel claddings under severe accident conditions

    NASA Astrophysics Data System (ADS)

    Yano, Y.; Tanno, T.; Oka, H.; Ohtsuka, S.; Inoue, T.; Kato, S.; Furukawa, T.; Uwaba, T.; Kaito, T.; Ukai, S.; Oono, N.; Kimura, A.; Hayashi, S.; Torimaru, T.

    2017-04-01

    Ultra-high temperature ring tensile tests were performed to investigate the tensile behavior of oxide dispersion strengthened (ODS) steel claddings and wrapper materials under severe accident conditions with temperatures ranging from room temperature to 1400 °C which is close to the melting point of core materials. The experimental results showed that the tensile strength of 9Cr-ODS steel claddings was highest in the core materials at ultra-high temperatures of 900-1200 °C, but there was significant degradation in the tensile strength of 9Cr-ODS steel claddings above 1200 °C. This degradation was attributed to grain boundary sliding deformation with γ/δ transformation, which is associated with reduced ductility. By contrast, the tensile strength of recrystallized 12Cr-ODS and FeCrAl-ODS steel claddings retained its high value above 1200 °C, unlike the other tested materials.

  18. Behavior of Fe-ODS Alloys After Thermal Aging Treatments

    NASA Astrophysics Data System (ADS)

    Serrano Garcia, Marta; Hernández-Mayoral, Mercedes; Esparraguera, Elvira Oñorbe

    2016-06-01

    Oxide dispersion alloys are one of the candidates as cladding materials for Gen IV fast reactors, due to their high strength at high temperature, good creep properties, and swelling resistance. This good performance is mainly due to a fine dispersion of nano-oxide particles on the microstructure and to non-grained structure. The microstructural stability and the mechanical properties of a Fe-ODS alloy are studied after different thermal aging experiments at 973 K (700 °C), 5000 hours; 973 K (700 °C), 10,000 hours; and 1123 K (850 °C), 10,000 hours. SEM/EBSD and TEM together with tensile and impact tests on the as-received and thermally aged material have been carried out. In general, for all the tested conditions, a slight softening effect is observed attributed to the changes in the grain structure as well as to the changes in the amount and size of nano-oxide particles. In addition, the aged material shows a lower impact USE value while the DBTT is maintained.

  19. [Enantioseparation behavior of chiral stationary phases AD, AS and OD].

    PubMed

    Li, Liqun; Fan, Jun; Zhang, Jing; Chen, Xiaodong; Wang, Tai; He, Jianfeng; Zhang, Weiguang

    2016-01-01

    Over the past decades, HPLC enantioseparation with chiral stationary phases (CSPs) has been widely applied in chiral analysis and preparation of new pharmaceuticals, pesticides, food, etc. Herein, enantioseparation of 20 chiral compounds have been carried out on three polysaccharide-based CSPs (EnantioPak AD, AS and OD) with normal phases by HPLC, separately. The influences of skeletal structure and the kinds of derivative groups on separation behaviors of these CSPs have been studied in detail. As results indicated, except for compound 13, the other compounds were baseline separated on EnantioPak AD, with most of resolution over 2. 0; in addition, better separation for acidic or basic compounds was achieved through adding acidic/basic additives into the mobile phase of hexane-alcohol. For four aromatic alcohols (compounds 13-16), their retention in the EnantioPak AD column showed a weakening tendency with increase of carbon number in side chain group, and the reverse trend of their resolution was observed. Furthermore, EnantioPak AD showed much better separation performance for eight compounds (13-20) than the others. In short, these results have provided some references for further investigation of separation behavior and applications of polysaccharide-based CSPs.

  20. Microstructure Evolution of Gas Atomized Iron Based ODS Alloys

    SciTech Connect

    Rieken, J.R.; Anderson, I.E.; Kramer, M.J.; Anderegg, J.W.; Shechtman, D.

    2009-12-01

    In a simplified process to produce precursor powders for oxide dispersion-strength- ened (ODS) alloys, gas-atomization reaction synthesis (GARS) was used to induce a surface oxide layer on molten droplets of three differing erritic stainless steel alloys during break-up and rapid solidification. The chemistry of the surface oxide was identified using auger electron spectroscopy (AES) and scanning electron microscopy (SEM) with energy dispersive spectroscopy (EDS). The precursor iron-base powders were consolidated at 850 C and 1,300 C using hot isostatic pressing (HIPing). Consolidation at the lower temperature resulted in a fully dense microstructure, while preventing substantial prior particle-boundary-oxide dissociation. Microstructural analysis of the alloys consolidated at the higher temperature confirmed a significant reduction in prior-particle-boundary-oxide volume fraction, in comparison with the lower-temperature-consolidated sample. This provided evidence that a high-temperature internal oxygen-exchange reaction occurred between the metastable prior particle-boundary-oxide phase (chromium oxide) and the yttrium contained within each prior particle. This internal oxygen-exchange reaction is shown to result in the formation of yttrium-enriched oxide dispersoids throughout the alloy microstructure. The evolving microstructure was characterized using transmission electron microscopy (TEM) and high-energy X-ray diffraction (HE-XRD).

  1. Microstructure Evolution of Gas Atomized Iron Based ODS Alloys

    SciTech Connect

    Rieken, J.R.; Anderson, I.E.; Kramer, M.J.

    2011-08-09

    In a simplified process to produce precursor powders for oxide dispersion-strengthened (ODS) alloys, gas-atomization reaction synthesis (GARS) was used to induce a surface oxide layer on molten droplets of three differing erritic stainless steel alloys during break-up and rapid solidification. The chemistry of the surface oxide was identified using auger electron spectroscopy (AES) and scanning electron microscopy (SEM) with energy dispersive spectroscopy (EDS). The precursor iron-base powders were consolidated at 850 C and 1,300 C using hot isostatic pressing (HIPing). Consolidation at the lower temperature resulted in a fully dense microstructure, while preventing substantial prior particle-boundary-oxide dissociation. Microstructural analysis of the alloys consolidated at the higher temperature confirmed a significant reduction in prior-particle-boundary-oxide volume fraction, in comparison with the lower-temperature-consolidated sample. This provided evidence that a high-temperature internal oxygen-exchange reaction occurred between the metastable prior particle-boundary-oxide phase (chromium oxide) and the yttrium contained within each prior particle. This internal oxygen-exchange reaction is shown to result in the formation of yttrium-enriched oxide dispersoids throughout the alloy microstructure. The evolving microstructure was characterized using transmission electron microscopy (TEM) and high-energy X-ray diffraction (HE-XRD).

  2. Thermal-induced phase-change ODS and photo-excited bistable state-change DVD-RAM

    NASA Astrophysics Data System (ADS)

    Rong, Ailun; Huang, De-yin; Lu, Yanwu; Zhang, Zhonglin; Shi, Luqing; Wang, Rui

    1996-09-01

    High density and high data rate are two key points in the development of ODS (optical data storage) which has advanced remarkably in recent years. The aim of this contribution is to report on the migration from CD-E to DVD-RAM by changing: 1) the recording media from heat-mode material to photo-mode material, 2) the recording laser from near infrared to green or blue wavelength, and 3) the recording methods from CD- format to sectorial format and from PPM-RLL to PWM-RLL, where PPM and PWM are pulse position modulation and pulse width modulation respectively, of which all have a potential to achieve an ultrafast recording rate-60ps/bit.

  3. Continuation of Studies on Development of ODS Heat Exchanger Tubing

    SciTech Connect

    Lawrence Brown; David Workman; Bimal Kad; Gaylord Smith; Archie Robertson; Ian Wright

    2008-04-15

    The Department of Energy (DOE), National Energy Technology Center (NETL), has initiated a strategic plan for the development of advanced technologies needed to design and build fossil fuel plants with very high efficiency and environmental performance. These plants, referred to as 'Vision 21' and FutureGen programs by DOE, will produce electricity, chemicals, fuels, or a combination of these products, and possibly secondary products such as steam/heat for industrial use. MA956 is a prime candidate material being considered for a high temperature heat exchanger in the 'Vision 21' and FutureGen programs. This material is an oxide dispersion strengthened (ODS) alloy; however, there are some gaps in the data required to commit to the use of these alloys in a full-size plant. To fill the technology gaps for commercial production and use of the material for 'Advanced Power Generation Systems' this project has performed development activity to significant increase in circumferential strength of MA956 as compared to currently available material, investigated bonding technologies for bonding tube-to-tube joints through joining development, and performed tensile, creep and fire-side corrosion tests to validate the use and fabrication processes of MA956 to heat exchanger tubing applications. Development activities within this projected has demonstrated increased circumferential strength of MA956 tubes through flow form processing. Of the six fabrication technologies for bonding tube-to-tube joints, inertia friction welding (IFW) and flash butt welding (FBW) were identified as processes for joining MA956 tubes. Tensile, creep, and fire-side corrosion test data were generated for both base metal and weld joints. The data can be used for design of future systems employing MA956. Based upon the positive development activities, two test probes were designed and fabricated for field exposure testing at 1204 C ({approx}2200 F) flue gas. The probes contained tube portions with FBW

  4. Effects of mechanical alloying time on microstructure and properties of 9Cr-ODS steels

    NASA Astrophysics Data System (ADS)

    Xie, Rui; Lu, Zheng; Lu, Chenyang; Liu, Chunming

    2014-12-01

    Pre-alloyed powders of oxide dispersion strengthened (ODS) steels were produced by atomization. The atomized powders without mechanical alloying (MA) and with short-time MA were consolidated by hot isostatic pressing (HIP). The morphology and microstructure of the atomized and the MA powders were studied by scanning electron microscopy (SEM) and X-ray diffraction (XRD). The microstructure of 9Cr-ODS steels with different MA time was characterized by high-resolution transmission electron microscopy (HRTEM), electron backscatter diffraction (EBSD) and atom probe tomography (APT). The results showed that high-density of nanosized precipitates and ultrafine grains are formed in the ODS steels using the processing route, which remarkably reduce MA time. The yield strength and ultimate tensile strength of ODS steels are improved with the increase of MA time.

  5. Microstructural and mechanical property characterization of ingot metallurgy ODS iron aluminide

    SciTech Connect

    Sikka, V.K.; Howell, C.R.; Hall, F.; Valykeo, J.

    1997-12-01

    This paper deals with a novel, lower cost method of producing a oxide dispersion strengthened (ODS) iron-aluminide alloy. A large 250-kg batch of ODS iron-aluminide alloy designated as FAS was produced by Hoskins Manufacturing Company (Hoskins) [Hamburg, Michigan] using the new process. Plate and bar stock of the ODS alloy were the two major products received. Each of the products was characterized for its microstructure, including grain size and uniformity of oxide dispersion. Tensile tests were completed from room temperature to 1100 C. Only 100-h creep tests were completed at 800 and 1000 C. The results of these tests are compared with the commercial ODS alloy designated as MA-956. An assessment of these data is used to develop future plans for additional work and identifying applications.

  6. Chemical engineering and structural and pharmacological characterization of the α-scorpion toxin OD1.

    PubMed

    Durek, Thomas; Vetter, Irina; Wang, Ching-I Anderson; Motin, Leonid; Knapp, Oliver; Adams, David J; Lewis, Richard J; Alewood, Paul F

    2013-01-01

    Scorpion α-toxins are invaluable pharmacological tools for studying voltage-gated sodium channels, but few structure-function studies have been undertaken due to their challenging synthesis. To address this deficiency, we report a chemical engineering strategy based upon native chemical ligation. The chemical synthesis of α-toxin OD1 was achieved by chemical ligation of three unprotected peptide segments. A high resolution X-ray structure (1.8 Å) of synthetic OD1 showed the typical βαββ α-toxin fold and revealed important conformational differences in the pharmacophore region when compared with other α-toxin structures. Pharmacological analysis of synthetic OD1 revealed potent α-toxin activity (inhibition of fast inactivation) at Nav1.7, as well as Nav1.4 and Nav1.6. In addition, OD1 also produced potent β-toxin activity at Nav1.4 and Nav1.6 (shift of channel activation in the hyperpolarizing direction), indicating that OD1 might interact at more than one site with Nav1.4 and Nav1.6. Investigation of nine OD1 mutants revealed that three residues in the reverse turn contributed significantly to selectivity, with the triple OD1 mutant (D9K, D10P, K11H) being 40-fold more selective for Nav1.7 over Nav1.6, while OD1 K11V was 5-fold more selective for Nav1.6 than Nav1.7. This switch in selectivity highlights the importance of the reverse turn for engineering α-toxins with altered selectivity at Nav subtypes.

  7. Commissioning and initial experimental program of the BGO-OD experiment at ELSA

    NASA Astrophysics Data System (ADS)

    Alef, S.; Bauer, P.; Bayadilov, D.; Beck, R.; Becker, M.; Bella, A.; Bielefeldt, P.; Böse, S.; Braghieri, A.; Brinkmann, K.; Cole, P.; Di Salvo, R.; Dutz, H.; Elsner, D.; Fantini, A.; Freyermuth, O.; Friedrich, S.; Frommberger, F.; Ganenko, V.; Geffers, D.; Gervino, G.; Ghio, F.; Görtz, S.; Gridnev, A.; Gutz, E.; Hammann, D.; Hannappel, J.; Hillert, W.; Ignatov, A.; Jahn, R.; Joosten, R.; Jude, T. C.; Klein, F.; Knaust, J.; Kohl, K.; Koop, K.; Krusche, B.; Lapik, A.; Levi Sandri, P.; Lopatin, I. V.; Mandaglio, G.; Messi, F.; Messi, R.; Metag, V.; Moricciani, D.; Mushkarenkov, A.; Nanova, M.; Nedorezov, V.; Novinskiy, D.; Pedroni, P.; Reitz, B.; Romaniuk, M.; Rostomyan, T.; Rudnev, N.; Schaerf, C.; Scheluchin, G.; Schmieden, H.; Stugelev, A.; Sumachev, V.; Tarakanov, V.; Vegna, V.; Walther, D.; Watts, D.; Zaunick, H.; Zimmermann, T.

    2016-11-01

    BGO-OD is a new meson photoproduction experiment at the ELSA facility of Bonn University. It aims at the investigation of non strange and strange baryon excitations, and is especially designed to be able to detect weekly bound meson-baryon type structures. The setup for the BGO-OD experiment is presented, the characteristics of the photon beam and the detector performances are shown and the initial experimental program is discussed.

  8. Evaluation of oxide dispersion strengthened (ODS) molybdenum and molybdenum-rhenium Alloys

    SciTech Connect

    Mueller, A.J.; Bianco, R.; Buckman, R.W. Jr.

    1999-10-22

    Oxide dispersion strengthened (ODS) molybdenum alloys being developed for high temperature applications possess excellent high temperature strength and creep resistance. In addition they exhibit a ductile-to-brittle transition temperature (DBIT) in the worked and stress-relieved condition under longitudinal tensile load well below room temperature. However, in the recrystallized condition, the DBTT maybe near or above room temperature, depending on the volume fraction of oxide dispersion and the amount of prior work. Dilute rhenium additions (7 and 14 wt.%) to ODS molybdenum were evaluated to determine their effect on low temperature ductility. The addition of 7 wt.% rhenium to the ODS molybdenum did not significantly enhance the mechanical properties. However, the addition of 14 wt.% rhenium to the ODS molybdenum resulted in a DBTT well below room temperature in both the stress-relieved and recrystallized condition. Additionally, the tensile strength of ODS Mo-14Re is greater than the base ODS molybdenum at 1,000 to 1,250 C.

  9. odNEAT: An Algorithm for Decentralised Online Evolution of Robotic Controllers.

    PubMed

    Silva, Fernando; Urbano, Paulo; Correia, Luís; Christensen, Anders Lyhne

    2015-01-01

    Online evolution gives robots the capacity to learn new tasks and to adapt to changing environmental conditions during task execution. Previous approaches to online evolution of neural controllers are typically limited to the optimisation of weights in networks with a prespecified, fixed topology. In this article, we propose a novel approach to online learning in groups of autonomous robots called odNEAT. odNEAT is a distributed and decentralised neuroevolution algorithm that evolves both weights and network topology. We demonstrate odNEAT in three multirobot tasks: aggregation, integrated navigation and obstacle avoidance, and phototaxis. Results show that odNEAT approximates the performance of rtNEAT, an efficient centralised method, and outperforms IM-(μ + 1), a decentralised neuroevolution algorithm. Compared with rtNEAT and IM-(μ + 1), odNEAT's evolutionary dynamics lead to the synthesis of less complex neural controllers with superior generalisation capabilities. We show that robots executing odNEAT can display a high degree of fault tolerance as they are able to adapt and learn new behaviours in the presence of faults. We conclude with a series of ablation studies to analyse the impact of each algorithmic component on performance.

  10. Development of Oxide Dispersion Strengthened (ODS) Ferritic Steel Through Powder Forging

    NASA Astrophysics Data System (ADS)

    Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

    2017-02-01

    Oxide dispersion strengthened (ODS) ferritic steels are candidates for cladding tubes in fast breeder nuclear reactors. In this study, an 18%Cr ODS ferritic steel was prepared through powder forging route. Elemental powders with a nominal composition of Fe-18Cr-2 W-0.2Ti (composition in wt.%) with 0 and 0.35% yttria were prepared by mechanical alloying in a Simoloyer attritor under argon atmosphere. The alloyed powders were heated in a mild steel can to 1473 K under flowing hydrogen atmosphere. The can was then hot forged. Steps of sealing, degassing and evacuation are eliminated by using powder forging. Heating ODS powder in hydrogen atmosphere ensures good bonding between alloy powders. A dense ODS alloy with an attractive combination of strength and ductility was obtained after re-forging. On testing at 973 K, a loss in ductility was observed in yttria-containing alloy. The strength and ductility increased with increase in strain rate at 973 K. Reasons for this are discussed. The ODS alloy exhibited a recrystallized microstructure which is difficult to achieve by extrusion. No prior particle boundaries were observed after forging. The forged compacts exhibited isotropic mechanical properties. It is suggested that powder forging may offer several advantages over the traditional extrusion/HIP routes for fabrication of ODS alloys.

  11. Utilization of scanning laser ophthalmoscopy in laser-induced bilateral human retinal nerve fiber layer damage

    NASA Astrophysics Data System (ADS)

    Zwick, Harry; Gagliano, Donald A.; Ruiz, S.; Stuck, Bruce E.

    1995-05-01

    In this paper, we describe a military laser accident case where bilateral Q-switched laser exposure resulted in bilateral macular damage with immediate visual acuity loss in one eye (OS) and delayed visual acuity loss in the other exposed eye (OD), where retinal damage appeared more parafoveal. At 6 weeks post exposure, OS had recovered to 20/17 and OD had dropped to 20/100 Snellen activity. Retinal nerve fiber damage was observed in both eyes at this time. Contrast sensitivity measurements made in OS were suppressed across all spatial frequencies, even though Snellen acuity measured in the normal range. More severe high spatial frequency loss in contrast was measured in the right eye as well as low spatial frequency loss. Both OS and OD revealed a parafoveal preferred retinal locus with scanning laser ophthalmoscopy contrast sensitivity measurements, suggesting parafoveal retinal compensatory processes.

  12. Development of Austenitic ODS Strengthened Alloys for Very High Temperature Applications

    SciTech Connect

    Stubbins, James; Heuser, Brent; Robertson, Ian; Sehitoglu, Huseyin; Sofronis, Petros; Gewirth, Andrew

    2015-04-22

    This “Blue Sky” project was directed at exploring the opportunities that would be gained by developing Oxide Dispersion Strengthened (ODS) alloys based on the Fe-Cr-Ni austenitic alloy system. A great deal of research effort has been directed toward ferritic and ferritic/martensitic ODS alloys which has resulted in reasonable advances in alloy properties. Similar gains should be possible with austenitic alloy which would also take advantage of other superior properties of that alloy system. The research effort was aimed at the developing an in-depth understanding of the microstructural-level strengthening effects of ODS particles in austentic alloys. This was accomplished on a variety of alloy compositions with the main focus on 304SS and 316SS compositions. A further goal was to develop an understanding other the role of ODS particles on crack propagation and creep performance. Since these later two properties require bulk alloy material which was not available, this work was carried out on promising austentic alloy systems which could later be enhanced with ODS strengthening. The research relied on a large variety of micro-analytical techniques, many of which were available through various scientific user facilities. Access to these facilities throughout the course of this work was instrumental in gathering complimentary data from various analysis techniques to form a well-rounded picture of the processes which control austenitic ODS alloy performance. Micromechanical testing of the austenitic ODS alloys confirmed their highly superior mechanical properties at elevated temperature from the enhanced strengthening effects. The study analyzed the microstructural mechanisms that provide this enhanced high temperature performance. The findings confirm that the smallest size ODS particles provide the most potent strengthening component. Larger particles and other thermally- driven precipitate structures were less effective contributors and, in some cases, limited

  13. Microstructure of a 14Cr-ODS ferritic steel before and after helium ion implantation

    NASA Astrophysics Data System (ADS)

    Lu, Chenyang; Lu, Zheng; Xie, Rui; Liu, Chunming; Wang, Lumin

    2014-12-01

    A 14Cr-ODS ferritic steel with the nominal compositions of Fe-14Cr-2 W-0.3Ti-0.3Y2O3 (wt.%) was produced by mechanical alloying (MA) and hot isostatic pressing (HIP). Helium ion was implanted into the 14Cr-ODS steel along with Eurofer 97 steel as reference at 400 °C to a fluence of 1 × 1017 He+/cm2. High resolution transmission electron microscopy (HRTEM), high angle annual dark field (HAADF) scanning TEM (STEM) and atom probe tomography (APT) were used to characterize the microstructure of 14Cr-ODS and Eurofer 97 steels before and after helium implantation. High-density Y-Ti-O-rich nanoclusters and Y2Ti2O7 precipitates as well as large Cr-Ti rich oxides were observed in the 14Cr-ODS steel. The average size of Y-Ti-O nanoclusters and Y2Ti2O7 precipitates is 9 nm. After helium implantation, the helium bubbles formed in the 14Cr-ODS steel exhibit the smaller size and the lower volume fraction than that in Eurofer 97 steel, indicating high-density nano-scale precipitates can effectively suppress the coarsening of helium bubbles.

  14. Creep constitutive equation of dual phase 9Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Sakasegawa, Hideo; Ukai, Shigeharu; Tamura, Manabu; Ohtsuka, Satoshi; Tanigawa, Hiroyasu; Ogiwara, Hiroyuki; Kohyama, Akira; Fujiwara, Masayuki

    2008-02-01

    9Cr-ODS (oxide dispersion strengthened) steels developed by JAEA (Japan Atomic Energy Agency) have superior creep properties compared with conventional heat resistant steels. The ODS steels can enormously contribute to practical applications of fast breeder reactors and more attractive fusion reactors. Key issues are developments of material processing procedures for mass production and creep life prediction methods in present R&D. In this study, formulation of creep constitutive equation was performed against the backdrop. The 9Cr-ODS steel displaying an excellent creep property is a dual phase steel. The ODS steel is strengthened by the δ ferrite which has a finer dispersion of oxide particles and shows a higher hardness than the α' martensite. The δ ferrite functions as a reinforcement in the dual phase 9Cr-ODS steel. Its creep behavior is very unique and cannot be interpreted by conventional theories of heat resistant steels. Alternative qualitative model of creep mechanism was formulated at the start of this study using the results of microstructural observations. Based on the alternative creep mechanism model, a novel creep constitutive equation was formulated using the exponential type creep equation extended by a law of mixture.

  15. Status of FeCrAl ODS Irradiations in the High Flux Isotope Reactor

    SciTech Connect

    Field, Kevin G.; Howard, Richard H.

    2016-08-19

    FeCrAl oxide-dispersion strengthened (ODS) alloys are an attractive sub-set alloy class of the more global FeCrAl material class for nuclear applications due to their high-temperature steam oxidation resistance and hypothesized enhanced radiation tolerance. A need currently exists to determine the radiation tolerance of these newly developed alloys. To address this need, a preliminary study was conducted using the High Flux Isotope Reactor (HFIR) to irradiate an early generation FeCrAl ODS alloy, 125YF. Preliminary post-irradiation examination (PIE) on these irradiated specimens have shown good radiation tolerance at elevated temperatures (≥330°C) but possible radiation-induced hardening and embrittlement at irradiations of 200°C to a damage level of 1.9 displacement per atom (dpa). Building on this experience, a new series of irradiations are currently being conceptualized. This irradiation series called the FCAD irradiation program will irradiate the latest generation FeCrAl ODS and FeCr ODS alloys to significantly higher doses. These experiments will provide the necessary information to determine the mechanical performance of irradiated FeCrAl ODS alloys at light water reactor and fast reactor conditions.

  16. Characterization of precipitates in nano structured 14% Cr ODS alloys for fusion application

    NASA Astrophysics Data System (ADS)

    He, P.; Klimenkov, M.; Lindau, R.; Möslang, A.

    2012-09-01

    Oxide dispersion strengthened (ODS) reduced activation ferritic (RAF) steels, have been considered as promising materials for application in fusion power reactors up to about 750 °C. Four ODS RAF steels, with compositions of Fe-13.5Cr-2W-(0-0.2-0.3-0.4)Ti-0.3Y2O3 (in wt.%) were produced by powder metallurgy technique. For the different Ti-contents, the correlation between microstructure and mechanical properties was analyzed by means of scanning electron microscope (SEM) and transmission electron microscope (TEM) equipped with energy- dispersive X-ray spectrometer (EDX) and electron energy loss spectrometer (EELS). A bimodal grain size distribution was observed in all as-hipped Ti-containing ODS alloys. These alloys consisted of coarse grains typical ranging from 1 μm to 8 μm and fine grains well below 1 μm in diameter. The addition of Ti resulted in the formation of spherical Ti oxides rather than Cr oxides owing to the stronger affinity of Ti. The influence of Ti on particle size refinement was striking and the optimum effect was obtained when adding 0.3% Ti. Generally the hardness increased consistently with increasing in Ti content. The ODS alloying with 0.3% Ti exhibit the highest strength due to the optimum refinement of mean ODS particle size.

  17. HRTEM Study of the Role of Nanoparticles in ODS Ferritic Steel

    SciTech Connect

    Hsiung, L; Tumey, S; Fluss, M; Serruys, Y; Willaime, F

    2011-08-30

    Structures of nanoparticles and their role in dual-ion irradiated Fe-16Cr-4.5Al-0.3Ti-2W-0.37Y{sub 2}O{sub 3} (K3) ODS ferritic steel produced by mechanical alloying (MA) were studied using high-resolution transmission electron microscopy (HRTEM) techniques. The observation of Y{sub 4}Al{sub 2}O{sub 9} complex-oxide nanoparticles in the ODS steel imply that decomposition of Y{sub 2}O{sub 3} in association with internal oxidation of Al occurred during mechanical alloying. HRTEM observations of crystalline and partially crystalline nanoparticles larger than {approx}2 nm and amorphous cluster-domains smaller than {approx}2 nm provide an insight into the formation mechanism of nanoparticles/clusters in MA/ODS steels, which we believe involves solid-state amorphization and re-crystallization. The role of nanoparticles/clusters in suppressing radiation-induced swelling is revealed through TEM examinations of cavity distributions in (Fe + He) dual-ion irradiated K3-ODS steel. HRTEM observations of helium-filled cavities (helium bubbles) preferably trapped at nanoparticle/clusters in dual-ion irradiated K3-ODS are presented.

  18. Research on Methods of Processing Transit IC Card Information and Constructing Transit OD Matrix

    NASA Astrophysics Data System (ADS)

    Han, Xiuhua; Li, Jin; Peng, Han

    Transit OD matrix is of vital importance when planning urban transit system. Traditional transit OD matrix constructing method needs a large range of spot check survey. It is expensive and needs long cycle time to process information. Recently transit IC card charging systems have been widely applied in big cities. Being processed reasonably, transit passenger information stored in IC card database can turn into information resource. It will reduce survey cost a lot. The concept of transit trip chain is put forward in this paper. According to the characteristics of closed transit trip chain, it discusses how to process IC card information and construct transit OD matrix. It also points out that urban transit information platform and data warehouse should be constructed, and how to integrate IC card information.

  19. Structure of Oxide Nanoparticles in Fe-16Cr MA/ODS Ferritic Steel

    SciTech Connect

    Hsiung, L; Fluss, M; Kimura, A

    2010-04-06

    Oxide nanoparticles in Fe-16Cr ODS ferritic steel fabricated by mechanical alloying (MA) method have been examined using high-resolution transmission electron microscopy (HRTEM) techniques. A partial crystallization of oxide nanoparticles was frequently observed in as-fabricated ODS steel. The crystal structure of crystalline oxide particles is identified to be mainly Y{sub 4}Al{sub 2}O{sub 9} (YAM) with a monoclinic structure. Large nanoparticles with a diameter larger than 20 nm tend to be incoherent and have a nearly spherical shape, whereas small nanoparticles with a diameter smaller than 10 nm tend to be coherent or semi-coherent and have faceted boundaries. The oxide nanoparticles become fully crystallized after prolonged annealing at 900 C. These results lead us to propose a three-stage formation mechanism of oxide nanoparticles in MA/ODS steels.

  20. Investigation of microstructure changes in ODS-EUROFER after hydrogen loading

    NASA Astrophysics Data System (ADS)

    Emelyanova, O. V.; Ganchenkova, M. G.; Malitskii, E.; Yagodzinskyy, Y. N.; Klimenkov, M.; Borodin, V. A.; Vladimirov, P. V.; Lindau, R.; Möslang, A.; Hänninen, H.

    2016-01-01

    The effect of hydrogen on the microstructure of mechanically tested ODS-EUROFER steel was investigated by means of transmission electron microscopy, thermal desorption spectroscopy, and atomistic simulations. The presence of yttrium oxide particles notably increases hydrogen uptake in ODS-EUROFER steel as compared to ODS-free EUROFER 97. Under tensile loading, hydrogen accumulation promotes the loss of cohesion at the oxide particle interfaces. First-principles molecular dynamics simulations indicate that hydrogen can be trapped at nanoparticle/matrix interface, creating OH-groups. The accumulation of hydrogen atoms at the oxide particle surface can be the reason for the observed hydrogen-induced oxide/matrix interface weakening and de-cohesion under the action of external tensile stress.

  1. Characterization of Residual Stress as a Function of Friction Stir Welding Parameters in ODS Steel MA956

    DTIC Science & Technology

    2013-06-01

    8  Figure 5.  (a) Residual stress profiles for the FSW of AA 5083. From Peel [15]. (b) The residual stress profile across PM2000, an ODS steel ...solid state technique for joining ODS steels (Figure 2). FSW does not melt the base metal, and preserves many mechanical and microstructural properties...been performed by Baker [5] and Han [12] for fine-grained ODS steels subjected to a variety of FSW conditions. Fine grained material has a grain

  2. Optimization of High Temperature Hoop Creep Response in ODS-Fe3Al Tubes

    SciTech Connect

    Kad, B.K.; Heatherington, J.H.; McKamey, C.; Wright, I.; Sikka, V.; Judkins, R.

    2003-04-22

    Oxide dispersion strengthened (ODS) Fe3Al alloys are currently being developed for heat-exchanger tubes for eventual use at operating temperatures of up to 1100 C in the power generation industry. The development challenges include (a) efforts to produce thin walled ODS-Fe3Al tubes, employing powder extrusion methodologies, with (b) adequate increased strength for service at operating temperatures to (c) mitigate creep failures by enhancing the as-processed grain size. A detailed and comprehensive research and development methodology is prescribed to produce ODS-Fe3Al thin walled tubes. Current single step extrusion consolidation methodologies typically yield 8ft. lengths of 1-3/8 inch diameter, 1/8 inch wall thickness ODS-Fe3Al tubes. The process parameters for such consolidation methodologies have been prescribed and evaluated as being routinely reproducible. Recrystallization treatments at 1200 C produce elongated grains (with their long axis parallel to the extrusion axis), typically 200-2000 {micro}m in diameter, and several millimeters long. The dispersion distribution is unaltered on a micro scale by recrystallization, but the high aspect ratio grain shape typically obtained limits grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloys requires an understanding and manipulating the factors that control grain alignment and recrystallization behavior. Current efforts are focused on examining the processing dependent longitudinal vs. transverse creep anisotropy, and exploring post-extrusion methods to improve hoop creep response in ODS-Fe3Al alloy tubes. In this report we examine the mechanisms of hoop creep failure and describe our efforts to improve creep performance via variations in thermal-mechanical treatments.

  3. Effect of displacement damage on the stability of oxide nanoparticles in model ODS alloys: TEM studies

    SciTech Connect

    Santra, Sumita; Balaji, S.; Panigrahi, B. K.; Serruys, Yves; Robertson, C.; Ana, Alamo; Sundar, C. S.

    2012-06-05

    Model ODS alloy containing Fe-0.3% yttria was prepared by ball milling and hipping at high temperature and the effect of irradiation on stability of yttria nanoclusters in model ODS alloy is studied by dual beam ion irradiation using 5 MeV Fe{sup +} and 1.5 MeV He{sup +} ions. TEM studies on irradiated sample show that these particles are stable at 25 dpa and 40 appm He concentration. However, at 80 dpa and 360 appm He concentration Yttria particles were found to be unstable as evidenced from increase in average particle size and particle size distribution.

  4. Irradiation effects in oxide dispersion strengthened (ODS) Ni-base alloys for Gen. IV nuclear reactors

    NASA Astrophysics Data System (ADS)

    Oono, Naoko; Ukai, Shigeharu; Kondo, Sosuke; Hashitomi, Okinobu; Kimura, Akihiko

    2015-10-01

    Oxide particle dispersion strengthened (ODS) Ni-base alloys are irradiated by using simulation technique (Fe/He dual-ion irradiation) to investigate the reliability to Gen. IV high-temperature reactors. The fine oxide particles with less than 10 nm in average size and approximately 8.0 × 1022 m-3 in number density remained after 101 dpa irradiation. The tiny helium bubbles were inside grains, not at grain-boundaries; it is advantageous effect of oxide particles which trap the helium atoms at the particle-matrix interface. Ni-base ODS alloys demonstrated their great ability to overcome He embrittlement.

  5. Development of ODS FeCrAl alloys for accident-tolerant fuel cladding

    SciTech Connect

    Dryepondt, Sebastien N.; Hoelzer, David T.; Pint, Bruce A.; Unocic, Kinga A.

    2015-09-18

    FeCrAl alloys are prime candidates for accident-tolerant fuel cladding due to their excellent oxidation resistance up to 1400 C and good mechanical properties at intermediate temperature. Former commercial oxide dispersion strengthened (ODS) FeCrAl alloys such as PM2000 exhibit significantly better tensile strength than wrought FeCrAl alloys, which would alloy for the fabrication of a very thin (~250 m) ODS FeCrAl cladding and limit the neutronic penalty from the replacement of Zr-based alloys by Fe-based alloys. Several Fe-12-Cr-5Al ODS alloys where therefore fabricated by ball milling FeCrAl powders with Y2O3 and additional oxides such as TiO2 or ZrO2. The new Fe-12Cr-5Al ODS alloys showed excellent tensile strength up to 800 C but limited ductility. Good oxidation resistance in steam at 1200 and 1400 C was observed except for one ODS FeCrAl alloy containing Ti. Rolling trials were conducted at 300, 600 C and 800 C to simulate the fabrication of thin tube cladding and a plate thickness of ~0.6mm was reached before the formation of multiple edge cracks. Hardness measurements at different stages of the rolling process, before and after annealing for 1h at 1000 C, showed that a thinner plate thickness could likely be achieved by using a multi-step approach combining warm rolling and high temperature annealing. Finally, new Fe-10-12Cr-5.5-6Al-Z gas atomized powders have been purchased to fabricate the second generation of low-Cr ODS FeCrAl alloys. The main goals are to assess the effect of O, C, N and Zr contents on the ODS FeCrAl microstructure and mechanical properties, and to optimize the fabrication process to improve the ductility of the 2nd gen ODS FeCrAl while maintaining good mechanical strength and oxidation resistance.

  6. The photodissociation lifetimes of the OH and OD radicals in comets

    NASA Technical Reports Server (NTRS)

    Singh, P. D.; Van Dishoeck, E. F.; Dalgarno, A.

    1983-01-01

    The photodissociation rates of OH and OD molecules due to absorption of solar radiation in the X(2)Pi-A(2)Sigma(+) electronic transition are calculated to lie between 3.5 and 6.7 x 10 to the -6th/sec for OH for heliocentric velocities between -60 and +60 km/sec and at about 4.7 x 10 to the -7th/sec for OD at 1 AU from the sun. The corresponding lifetimes, which are upper bounds to the actual lifetimes, are generally consistent with the observational cometary data.

  7. Initial Development in Joining of ODS Alloys Using Friction Stir Welding

    SciTech Connect

    Ren, Weiju; Feng, Zhili

    2007-08-01

    Solid-state welding of oxide-dispersion-strengthened (ODS) alloy MA956 sheets using friction stir welding (FSW) was investigated. Butt weld was successfully produced. The weld and base metals were characterized using optical microscopy, scanning electronic microscopy, transmission electronic microscopy, and energy dispersion x-ray spectrum. Microhardness mapping was also conducted over the weld region. Analyses indicate that the distribution of the strengthening oxides was preserved in the weld. Decrease in microhardness of the weld was observed but was insignificant. The preliminary results seem to confirm the envisioned feasibility of FSW application to ODS alloy joining. For application to Gen IV nuclear reactor heat exchanger, further investigation is suggested.

  8. Radiation Stability of Nanoclusters in Nano-structured Oxide Dispersion Strengthened (ODS) Steels

    SciTech Connect

    Certain, Alicia G.; Kuchibhatla, Satyanarayana V N T; Shutthanandan, V.; Hoelzer, D. T.; Allen, T. R.

    2013-03-01

    Nanostructured oxide dispersion strengthened (ODS) steels are considered candidates for nuclear fission and fusion applications at high temperature and dose. The complex oxide nanoclusters in these alloys provide high-temperature strength and are expected to afford better radiation resistance. Proton, heavy ion, and neutron irradiations have been performed to evaluate cluster stability in 14YWT and 9CrODS steel under a range of irradiation conditions. Energy-filtered transmission electron microscopy and atom probe tomography were used in this work to analyze the evolution of the oxide population.

  9. Infrared spectroscopic analysis of OH - and OD - in crystalline Li 2O as a function of chemical treatment

    NASA Astrophysics Data System (ADS)

    Kurasawa, T.; Maroni, V. A.

    1983-11-01

    Infrared spectroscopy has been used to study the chemical form and approximate concentration of OH - and OD - in Li 2O single crystals as a function of chemical treatment. Infrared absorption maxima at (3671±0.5) cm-1and (2711±3.3) cm-1 were observed for OH - and OD -, respectively. The absorption coefficient for OD - was determined to be 4.0±0.4 absorbance units per mol part per million OD - per mm of sample thickness. Vacuum baking of Li 2O crystals reduced the OH - and OD - concentrations to <50 mppm; baking in a low moisture-level D 2 environment at 600 to 800°C appeared to lead to volatilization of LiD from the Li 2O crystals; and baking in D 2 containing ( 350±50) mppm D 2O at 600 to 800°C produced a measurable quantity of LiOD. In all cases, the observed spectra indicated the presence of only one distinguishable form of OH - or OD - in the Li 2O lattice. Because of the close correspondence of the observed absorption maxima to reported values for pure LiOH and LiOD, the most consistent (although not conclusive) interpretation is that the OH - and OD - are present as a separate LiOH or LiOD phase at room temperature. Only limited conclusions can be drawn regarding the chemical state of OH - and OD - during the elevated temperatures exposures. An estimate of the approximate value for the solubility of tritium in Li 2O at 800°C was made using data from D 2/Li 2O isothermal exposure experiments — this value was ⩾ 25 wppm.

  10. Microstructural characterizations of 14Cr ODS ferritic steels subjected to hot torsion

    NASA Astrophysics Data System (ADS)

    Karch, A.; Sornin, D.; Barcelo, F.; Bosonnet, S.; de Carlan, Y.; Logé, R.

    2015-04-01

    Oxide dispersion strengthened (ODS) steels are very promising materials for nuclear applications. In this paper, the hot working behavior of ODS ferritic steels, consolidated by hot extrusion, is studied through torsion tests. Three ODS steels are produced acting on both the quantity of Ti and Y2O3 added to the matrix (wt% Fe-14Cr-1W), and the density and size of the nanoparticles. A temperature range of 1000-1200 °C and strain rates from 5 ṡ 10-2 to 5 s-1 are considered. The microstructures of deformed samples are examined by Electron Back-Scatter Diffraction and X-ray diffraction techniques. It is observed that hot plastic strain leads to an early damage with nucleation and growth of cavities along grain boundaries. Except for the damage, very few microstructural and textural evolutions are noticed. The three tested ODS steels exhibit almost the same behavior under hot torsion straining, regardless of the precipitation state. Overall, the experimental results are interpreted through a mechanism of strain accommodation at grain boundaries, with low dislocation activity in the bulk of the grains.

  11. Differences in ODS formatting for HTML with Proc Print and Proc Report

    Technology Transfer Automated Retrieval System (TEKTRAN)

    While proc print is a terrific tool for data checking and data summary, proc report is similar to, but more powerful because it can do some basic calculations or statistics and data can be broken more effectively into manageable fields. The ODS procedure can produce HTML files from either procedure...

  12. odò: weed management issues in North American edamame

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Despite the fact that the United States is a global leader in commodity soybean production, most of the vegetable soybean (i.e. edamame or máodò) consumed in North America is imported from Asia. Interest in domestically grown edamame is on the rise among consumers; however, the U.S. vegetable proces...

  13. Assessment of a new fabrication route for Fe-9Cr-1W ODS cladding tubes

    NASA Astrophysics Data System (ADS)

    Toualbi, L.; Cayron, C.; Olier, P.; Malaplate, J.; Praud, M.; Mathon, M.-H.; Bossu, D.; Rouesne, E.; Montani, A.; Logé, R.; de Carlan, Y.

    2012-09-01

    Oxide Dispersion Strengthened ferritic/martensitic steels are developed as future cladding materials for Generation IV Sodium-Cooled Fast Reactors. ODS alloys are elaborated by powder metallurgy, consolidated by hot extrusion and manufactured into tube cladding using cold rolling process. ODS steels present low ductility and high hardness at room temperature which complicate their manufacturing. Cold working leads to the hardening of the tube which needs to be softened by heat treatment. A new high temperature fabrication route performed on a Fe-9Cr-1W-Ti-Y2O3-ODS martensitic steel has been designed by following the hardness values, the morphological and crystallographic anisotropy and the nano-precipitation size evolution at each step of the fabrication route. Observations show that phase transformation from ferrite (α) to austenite (γ) is crucial to reduce the morphological and the crystallographic anisotropy induced by the manufacturing processes. The high temperature heat treatments permit to make the austenitic grain grow leading to an improvement of the cold workability. Ultimate Tensile Strength values obtained in the hoop direction remain about 315 MPa at 650 °C which is slightly lower compared to other Fe-9Cr ODS tubes but the new microstructure could be more favorable for creep properties.

  14. Coaching, HRD, and OD: Towards Three "Silo" Fields of Practice or a Single "Unified" Profession?

    ERIC Educational Resources Information Center

    Ellinger, Andrea D.; Hamlin, Robert G.; Beattie, Rona S.

    2008-01-01

    During the past few years, the growth of an emergent "coaching industry" in many countries has resulted in some scholars calling for the development of a "coaching profession." Yet, contemporary HRD and OD professionals conceive of coaching as a necessary area of expertise. This paper reports the results of a qualitative study of different…

  15. 46 CFR 280.9 - Special rules for last year of ODS agreement.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Special rules for last year of ODS agreement. 280.9 Section 280.9 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS LIMITATIONS ON THE AWARD AND PAYMENT OF OPERATING-DIFFERENTIAL SUBSIDY FOR LINER OPERATORS § 280.9 Special rules for...

  16. The optical depth sensor (ODS) for column dust opacity measurements and cloud detection on martian atmosphere

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Foujols, T.

    2016-08-01

    A lightweight and sophisticated optical depth sensor (ODS) able to measure alternatively scattered flux at zenith and the sum of the direct flux and the scattered flux in blue and red has been developed to work in martian environment. The principal goals of ODS are to perform measurements of the daily mean dust opacity and to retrieve the altitude and optical depth of high altitude clouds at twilight, crucial parameters in the understanding of martian meteorology. The retrieval procedure of dust opacity is based on the use of radiative transfer simulations reproducing observed changes in the solar flux during the day as a function of 4 free parameters: dust opacity in blue and red, and effective radius and effective width of dust size distribution. The detection of clouds is undertaken by looking at the time variation of the color index (CI), defined as the ratio between red and blue ODS channels, at twilight. The retrieval of altitude and optical depth of clouds is carried out using a radiative transfer model in spherical geometry to simulate the CI time variation at twilight. Here the different retrieval procedures to analyze ODS signals, as well as the results obtained in different sensitivity analysis are presented and discussed.

  17. Advanced ODS FeCrAl alloys for accident-tolerant fuel cladding

    SciTech Connect

    Dryepondt, Sebastien N; Unocic, Kinga A; Hoelzer, David T; Pint, Bruce A

    2014-09-01

    ODS FeCrAl alloys are being developed with optimum composition and properties for accident tolerant fuel cladding. Two oxide dispersion strengthened (ODS) Fe-15Cr-5Al+Y2O3 alloys were fabricated by ball milling and extrusion of gas atomized metallic powder mixed with Y2O3 powder. To assess the impact of Mo on the alloy mechanical properties, one alloy contained 1%Mo. The hardness and tensile properties of the two alloys were close and higher than the values reported for fine grain PM2000 alloy. This is likely due to the combination of a very fine grain structure and the presence of nano oxide precipitates. The nano oxide dispersion was however not sufficient to prevent grain boundary sliding at 800 C and the creep properties of the alloys were similar or only slightly superior to fine grain PM2000 alloy. Both alloys formed a protective alumina scale at 1200 C in air and steam and the mass gain curves were similar to curves generated with 12Cr-5Al+Y2O3 (+Hf or Zr) ODS alloys fabricated for a different project. To estimate the maximum temperature limit of use for the two alloys in steam, ramp tests at a rate of 5 C/min were carried out in steam. Like other ODS alloys, the two alloys showed a significant increase of the mas gains at T~ 1380 C compared with ~1480 C for wrought alloys of similar composition. The beneficial effect of Yttrium for wrought FeCrAl does not seem effective for most ODS FeCrAl alloys. Characterization of the hardness of annealed specimens revealed that the microstructure of the two alloys was not stable above 1000 C. Concurrent radiation results suggested that Cr levels <15wt% are desirable and the creep and oxidation results from the 12Cr ODS alloys indicate that a lower Cr, high strength ODS alloy with a higher maximum use temperature could be achieved.

  18. A stable, high power optically pumped far infrared laser system

    NASA Technical Reports Server (NTRS)

    Farhoomand, Jam; Pickett, Herbert M.

    1988-01-01

    The generation of 1.25 watts of CW laser power at the 119-micron (2522.8 GHz) methanol line is reported. The maximum frequency fluctuation of the free running laser is less than + or - 100 kHz per hour. This laser has also been tested on numerous other lines ranging from 403.7 GHz (HCOOH) to 5260 GHz (CH3OD) with improved power and stability.

  19. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-05-31

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (1) prescribe extrusion consolidation methodologies via detailed

  20. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-03-31

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (1) prescribe extrusion consolidation methodologies via detailed

  1. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2005-02-28

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  2. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-08-31

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  3. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2005-06-27

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  4. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-11-30

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  5. O(D-1) production in ozone photolysis near 310 nm

    NASA Technical Reports Server (NTRS)

    Lin, C.; Demore, W. B.

    1973-01-01

    Relative quantum yields of O(D-1)production, phi, in ozone photolysis from 275 nm to 334 nm were determined in the gas phase at 233 K. The O(D-1) was monitored by means of its reaction with isobutane to form isobutyl alcohol. The light source was a high pressure mercury lamp combined with a monochromator, with a bandwidth of 1.6 nm. The results show a constant phi below 300 nm, which is taken as unity on the basis of previous work. There is a very sharp fall-off in phi which is centered at 308 nm. At 313 nm phi is not greater than 0.1.

  6. STS-79 Ku-band antenna, ODS and Spacehab module at PCR

    NASA Technical Reports Server (NTRS)

    1996-01-01

    The orbiter Ku-band antenna looms large in this view of the Space Shuttle Atlantis' payload bay. Visible just past the antenna system -- stowed on the starboard side of the payload bay wall -- is the Orbiter Docking System (ODS), and connected to the ODS via a tunnel is the Spacehab Double Module in the aft area of the payload bay. This photograph was taken from the starboard wing platform on the fifth level of the Payload Changeout Room (PCR) at Launch Pad 39A. Work is under way in the PCR to close Atlantis' payload bay doors for flight. Atlantis currently is being targeted for liftoff on Mission STS-79, the fourth docking of the U.S. Shuttle to the Russian Space Station Mir, around September 12.

  7. The Okavango Dike Swarm (ODS) of Northern Botswana: Was it associated with a failed Rift System?

    NASA Astrophysics Data System (ADS)

    LePera, Alan; Atekwana, Estella; Abdelsalam, Mohamed

    2014-05-01

    Dikes and dike swarms often play a significant role in the initiation and extension of rift zones. The giant ODS in northern Botswana, Africa represents a Jurassic aged (~180Ma) thermo-tectonic event which developed during the initial lithospheric weakening phase of Gondwana. Detailed investigations of the mafic dike swarm over the last four decades have provided insights into its age, shape, orientation, and chemistry but have thus far been limited in addressing the crustal structure below the swarm. Historically, the ODS has been interpreted as a failed rift arm based on its association with the Bouvet Hotspot and geometric relationship with two other prominent dike swarms. More recent studies suggest instead that the ODS was emplaced along a preexisting Precambrian basement fabric. Accordingly, the origin of the swarm still remains a matter of debate. The objectives of this study were: (1) determine the role of crustal heterogeneities on the emplacement of the dikes, (2) determine variations in crustal thickness below the ODS and geographically related Okavango Rift Zone (ORZ), a zone of incipient rifting and (3) determine along-strike variations in Curie Point Depth (CPD) below the swarm. We used high resolution aeromagnetic data and applied mathematical filters to enhance structures associated with the swarm's oblique geometry. Crustal thicknesses were estimated using the radial average power spectrum method, applied to 1.2km spatial resolution gravity data. 3D inversions were used to map the magnetic basement and determine the depth to the base of the swarm. Our results showed: (1) There were no apparent basement structures with the same 110° orientation as the ODS. (2) Crustal thickness below the swarm ranges from 39 to 45km with an average of 42± 3km, comparable with thicknesses derived from the Southern African Seismic Experiment (SASE). In contrast, crustal thickness below the ORZ is 9 to 16km thinner than the surrounding blocks. (3) The magnetic

  8. Terahertz-visible two-photon rotational spectroscopy of cold OD-

    NASA Astrophysics Data System (ADS)

    Lee, Seunghyun; Hauser, Daniel; Lakhmanskaya, Olga; Spieler, Steffen; Endres, Eric S.; Geistlinger, Katharina; Kumar, Sunil S.; Wester, Roland

    2016-03-01

    We present a method to measure rotational transitions of molecular anions in the terahertz domain by sequential two-photon absorption. Ion excitation by bound-bound terahertz absorption is probed by absorption in the visible on a bound-free transition. The visible frequency is tuned to a state-selective photodetachment transition of the excited anions. This provides a terahertz action spectrum for just a few hundred molecular ions. To demonstrate this we measure the two lowest rotational transitions, J =1 ←0 and J =2 ←1 of OD- anions in a cryogenic 22-pole trap. We obtain rotational transition frequencies of 598 596.08(19) MHz for J =1 ←0 and 1 196 791.57(27) MHz for J =2 ←1 of OD-, in good agreement with their only previous measurement. This two-photon scheme opens up terahertz rovibrational spectroscopy for a range of molecular anions, in particular for polyatomic and cluster anions.

  9. Techniques to Improve the Environmental Safety of OB and OD Operations

    DTIC Science & Technology

    2007-11-02

    PEP material to be detonated will be lowered into the ODOBi by a crane and suspended approximately 2 m above the floor. The pan comprising the...Noise From OD Activities. Salter and Parkes10, Keenan and Wager9, Barrett12 and the DTEO11 have shown conclusively that water can be used to...National Laboratory, Livermore CA, September 1995, 40 pp. ’ 9. W.A. Keenan and P.C. Wager, "Mitigation of confined explosive effects by

  10. Low Cost Process for Manufacture of Oxide Dispersion Strengthened (ODS) Turbine Nozzle Components.

    DTIC Science & Technology

    1979-12-01

    SWTTPROCESS FORJIANUFACTURE OF9OXIDE)ISPERSIONSTRENGTHENED (ODS) O0 TURBINE !IJOZZLE COMPONENTS, -- , General Electric Company Aircraft Engine Group...machining processes for low pressure turbine (LPT) vanes , high pressure turbine (HPT) vanes , and HPT band segments for the F101 engine . The primary intent...for aircraft turbine nozzle components. These processes were shown capable of maintaining required microstructures and properties for the vane and

  11. Intermolecular potential and rovibrational states of the H2O-D2 complex

    NASA Astrophysics Data System (ADS)

    van der Avoird, Ad; Scribano, Yohann; Faure, Alexandre; Weida, Miles J.; Fair, Joanna R.; Nesbitt, David J.

    2012-05-01

    A five-dimensional intermolecular potential for H2O-D2 was obtained from the full nine-dimensional ab initio potential surface of Valiron et al. [P. Valiron, M. Wernli, A. Faure, L. Wiesenfeld, C. Rist, S. Kedžuch, J. Noga, J. Chem. Phys. 129 (2008) 134306] by averaging over the ground state vibrational wave functions of H2O and D2. On this five-dimensional potential with a well depth De of 232.12 cm-1 we calculated the bound rovibrational levels of H2O-D2 for total angular momentum J = 0-3. The method used to compute the rovibrational levels is similar to a scattering approach—it involves a basis of coupled free rotor wave functions for the hindered internal rotations and the overall rotation of the dimer—while it uses a discrete variable representation of the intermolecular distance coordinate R. The basis was adapted to the permutation symmetry associated with the para/ortho (p/o) nature of both H2O and D2, as well as to inversion symmetry. As expected, the H2O-D2 dimer is more strongly bound than its H2O-H2 isotopologue [cf. A. van der Avoird, D.J. Nesbitt, J. Chem. Phys. 134 (2011) 044314], with dissociation energies D0 of 46.10, 50.59, 67.43, and 73.53 cm-1 for pH2O-oD2, oH2O-oD2, pH2O-pD2, and oH2O-pD2. A rotationally resolved infrared spectrum of H2O-D2 was measured in the frequency region of the H2O bend mode. The ab initio calculated values of the rotational and distortion constants agree well with the values extracted from this spectrum.

  12. ODS Ferritic/martensitic alloys for Sodium Fast Reactor fuel pin cladding

    NASA Astrophysics Data System (ADS)

    Dubuisson, Philippe; Carlan, Yann de; Garat, Véronique; Blat, Martine

    2012-09-01

    The development of ODS materials for the cladding for Sodium Fast Reactors is a key issue to achieve the objectives required for the GEN IV reactors. CEA, AREVA and EDF have launched in 2007 an important program to determine the optimal fabrication parameters, and to measure and understand the microstructure and properties before, under and after irradiation of such cladding materials. The aim of this paper is to present the French program and the major results obtained recently at CEA on Fe-9/14/18Cr1WTiY2O3 ferritic/martensitic ODS materials. The first step of the program was to consolidate Fe-9/14/18Cr ODS materials as plates and bars to study the microstructure and the mechanical properties of the new alloys. The second step consists in producing tubes at a geometry representative of the cladding of new Sodium Fast Reactors. The optimization of the fabrication route at the laboratory scale is conducted and different tubes were produced. Their microstructure depends on the martensitic (Fe-9Cr) or ferritic (Fe-14Cr) structure. To join the plug to the tube, the reference process is the welding resistance. A specific approach is developed to model the process and support the development of the welds performed within the "SOPRANO" facility. The development at CEA of Fe-9/14/18Cr new ODS materials for the cladding for GENIV Sodium Fast Reactors is in progress. The first microstructural and mechanical characterizations are very encouraging and the full assessment and qualification of this new alloys and products will pass through the irradiation of specimens, tubes, fuel pins and subassemblies up to high doses.

  13. Vibrational spectroscopy of O-H and O-D centers in TiO2

    NASA Astrophysics Data System (ADS)

    Bekisli, Figen; Stavola, Michael; Fowler, W. Beall

    2012-02-01

    While the vibrational properties of O-H centers in TiO2 have been studied for many years, recent experiments suggest a new picture of their behavior. In the 1970s, Bates and Perkins found a single, sharp, strongly polarized O-H line in TiO2, and similarly for O-D and O-T [1]. On the contrary, recent studies by Herklotz et al. [2] find three closely spaced O-H (O-D) lines that were assigned to two different charge states of an O-H (O-D) shallow donor. We have in our possession the very TiO2 samples studied many years ago by Bates and Perkins. We have introduced H and D into these samples and also into TiO2 samples obtained recently. High-resolution vibrational spectroscopy performed as a function of temperature at Lehigh provides new insight into the different vibrational properties seen for O-H in TiO2 in the 1970's and in recent studies by Herklotz et al. [1] J.B. Bates and R.A. Perkins, Phys. Rev. B 16, 3713 (1977). [2] F. Herklotz et al., Phys. Rev. B 83, 235202 (2011)..

  14. The influence of Cr content on the mechanical properties of ODS ferritic steels

    NASA Astrophysics Data System (ADS)

    Li, Shaofu; Zhou, Zhangjian; Jang, Jinsung; Wang, Man; Hu, Helong; Sun, Hongying; Zou, Lei; Zhang, Guangming; Zhang, Liwei

    2014-12-01

    The present investigation aimed at researching the mechanical properties of the oxide dispersion strengthened (ODS) ferritic steels with different Cr content, which were fabricated through a consolidation of mechanical alloyed (MA) powders of 0.35 wt.% nano Y2O3 dispersed Fe-12.0Cr-0.5Ti-1.0W (alloy A), Fe-16.0Cr-0.5Ti-1.0W (alloy B), and Fe-18.0Cr-0.5Ti-1.0W (alloy C) alloys (all in wt.%) by hot isostatic pressing (HIP) with 100 MPa pressure at 1150 °C for 3 h. The mechanical properties, including the tensile strength, hardness, and impact fracture toughness were tested by universal testers, while Young's modulus was determined by ultrasonic wave non-destructive tester. It was found that the relationship between Cr content and the strength of ODS ferritic steels was not a proportional relationship. However, too high a Cr content will cause the precipitation of Cr-enriched segregation phase, which is detrimental to the ductility of ODS ferritic steels.

  15. In Situ Synchrotron Tensile Investigations on 14YWT, MA957 and 9-Cr ODS Alloys

    SciTech Connect

    Lin, Jun-Li; Mo, Kun; Yun, Di; Miao, Yinbin; Liu, Xiang; Zhao, Huijuan; Hoelzer, David T; Park, Jun-Sang; Almer, Jonathan; Zhang, Guangming; Zhou, Zhangjian; Stubbins, James; Yacout, Abdellatif

    2016-01-01

    Nanostructured ferritic alloys (NFAs) provide exceptional radiation tolerance and high-temperature mechanical properties when compared to traditional ferritic and ferritic/martensitic (F/M) steels. Their remarkable properties result from ultrahigh density and ultrafine size of Y-Ti-O nanoclusters within the ferritic matrix. In this work, we applied a high-energy synchrotron radiation X-ray to study the deformation process of two NFAs including 14YWT and MA957, and a 9-Cr ODS steel. Only the relatively large nanoparticles in the 9-Cr ODS were observed in the synchrotron X-ray diffraction. The nanoclusters in both 14 YWT and MA957 were invisible in the measurement due to their non-stoichiometric nature. Due to the different sizes of nanoparticles and nanoclusters in the materials, the Orowan looping was considered to be the major strengthening mechanism in the 9-Cr ODS, while the dispersed-barrier-hardening is dominant strengthening mechanism in both 14YWT and MA957, respectively. This analysis was inferred from the different build-up rates of dislocation density when plastic deformation was initiated. Finally, the dislocation densities interpreted from the X-ray measurements were successfully modeled using the Bergstr m s dislocation models.

  16. Development of ODS FeCrAl for compatibility in fusion and fission energy applications

    SciTech Connect

    Pint, Bruce A.; Dryepondt, Sebastien N.; Unocic, Kinga A.; Hoelzer, David T.

    2014-11-15

    In this paper, oxide dispersion strengthened (ODS) FeCrAl alloys with 12–15% Cr are being evaluated for improved compatibility with Pb-Li for a fusion energy application and with high temperature steam for a more accident-tolerant light water reactor fuel cladding application. A 12% Cr content alloy showed low mass losses in static Pb-Li at 700°C, where a LiAlO2 surface oxide formed and inhibited dissolution into the liquid metal. All the evaluated compositions formed a protective scale in steam at 1200°C, which is not possible with ODS FeCr alloys. However, most of the compositions were not protective at 1400°C, which is a general and somewhat surprising problem with ODS FeCrAl alloys that is still being studied. More work is needed to optimize the alloy composition, microstructure and oxide dispersion, but initial promising tensile and creep results have been obtained with mixed oxide additions, i.e. Y2O3 with ZrO2, HfO2 or TiO2.

  17. Development of ODS FeCrAl for compatibility in fusion and fission energy applications

    DOE PAGES

    Pint, Bruce A.; Dryepondt, Sebastien N.; Unocic, Kinga A.; ...

    2014-11-15

    In this paper, oxide dispersion strengthened (ODS) FeCrAl alloys with 12–15% Cr are being evaluated for improved compatibility with Pb-Li for a fusion energy application and with high temperature steam for a more accident-tolerant light water reactor fuel cladding application. A 12% Cr content alloy showed low mass losses in static Pb-Li at 700°C, where a LiAlO2 surface oxide formed and inhibited dissolution into the liquid metal. All the evaluated compositions formed a protective scale in steam at 1200°C, which is not possible with ODS FeCr alloys. However, most of the compositions were not protective at 1400°C, which is amore » general and somewhat surprising problem with ODS FeCrAl alloys that is still being studied. More work is needed to optimize the alloy composition, microstructure and oxide dispersion, but initial promising tensile and creep results have been obtained with mixed oxide additions, i.e. Y2O3 with ZrO2, HfO2 or TiO2.« less

  18. OD in North American Schools: A Scandinavian View, with Comments by Matthew Miles and Michael Fullan. Uppsala Reports on Education, No. 20.

    ERIC Educational Resources Information Center

    Berg, Gunnar

    This report discusses the structural conditions under which organizational development (OD), as employed in the school systems of the United States and Canada, is more or less applicable to schools. The first section (chapters 1-6) reviews papers and books, concerning either OD in general or the ways in which the ideas of OD have been used in the…

  19. Time-resolved laser-induced incandescence from multiwalled carbon nanotubes in air

    SciTech Connect

    Mitrani, J. M.; Shneider, M. N.

    2015-01-26

    We observed temporal laser-induced incandescence (LII) signals from multiwalled carbon nanotubes(MWCNTs) suspended in ambient air. Unlike previous LII experiments with soot particles, which showed that primary particles with larger diameters cool at slower timescales relative to smaller particles, we observed that thicker MWCNTs with larger outer diameters (ODs) cool at faster timescales relative to thinner MWCNTs with smaller ODs. We suggested a simple explanation of this effect, based on the solution of one-dimensional nonstationary heat conduction equation for the initial non-uniform heating of MWCNTs with ODs greater than the skin depth.

  20. Collisional quenching of OD A 2Σ+ by H2: experimental and theoretical studies of the state-resolved OD X 2Π product distribution and branching fraction.

    PubMed

    Lehman, Julia H; Dempsey, Logan P; Lester, Marsha I; Fu, Bina; Kamarchik, Eugene; Bowman, Joel M

    2010-10-28

    We report joint experimental and theoretical studies of outcomes resulting from the nonreactive quenching of electronically excited OD A  (2)Σ(+) by H(2). The experiments utilize a pump-probe technique to detect the OD X  (2)Π product state distribution under single collision conditions. The OD X  (2)Π products are observed primarily in their lowest vibrational state (v(") = 0) with substantially less population in v(") = 1. The OD X  (2)Π products are generated with a high degree of rotational excitation, peaking at N(") = 21 with an average rotational energy of 4600 cm(-1), and a strong propensity for populating the Π(A(')) Λ-doublet component indicative of alignment of the half-filled pπ orbital in the plane of OD rotation. Branching fraction measurements show that the nonreactive channel accounts for less than 20% of quenching outcomes. Complementary classical trajectory calculations of the postquenching dynamics are initiated from representative points along seams of conical intersections between the ground and excited-state potentials of OD(A  (2)Σ(+),X  (2)Π) + H(2). Diabatic modeling of the initial momenta in the dynamical calculations captures the key experimental trends: OD X  (2)Π products released primarily in their ground vibrational state with extensive rotational excitation and a branching ratio that strongly favors reactive quenching. The OD A  (2)Σ(+) + H(2) results are also compared with previous studies on the quenching of OH A  (2)Σ(+) + H(2); the two experimental studies show remarkably similar rotational energy distributions for the OH and OD X  (2)Π radical products.

  1. Measurement of aerosol optical depth and sub-visual cloud detection using the optical depth sensor (ODS)

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2016-02-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in the atmosphere of Mars. The instrument measures alternatively the diffuse radiation from the sky and the attenuated direct radiation from the Sun on the surface. The principal goals of ODS are to retrieve the daily mean aerosol optical depth (AOD) and to detect very high and optically thin clouds, crucial parameters in understanding the Martian meteorology and climatology. The detection of clouds is undertaken at twilight, allowing the detection and characterization of clouds with opacities below 0.03 (sub-visual clouds). In addition, ODS is capable to retrieve the aerosol optical depth during nighttime from moonlight measurements. Recently, ODS has been selected at the METEO meteorological station on board the ExoMars 2018 Lander. In order to study the performance of ODS under Mars-like conditions as well as to evaluate the retrieval algorithms for terrestrial measurements, ODS was deployed in Ouagadougou (Africa) between November 2004 and October 2005, a Sahelian region characterized by its high dust aerosol load and the frequent occurrence of Saharan dust storms. The daily average AOD values retrieved by ODS were compared with those provided by a CIMEL sunphotometer of the AERONET (Aerosol Robotic NETwork) network localized at the same location. Results represent a good agreement between both ground-based instruments, with a correlation coefficient of 0.77 for the whole data set and 0.94 considering only the cloud-free days. From the whole data set, a total of 71 sub-visual cirrus (SVC) were detected at twilight with opacities as thin as 1.10-3 and with a maximum of occurrence at altitudes between 14 and 20 km. Although further optimizations and comparisons of ODS terrestrial measurements are required, results indicate the potential of these measurements to retrieve the AOD and detect sub-visual clouds.

  2. Infrared spectroscopy of OD vibrators in minerals at natural dilution: hydroxyl groups in talc and kaolinite, and structural water in beryl and emerald.

    PubMed

    de Donato, Philippe; Cheilletz, Alain; Barres, Odile; Yvon, Jacques

    2004-05-01

    An infrared (IR) study of natural deuteration is conducted on minerals containing hydroxyl groups (talc and kaolinite) and channel-water-bearing minerals (beryl and emerald). In talc, the OD valence vibration is located at 2710 cm(-1), corresponding to OD groups surrounded by 3 Mg atoms. In kaolinite, the OD valence vibrations are located at 2671 cm(-1) (inner OD group), 2712, 2706, and 2700 cm(-1) (three inner-surface OD groups). In beryl and emerald, natural deuteration of channel water is observed for the first time by infrared microspectroscopy. In beryl from Minas Gerais (Brazil), the OD profiles are characterized by four bands at 2735, 2686, 2672, and 2641 cm(-1). In emeralds from Colombia and Brazil, the OD profiles are characterized by five or four bands, respectively, at 2816, 2737, 2685, 2673, and 2641 cm(-1) (Colombia) and 2730, 2684, 2672, and 2640 cm(-1) (Brazil). The band at 2816 cm(-1) can be assigned to -OD or OD(-), and bands at 2686-2684, 2673-2672, and 2641-2640 cm(-1) can be assigned to type-I and type-II HOD molecules. The band at 2737-2730 cm(-1) is partially disturbed by combination bands of the mineral. Such OD profiles are different from those obtained by artificial deuteration at higher OD dilution.

  3. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes For Hoop Creep Enhancement

    SciTech Connect

    Bimal K. Kad

    2005-11-23

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in crossrolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (1) examine and identify post-extrusion forming methodologies to

  4. Optimization of the chemical composition and manufacturing route for ODS RAF steels for fusion reactor application

    NASA Astrophysics Data System (ADS)

    Oksiuta, Z.; Baluc, N.

    2009-05-01

    As the upper temperature for use of reduced activation ferritic/martensitic steels is presently limited by a drop in mechanical strength at about 550 °C, Europe, Japan and the US are actively researching steels with high strength at higher operating temperatures, mainly using stable oxide dispersion. In addition, the numerous interfaces between matrix and oxide particles are expected to act as sinks for the irradiation-induced defects. The main R&D activities aim at finding a compromise between good tensile and creep strength and sufficient ductility, especially in terms of fracture toughness. Oxide dispersion strengthened (ODS) reduced activation ferritic (RAF) steels appear as promising materials for application in fusion power reactors up to about 750 °C. Six different ODS RAF steels, with compositions of Fe-(12-14)Cr-2W-(0.1-0.3-0.5)Ti-0.3Y2O3 (in wt%), were produced by powder metallurgy techniques, including mechanical alloying, canning and degassing of the milled powders and compaction of the powders by hot isostatic pressing, using various devices and conditions. The materials have been characterized in terms of microstructure and mechanical properties. The results have been analysed in terms of optimal chemical composition and manufacturing conditions. In particular, it was found that the composition of the materials should lie in the range Fe-14Cr-2W-(0.3-0.4)Ti-(0.25-0.3)Y2O3, as 14Cr ODS RAF steels exhibit higher tensile strength and better Charpy impact properties and are more stable than 12Cr materials (no risk of martensitic transformation), while materials with 0.5% Ti or more should not be further investigated, due to potential embrittlement by large TiO2 particles.

  5. Effects of heat treatment conditions on the microstructure and impact properties of EUROFER 97 ODS steel

    NASA Astrophysics Data System (ADS)

    Di Martino, S. F.; Faulkner, R. G.; Riddle, N. B.; Monge, M. A.; Munoz, A.

    2011-12-01

    Probably the most important range of materials to consider for the blanket material in the tokamak design for fusion reactors such as ITER and DEMO is the high alloy Fe9Cr oxide dispersion strengthened (ODS) ferritic steels. These steels possess exceptional thermal conductivity and low thermal expansion while being strongly resistant to void swelling. Their main drawback is the high ductile-to-brittle transition temperature (DBTT), particularly in the ODS versions of the material. This paper describes attempts that are being made to reduce this DBTT in as yet unirradiated materials by a novel heat treatment procedure. The principle behind this approach is that low DBTT in the unirradiated materials will lead to relatively low DBTT even in He-containing material that has been irradiated with fusion blanket-type irradiations. New batches of high alloy Fe9Cr ODS (EUROFER) ferritic steel have been produced by a powder metallurgical route, and relatively homogeneous material has been produced by a hot isostatic pressing procedure. Mini-Charpy test specimens were made from materials that had been subjected to a matrix of heat treatments designed to show up variations in solution treatment (ST) temperature, cooling rate from the ST temperature and tempering treatment. The initial DBTT was in the range 150-200 °C. Extremely interesting results have been obtained. DBTT downward shifts of up to 200 °C have been observed by using a high 1300 °C ST temperature and a low cooling rate. The paper goes on to describe the microstructure of this material, and discusses the possible microstructural factors needed to produce these very high DBTT downward shifts. Low dissolved carbon and higher proportions of low-angle grain boundaries seem to provide the key to the understanding of the alloy behaviour.

  6. Chemical and microstructural evolution on ODS Fe-14CrWTi steel during manufacturing stages

    NASA Astrophysics Data System (ADS)

    Olier, P.; Malaplate, J.; Mathon, M. H.; Nunes, D.; Hamon, D.; Toualbi, L.; de Carlan, Y.; Chaffron, L.

    2012-09-01

    Oxide Dispersion Strengthened (ODS) steels are promising candidate materials for fission and fusion applications thanks to their improved properties related to both their fine grained microstructure and high density of Y-Ti-O nanoscale clusters (NCs). The Fe-14Cr-1 W-0.3Ti-0.3Y2O3 ODS ferritic steel was produced by powder metallurgy: Iron-base gas atomized powders were mechanically alloyed with 0.3% Y2O3 particles in an attritor. Then, the ODS powders were encapsulated in a soft steel can, consolidated by hot extrusion and cold rolled under the shape of tube cladding. The present work investigates the evolution of the chemical composition and the microstructure after each stage of the fabrication route (i.e. mechanical alloying, extrusion and cold rolling). Chemical analysis indicates a significant increase of the carbon content and a moderate increase of oxygen and nitrogen after mechanical alloying compared to initial atomized powders. After extrusion, the measured oxygen content corresponds mainly to the oxygen coming from yttria addition during MA process. In addition, electron microprobe analyses are performed after hot extrusion to determine the concentration and the distribution of the constitutive elements (Cr, Ti, W, Y, O). The microstructure was investigated by transmission electron microscopy (TEM) and small angle neutron scattering (SANS) in order to characterize the size distribution of Y-Ti-O particles. TEM results reveal a fine microstructure (average grain size of 600 nm in the transverse direction) including Y-Ti-O NCs with a mean diameter close to 3 nm after extrusion. A slight coarsening of Y-Ti-O NCs is evidenced by SANS after cold rolling and heat treatments.

  7. Efficiency in supercritical fluid chromatography with different superficially porous and fully porous particles ODS bonded phases.

    PubMed

    Lesellier, E

    2012-03-09

    The chromatographic efficiency, in terms of plate number per second, was dramatically improved by the introduction of sub-two microns particles with ultra-high pressure liquid chromatography (UHPLC). On the other hand, the recent development of superficially porous particles, called core-shell or fused-core particles, appears to allow the achievement of the same efficiency performances at higher speed without high pressure drops. CO₂-based mobile phases exhibiting much lower viscosities than aqueous based mobile phases allow better theoretical efficiencies, even with 3-5 μm particles, but with relative low pressure drops. They also allow much higher flow rates or much longer columns while using conventional instruments capable to operate below 400 bar. Moreover, the use of superficially porous particles in SFC could enhance the chromatographic performances even more. The kinetic behavior of ODS phases bonded on these particles was studied, with varied flow rates, outlet (and obviously inlet) pressures, temperatures, by using a homologous series (alkylbenzenes) with 10% modifier (methanol or acetonitrile) in the carbon dioxide mobile phase. Results were also compared with classical fully porous particles, having different sizes, from 2.5 to 5 μm. Superior efficiency (N) and reduced h were obtained with these new ODS-bonded particles in regards to classical ones, showing their great interest for use in SFC. However, surprising behavior were noticed, i.e. the increase of the theoretical plate number vs. the increase of the chain length of the compounds. This behavior, opposite to the one classically reported vs. the retention factor, was not depending on the outlet pressure, but on the flow rate and the temperature changes. The lower radial trans-column diffusion on this particle types could explain these results. This diffusion reduction with these ODS-bonded superficially porous particles seems to decrease with the increase of the residence time of compounds.

  8. Investigation of eddy current examination on OD fatigue crack for steam generator tubes

    NASA Astrophysics Data System (ADS)

    Kong, Yuying; Ding, Boyuan; Li, Ming; Liu, Jinhong; Chen, Huaidong; Meyendorf, Norbert G.

    2015-03-01

    The opening width of fatigue crack was very small, and conventional Bobbin probe was very difficult to detect it in steam generator tubes. Different sizes of 8 fatigue cracks were inspected using bobbin probe rotating probe. The analysis results showed that, bobbin probe was not sensitive for fatigue crack even for small through wall crack mixed with denting signal. On the other hand, the rotating probe was easily to detect all cracks. Finally, the OD phase to depth curve for fatigue crack using rotating probe was established and the results agreed very well with the true crack size.

  9. Raman OD stretching spectral differences between aqueous and alcoholic tetraalkylammonium chloride solutions

    NASA Astrophysics Data System (ADS)

    Hidaka, Fumi; Kanno, Hitoshi

    2003-09-01

    Raman OD stretching spectra were measured for aqueous and alcoholic R 4NCl solutions in both liquid state at room temperature and glassy state at liquid nitrogen temperature (alcohol=methanol and ethanol, R=alkyl group: methyl, ethyl and n-propyl). Comparison of the spectra indicates that enhancement of the low frequency region is more pronounced for the glassy aqueous solution than the corresponding alcohol solution. It is suggested that hydrophobic hydration plays a role in the strengthening of hydrogen bonds around an apolar solute (group) at low temperatures in aqueous solution system.

  10. [Odón de Buen: forty-five years of commitment to the university].

    PubMed

    Gomis, Alberto

    2011-01-01

    The aragonese naturalist Odón de Buen y del Cos for twenty-two annual academic courses professor of natural history at the University of Barcelona and for twenty-three of the University of Madrid. Strong supporter of Darwin's evolutionary theory, experimental work in the field and laboratory, in this paper puts the value of their efforts, as an educator, to popularize the natural sciences and thus separated from the concerns, superstition and fanaticism, which they were basic reasons of the moral and material backwardness in which Spain was found.

  11. Laser pointer induced macular damage: case report and mini review.

    PubMed

    Turaka, Kiran; Bryan, J Shepard; Gordon, Alan J; Reddy, Rahul; Kwong, Henry M; Sell, Clive H

    2012-06-01

    To report laser pointer induced damage to retina and choroid and briefly review literature. A case report of a 13-year old Caucasian boy developed blurry central vision and central scotoma in right eye (OD). He was exposed for one minute to class IIIA green laser pointer of 650 nm wavelength and 5 mW power. Clinical examination showed a grayish lesion in foveal region. Ancillary testing revealed disruption of the retinal pigment epithelial (RPE) layer in foveal region and indocyanine green angiography demonstrated evidence of choroidal hypofluorescence suggestive of choroidal infarction in OD. Visual acuity improved from 20/100 to 20/60 in one day and he was treated with tapering doses of oral prednisolone (40 mg) for 3 weeks. Laser pointer with a power of >5 mW caused damage to RPE in the macula. Children should not be given laser pointers as toys especially those with label of danger instructions.

  12. Measurement of aerosol optical depth and sub-visual cloud detection using the optical depth sensor (ODS)

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2015-09-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in the atmosphere of Earth and Mars. The instrument measures alternatively the diffuse radiation from the sky and the attenuated direct radiation from the sun on the surface. The principal goals of ODS are to retrieve the daily mean aerosol optical depth (AOD) and to detect very high and optically thin clouds, crucial parameters in understanding the Martian and Earth meteorology and climatology. The detection of clouds is undertaken at twilight, allowing the detection and characterization of clouds with opacities below 0.03 (sub-visual clouds). In addition, ODS is capable to retrieve the aerosol optical depth during night-time from moonlight measurements. In order to study the performance of ODS under Mars-like conditions as well as to evaluate the retrieval algorithms for terrestrial measurements, ODS was deployed in Ouagadougou (Africa) between November 2004 and October 2005, a sahelian region characterized by its high dust aerosol load and the frequent occurrence of Saharan dust storms. The daily average AOD values retrieved by ODS were compared with those provided by a CIMEL Sun-photometer of the AERONET (Aerosol Robotic NETwork) network localized at the same location. Results represent a good agreement between both ground-based instruments, with a correlation coefficient of 0.79 for the whole data set and 0.96 considering only the cloud-free days. From the whole dataset, a total of 71 sub-visual cirrus (SVC) were detected at twilight with opacities as thin as 1.10-3 and with a maximum of occurrence at altitudes between 14 and 20 km. Although further analysis and comparisons are required, results indicate the potential of ODS measurements to detect sub-visual clouds.

  13. Analysis of high temperature deformation mechanism in ODS EUROFER97 alloy

    NASA Astrophysics Data System (ADS)

    Ramar, A.; Spätig, P.; Schäublin, R.

    2008-12-01

    Oxide dispersion in tempered martensitic EUROFER97 steel is an efficient approach to improve its strength. The oxide dispersion strengthened (ODS) EUROFER97 steel shows a good strength up to 600 °C, but degrades rapidly beyond that temperature. To understand the origin in the microstructure of this drop in strength in situ heating experiment in TEM was performed from room temperature to 1000 °C. Upon heating neither microstructure changes nor dislocation movement are observed up to 600 °C. Movement of dislocations are observed above 680 °C. Phase transformation to austenite starts at 840 °C. Yttria particles remain stable up to 1000 °C. Changes in mechanical properties thus do not relate to changes in yttria dispersion. It is attempted to relate these observations to the thermal activation parameters measured by the technique of conventional strain rate experiment, which allow to identify at a mesoscopic scale the microstructural mechanisms responsible for the degradation of ODS steel at high temperatures.

  14. Diffusion bonding between ODS ferritic steel and F82H steel for fusion applications

    NASA Astrophysics Data System (ADS)

    Noh, Sanghoon; Kim, Byungjun; Kasada, Ryuta; Kimura, Akihiko

    2012-07-01

    Diffusion bonding techniques were employed to join high Cr oxide dispersion strengthened (ODS) ferritic steel (Fe-15Cr-2W-0.2Ti-0.35Y2O3) and F82H steel under uni-axial hydrostatic pressure using a high vacuum hot press, and the microstructure and mechanical properties of the joints were investigated. The dissimilar joints were bonded by solid-state diffusion bonding (SSDB) and liquid phase diffusion bonding (LPDB). After bonding process, heat treatments were conducted to utilize the phase transformation of F82H steel for recovering the martensitic structure. Tensile tests with miniaturized specimens were carried out to investigate and compare the bonding strengths of each joint. Microstructure was observed for the bonding interface, and fracture mode was investigated after the tensile tests. LPDB joint of interfacial F82H steel fully recovered to martensite phase by post-joining heat treatments, while SSDB joint had ferrite phases at the interface even after heat treatment, which is considered to be due to decarburization of F82H steel during the bonding process. Therefore it is considered that the insert material plays a role as diffusion barrier of carbon during LPDB process. Microstructure observations and tensile tests of the joints revealed that the LPDB joints possess suitable tensile properties which are comparable to that of F82H steel. This indicates that LPDB is more promising method to bond ODS-FS and F82H steel than SSDB.

  15. A Comparative Study of Welded ODS Cladding materials for AFCI/GNEP Applications

    SciTech Connect

    Indrajit Charit; Megan Frary; Darryl Butt; K.L. Murty; Larry Zirker; James Cole; Mitchell Meyer; Rajiv S. Mishra; Mark Woltz

    2011-03-31

    This research project involved working on the pressure resistance welding of oxide dispersion strengthened (ODS) alloys which will have a large role to play in advanced nuclear reactors. The project also demonstrated the research collaboration between four universities and one nation laboratory (Idaho National Laboratory) with participation from an industry for developing for ODS alloys. These alloys contain a high number density of very fine oxide particles that can impart high temperature strength and radiation damage resistance suitable for in-core applications in advanced reactors. The conventional fusion welding techniques tend to produce porosity-laden microstructure in the weld region and lead to the agglomeration and non-uniform distribution of the neededoxide particles. That is why two solid state welding methods - pressure resistance welding (PRW) and friction stir welding (FSW) - were chosen to be evaluated in this project. The proposal is expected to support the development of Advanced Burner Reactors (ABR) under the GNEP program (now incorporated in Fuel Cycle R&D program). The outcomes of the concluded research include training of graduate and undergraduate students and get them interested in nuclear related research.

  16. Influence of consolidation methods on the recrystallization kinetics of a Fe-14Cr based ODS steel

    NASA Astrophysics Data System (ADS)

    Dadé, M.; Malaplate, J.; Garnier, J.; De Geuser, F.; Lochet, N.; Deschamps, A.

    2016-04-01

    The recrystallization behavior during thermal annealing with or without prior cold work has been investigated in a 14%Cr ODS steel consolidated by two different methods, hot extrusion (HE) and hot isostatic pressing (HIP). We show that a 1400°C-1 h annealing induces an increase of the oxide nanoparticles radius from 1.3 to 3 nm, however the grain size remain stable despite a recovery of sub-grain boundaries for the hot extruded material. When pre-deformation is applied before annealing, almost full recrystallization can be achieved on the HE ODS steel. In this study, we show recrystallization after 40% cold deformation and annealing 30 min at 1450 °C together with coarsening of oxide particles. At lower temperature and higher pre-deformation (70%-1150 °C/30 min), we show that recrystallization can be achieved without change of the oxide size distribution. We show that due to a lower initial dislocation density, recrystallization is strongly delayed, by at least 250 °C, in the HIP material. Finally, we show that the evolution of the size of the oxide precipitates is controlled by the time and temperature of annealing and are independent on the pre-deformation and occurrence of recrystallization.

  17. ODS steel raw material local structure analysis using X-ray absorption spectroscopy

    NASA Astrophysics Data System (ADS)

    Cintins, A.; Anspoks, A.; Purans, J.; Kuzmin, A.; Timoshenko, J.; Vladimirov, P.; Gräning, T.; Hoffmann, J.

    2015-03-01

    Oxide dispersion strengthened (ODS) steels are promising materials for fusion power reactors, concentrated solar power plants, jet engines, chemical reactors as well as for hydrogen production from thermolysis of water. In this study we used X-ray absorption spectroscopy at the Fe and Cr K-edges as a tool to get insight into the local structure of ferritic and austenitic ODS steels around Fe and Cr atoms and its transformation during mechanical alloying process. Using the analysis of X-ray absorption near edge structure (XANES) and extended X-ray absorption fine structure (EXAFS) we found that for austenitic samples a transformation of ferritic steel to austenitic steel is detectable after 10 hours of milling and proceeds till 40 hours of milling; only small amount of a-phase remains after 80 hours of milling. We found that the Cr K-edge EXAFS can be used to observe distortions inside the material and to get an impression on the formation of chromium clusters. In-situ EXAFS experiments offer a reliable method to investigate the ferritic to austenitic transformation.

  18. HRTEM Study of Oxide Nanoparticles in K3-ODS Ferritic Steel Developed for Radiation Tolerance

    SciTech Connect

    Hsiung, L; Fluss, M; Tumey, S; Kuntz, J; El-Dasher, B; Wall, M; Choi, W; Kimura, A; Willaime, F; Serruys, Y

    2009-11-02

    Crystal and interfacial structures of oxide nanoparticles and radiation damage in 16Cr-4.5Al-0.3Ti-2W-0.37 Y{sub 2}O{sub 3} ODS ferritic steel have been examined using high-resolution transmission electron microscopy (HRTEM) techniques. Oxide nanoparticles with a complex-oxide core and an amorphous shell were frequently observed. The crystal structure of complex-oxide core is identified to be mainly monoclinic Y{sub 4}Al{sub 2}O{sub 9} (YAM) oxide compound. Orientation relationships between the oxide and the matrix are found to be dependent on the particle size. Large particles (> 20 nm) tend to be incoherent and have a spherical shape, whereas small particles (< 10 nm) tend to be coherent or semi-coherent and have a faceted interface. The observations of partially amorphous nanoparticles and multiple crystalline domains formed within a nanoparticle lead us to propose a three-stage mechanism to rationalize the formation of oxide nanoparticles containing core/shell structures in as-fabricated ODS steels. Effects of nanoparticle size and density on cavity formation induced by (Fe{sup 8+} + He{sup +}) dual-beam irradiation are briefly addressed.

  19. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes For Hoop Creep Enhancement

    SciTech Connect

    Bimal Kad

    2007-09-30

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program were to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. The research program outlined was iterative and intended to systematically (i) examine and identify post-extrusion forming methodologies to create hoop strengthened tubes, to be (ii) evaluated at 'in-service' loads at service temperatures and environments. Our report outlines the significant hoop creep enhancements possible via secondary cross-rolling and/or flow-forming operations. Each of the

  20. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes For Hoop Creep Enhancement

    SciTech Connect

    Bimal K. Kad

    2006-09-30

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. The research program outlined here is iterative in nature and is intended to systematically (a) examine and identify post-extrusion forming methodologies to create hoop strengthened tubes, which will be (b) evaluated at ''in-service'' loads at service temperatures and environments. In this 12th quarter of performance, program activities are concluded for Task 2 and continuing for Tasks 3, 4 and

  1. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes for Hoop Creep Enhancement

    SciTech Connect

    Bimal K. Kad

    2006-04-10

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. The research program outlined here is iterative in nature and is intended to systematically (1) examine and identify post-extrusion forming methodologies to create hoop strengthened tubes, which will be (2) evaluated at ''in-service'' loads at service temperatures and environments. This research program is being conducted in collaboration with the DOE's Oak Ridge National Laboratory and the vested

  2. Effect of recrystallization on ion-irradiation hardening and microstructural changes in 15Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Ha, Yoosung; Kimura, Akihiko

    2015-12-01

    The effects of recrystallization on ion-irradiation hardening and microstructural changes were investigated for a 15Cr-ODS ferritic steel. Dual ion-irradiation experiments were performed at 470 °C using 6.4 MeV Fe3+ ions simultaneously with energy-degraded 1 MeV He+ ions. The displacement of damage at 600 nm depth from the specimen surface was 30 dpa. Nano-indentation test with Berkovich type indentation tip was measured by constant stiffness measurement (CSM) technique. Results from nano-indentation tests indicate irradiation hardening in ODS steels even at 470 °C, while it wasn't observed in reduced activation ferritic steel. Recrystallized ODS steel shows a larger irradiation hardening, which is considered to be due to the reduction of grain boundaries and interfaces of matrix/oxide particles. In 20% cold rolled ODS steel after recrystallization, both the hardening and bubble number density were lower than those of recrystallized ODS steel, suggesting that dislocations generated by cold rolling suppress bubble formation. Based on the estimation of irradiation hardening from TEM observation results, it is considered that the bubbles are not the main factor controlling ion-irradiation hardening.

  3. Vapor-phase catalytic oxidesulfurization (ODS) of organosulfur compounds over supported metal oxide catalysts

    NASA Astrophysics Data System (ADS)

    Choi, Sukwon

    Sulfur in transportation fuels remains a leading source of SOx emissions from vehicle engines and is a major source of air pollution. The very low levels of sulfur globally mandated for transportation fuels in the near future cannot be achieved by current practices of hydrodesulfurization (HDS) for sulfur removal, which operate under severe conditions (high T, P) and use valuable H2. Novel vapor-phase catalytic oxidesulfurization (ODS) processes of selectively oxidizing various organosulfur compounds (carbonyl sulfide, carbon disulfide, methanethiol, dimethyl sulfide (DMS), dimethyl disulfide (DMDS), thiophene, 2,5-dimenthylthiophene) typically found in various industrial streams (e.g., petroleum refining, pulp and paper) into valuable chemical intermediates (H 2CO, CO, H2, maleic anhydride and concentrated SO2) has been extensively studied. This research has primarily focused on establishing the fundamental kinetics and mechanisms of these selective oxidation reactions over well-defined supported metal oxide catalysts. The selective oxidation reactions of COS + O2 → CO + SO2; 2CS2 + 5O2 → 2CO + 4SO2; CH3SH + 2O 2 → H2CO + SO2 + H2O; C4 H4S + 3O2 → C4H2O 3 + H2O + SO2; were studied. Raman spectroscopy revealed that the supported metal oxide phases were 100% dispersed on the oxide substrate. All the catalysts were highly active and selective for the oxidesulfurization of carbonyl sulfide, carbon disulfide, methanethiol, and thiophene between 290--330°C, 230--270°C, 350--400°C, and 250--400°C, respectively and did not deactivate. The TOFs (turnover frequency, normalized activity per active catalytic site) for all ODS reactions over supported vanadia catalysts, only containing molecularly dispersed surface vanadia species, varied within one order of magnitude and revealed the V-O-Support bridging bond was involved in the critical rate-determining kinetic steps. The surface reaction mechanism for each reaction was revealed by in situ IR (infrared) and

  4. Direct correlation between morphology of (Fe,Cr) 23C 6 precipitates and impact behavior of ODS steels

    NASA Astrophysics Data System (ADS)

    Klimiankou, M.; Lindau, R.; Möslang, A.

    2007-08-01

    The microstructure of ODS steels was investigated after different thermal and thermo-mechanical treatments by means of transmission electron microscopy (TEM) and analytical TEM techniques, including energy-dispersive X-ray (EDX) mapping of the elemental distribution at the nanometer scale. In 'as-HIPped' first generation ODS-Eurofer steel the grain boundaries were decorated with Cr-rich precipitates of M 23C 6 type. In addition, EDX mapping showed Cr-depleted areas at grain boundaries. Thermal and thermo-mechanical treatments of the ODS material affect the size, composition and spatial distribution of the precipitates. Depending on the treatments, the morphology and density of the M 23C 6 can be systematically varied. A significant decrease in ductile-to-brittle-transition-temperature (DBTT) in impact tests and an improvement in the tensile ductility at high temperature can be directly linked to the changes in precipitate morphology and size.

  5. Formation mechanism and the role of nanoparticles in Fe-Cr ODS steels developed for radiation tolerance

    SciTech Connect

    Hsiung, Luke L.; Fluss, Michael J.; Tumey, Scott J.; Choi, B. William; Serruys, Yves; Willaime, Francois; Kimura, Akihiko

    2010-11-01

    Structures of nanoparticles in Fe-16Cr-4.5Al-0.3Ti-2W-0.37Y{sub 2}O{sub 3} (K3) and Fe-20Cr-4.5Al-0.34Ti-0.5Y{sub 2}O{sub 3} (MA956) oxide dispersion strengthened (ODS) ferritic steels produced by mechanical alloying (MA) and followed by hot extrusion have been studied using high-resolution transmission electron microscopy (HRTEM) techniques to understand the formation mechanism of nanoparticles in MA/ODS steels. The observations of Y-Al-O complex-oxide nanoparticles in both ODS steels imply that decomposition of Y{sub 2}O{sub 3} in association with internal oxidation of Al occurred during mechanical alloying. While the majority of oxide nanoparticles formed in both steels is Y{sub 4}Al{sub 2}O{sub 9}, a few oxide particles of YAlO{sub 3} are also observed occasionally. These results reveal that Ti (0.3 wt %) plays an insignificant role in forming oxide nanoparticles in the presence of Al (4.5 wt %). HRTEM observations of crystalline nanoparticles larger than {approx}2 nm and amorphous or disordered cluster domains smaller than {approx}2 nm provide an insight into the formation mechanism of oxide nanoparticle in MA/ODS steels, which we believe from our observations involves solid-state amorphization and recrystallization. The role of nanoparticles in suppressing radiation-induced swelling is revealed through TEM examinations of cavity distributions in ion-irradiated Fe-14Cr and K3-ODS ferritic steels. HRTEM observations of helium-filled cavities (helium bubbles) preferably trapped at nanoscale oxide particles and clusters in ion-irradiated K3-ODS are presented.

  6. Joining a Ni-based creep-resistant (ODS) alloy by brazing

    NASA Astrophysics Data System (ADS)

    Bucklow, I. A.

    Joints are produced in a fine-grained Ni oxide-dispersion-strengthened (ODS) alloy by means of brazing alloys with and without boron, and the resulting joints are studied mechanographically. The brazing alloys employed are either sputtered coatings or foils, and brazing is conducted in a vacuum for approximately two hours. The resulting joints are examined during the process by mass spectrometry and afterwards by means of metallographic observation following etching in glyceregia. Premature and uncontrolled recrystallization of the parent metal is noted in the samples brazed with alloys obtaining boron. The 2-micron braze coating used minimize second-phase formation and dispersoid agglomerations, and the 25-micron brazing foils lead to high porosity and dispersoid aggregation due to excessive melting. Recrystallization of the parent metal near brazing zones is concluded to be undesirable although is does not necessarily influence the quality of the joint.

  7. Reactions of Deuterated Methanol (CD3OD) on Fe3O4(111)

    SciTech Connect

    Li, Zhisheng; Potapenko, Denis V.; Rim, Kwang T.; Flytzani-Stephanopoulos, Maria; Flynn, George; Osgood, Richard; Wen, Xiaodong; Batista, Enrique R.

    2015-01-15

    We report an experimental and theoretical investigation of the decomposition (partial oxidation) of deuterated methanol (CD3OD) on a single-crystal Fe3O4(111) surface. The crystal surface contains majority areas of a Fe-terminated Fe3O4(111) surface as well as smaller regions of O-terminated FeO(111) or biphase surface reconstruction. Our investigation uses a combination of scanning tunneling microscopy, temperature-programmed desorption, and density functional theory calculations to examine the surface reactions and adsorbates as a function of coverage. Our studies show that the reaction of methanol on this iron–oxide surface is highly sensitive to atomic-level surface reconstructions

  8. Front-end electronics for the tagger of the BGO-OD experiment

    NASA Astrophysics Data System (ADS)

    Messi, Francesco

    2013-08-01

    The BGO-OD experiment is intended for the systematic investigation of the photo-production of mesons off the nucleon. The experiment will use bremsstrahlung photons from an e- beam incident upon a thin radiator. The photon energy will be measured via the deflection of the electrons in the magnetic field of a photon tagger. The B-FrED is a 16 channel double-threshold discriminator and shaper board designed as Front-End Electronics for the new Tagger detector of the experiment. It is a 6U-VME form factor card. The analog input stage has 1.7 GHz bandwidth. The output stage provides two LVDS signals with an expected jitter of ∼ 8 ps with respect to the input signal. The threshold settings are managed by a micro-controller which is remotely accessible through Ethernet.

  9. Radiation induced microstructures in ODS 316 austenitic steel under dual-beam ions

    NASA Astrophysics Data System (ADS)

    Zhang, He Ken; Yao, Zhongwen; Zhou, Zhangjian; Wang, Man; Kaitasov, Odile; Daymond, Mark R.

    2014-12-01

    An ODS 316 austenitic steel was fabricated and irradiated using dual ion beams (1 MeV Kr+ and 15 keV He+) with in-situ transmission electron microscope (TEM) observation. Cavities formed at a low dose in samples irradiated with simultaneous helium injection. It was found that Y-Ti-O particles acted as strong traps for cavity formation at low doses. Helium exhibited a significant effect on cavity development. Cavities were also preferentially nucleated along grain boundaries, phase boundaries and twin boundaries. Irradiation induced lattice defects mainly consisted of small 1/2<1 1 0> perfect loops and 1/3<1 1 1> Frank loops. An increment of helium injection rate also greatly enhanced the Frank loop growth. Small (<10 nm) Y-Ti-O particles were found to be unstable after irradiation to high doses. M23C6 precipitates were observed after irradiation and helium might play a major role in their formation.

  10. Study of radiation damage in ODS steels by positron annihilation spectroscopy

    NASA Astrophysics Data System (ADS)

    Bartošová, I.; Bouhaddane, A.; Dománková, M.; Slugeň, V.; Wall, D.; Selim, F. A.

    2016-01-01

    Microstructure of various oxide-dispersion-strengthened (ODS) steels with 15% chromium content was studied in term of vacancy defects presence and their accumulation after defined irradiation treatment, respectively. Studied materials originated from Kyoto University and studied via IAEA collaborative project. Samples were characterized “as received” by positron annihilation lifetime spectroscopy and their microstructure was examined by transmission electron microscopy as well. Samples were afterwards irradiated in Washington State University Nuclear Radiation Center via a strong gamma source (6TBq). Damage induced by gamma irradiation was evaluated by positron lifetime measurements in emphasis on defect accumulation in the materials. We have demonstrated strong defect production induced by gamma irradiation which results from positron measurement data.

  11. Progress toward determining the potential of ODS alloys for gas turbine applications

    NASA Technical Reports Server (NTRS)

    Dreshfield, R. L.; Hoppin, G., III; Sheffler, K.

    1983-01-01

    The Materials for Advanced Turbine Engine (MATE) Program managed by the NASA Lewis Research Center is supporting two projects to evaluate the potential of oxide dispersion strengthened (ODS) alloys for aircraft gas turbine applications. One project involves the evaluation of Incoloy (TM) MA-956 for application as a combustor liner material. An assessment of advanced engine potential will be conducted by means of a test in a P&WA 2037 turbofan engine. The other project involves the evaluation of Inconel (TM) MA 6000 for application as a high pressure turbine blade material and includes a test in a Garrett TFE 731 turbofan engine. Both projects are progressing toward these engine tests in 1984.

  12. Impact of friction stir welding on the microstructure of ODS steel

    NASA Astrophysics Data System (ADS)

    Dawson, H.; Serrano, M.; Cater, S.; Iqbal, N.; Almásy, L.; Tian, Q.; Jimenez-Melero, E.

    2017-04-01

    We have assessed the impact of the welding parameters on the nano-sized oxide dispersion and the grain size in the matrix of an ODS steel after friction stir welding. Our results, based on combined small angle neutron scattering and electron microscopy, reveal a decrease in the volume fraction of the particles smaller than 80 nm in the welds, mainly due to particle agglomeration. The increase in tool rotation speed or decrease in transverse speed leads to a higher reduction in nano-sized particle fraction, and additionally to the occurrence of particle melting. The dependence of the average grain size in the matrix on the particle volume fraction follows a Zener pinning-type relationship. This result points to the principal role that the particles have in pinning grain boundary movement, and consequently in controlling the grain size during welding.

  13. High-temperature corrosion behavior of coatings and ODS alloys based on Fe{sub 3}Al

    SciTech Connect

    Tortorelli, P.F.; Pint, B.A.; Wright, I.G.

    1996-06-01

    Iron aluminides containing greater than about 20-25 @ % Al have oxidation/sulfidation resistance at temperatures well above those at which these alloys have adequate mechanical strength. In addition to alloying modifications for improved creep resistance of wrought material, this strength limitation is being addressed by development of oxide-dispersion- strengthened (ODS) iron aluminides and by evaluation of Fe{sub 3}Al alloy compositions as coatings or claddings on higher-strength, less corrosion-resistant materials. As part of these efforts, the high-temperature corrosion behavior of iron-aluminide weld overlays and ODS alloys is being characterized and compared to previous results for ingot-processed material.

  14. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    SciTech Connect

    Nelson, William C.; Stegen, James C.

    2015-07-21

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. ‘Housekeeping’ genes and genes for biosynthesis of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum.

  15. Irradiation hardening of ODS ferritic steels under helium implantation and heavy-ion irradiation

    NASA Astrophysics Data System (ADS)

    Zhang, Hengqing; Zhang, Chonghong; Yang, Yitao; Meng, Yancheng; Jang, Jinsung; Kimura, Akihiko

    2014-12-01

    Irradiation hardening of ODS ferritic steels after multi-energy He-ion implantation, or after irradiation with energetic heavy ions including Xe and Bi-ions was investigated with nano-indentation technique. Three kinds of high-Cr ODS ferritic steels including the commercial MA956 (19Cr-3.5Al), the 16Cr-0.1Ti and the 16Cr-3.5Al-0.1Zr were used. Data of nano-hardness were analyzed with an approach based on Nix-Gao model. The depth profiles of nano-hardness can be understood by the indentation size effect (ISE) in specimens of MA956 implanted with multi-energy He-ions or irradiated with 328 MeV Xe ions, which produced a plateau damage profile in the near-surface region. However, the damage gradient overlaps the ISE in the specimens irradiated with 9.45 Bi ions. The dose dependence of the nano-hardness shows a rapid increase at low doses and a slowdown at higher doses. An 1/2-power law dependence on dpa level is obtained. The discrepancy in nano-hardness between the helium implantation and Xe-ion irradiation can be understood by using the average damage level instead of the peak dpa level. Helium-implantation to a high dose (7400 appm/0.5 dpa) causes an additional hardening, which is possibly attributed to the impediment of motion dislocations by helium bubbles formed in high concentration in specimens.

  16. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    DOE PAGES

    Nelson, William C.; Stegen, James C.

    2015-07-21

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in a broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. “Housekeeping” genes and genes for biosynthesismore » of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides, and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle, or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest that the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum.« less

  17. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    SciTech Connect

    Nelson, William C.; Stegen, James C.

    2015-07-21

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in a broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. “Housekeeping” genes and genes for biosynthesis of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides, and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle, or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest that the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum.

  18. Production, microstructure and mechanical properties of two different austenitic ODS steels

    NASA Astrophysics Data System (ADS)

    Gräning, T.; Rieth, M.; Hoffmann, J.; Möslang, A.

    2017-04-01

    This article is to summarize and examine processing parameters of novel developed austenitic oxide dispersed strengthened (ODS) steels. Comparing hot-rolled and extruded conditions after the same degree of deformation after and before annealing, are just some examples to give insights into the complex processing of austenitic ODS steels. One of the major drawbacks of the material is the more sophisticated production process. Due to a ductile matrix material with an increased stickiness during milling, a two-step milling procedure with the use of ZrO2 milling balls was applied to raise the production yield and to use the abrasion of the ZrO2 as an additional element to facilitate the formation of nano-sized precipitates. To get a better understanding how the different powder particle sizes after milling affect final properties, sieving was applied and revealed a serious effect in terms of precipitate size, distribution and mechanical properties. Grain sizes in relation to the precipitate size, annealing time and processing parameters were determined and compared to the mechanical properties. Hardness and tensile test have pointed out, that the precipitate size and number are more important in respect to the ultimate tensile strength than the grain size and that in this study hot-rolled material exhibited the better properties. The investigation of the microstructure illustrated the stability of precipitates during annealing at 1100 °C for 40 h. These heat treatments also led to a consistent grain size, due to the pinning effect of the grain boundaries, caused by precipitates.

  19. Evaluation of Pb-17Li compatibility of ODS Fe-12Cr-5Al alloys

    NASA Astrophysics Data System (ADS)

    Unocic, Kinga A.; Hoelzer, David T.

    2016-10-01

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb-17Li and He) blanket concept requires improved Pb-17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y2O3 (125Y), (2) Y2O3 + ZrO2 (125YZ), (3) Y2O3 + HfO2 (125YH), and (4) Y2O3 + TiO2 (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb-17Li for 1000 h at 700 °C. Alloys showed promising compatibility with Pb-17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experienced the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO2 on all four alloys. A small decrease (∼1 at.%) in Al content beneath the oxide scale was observed in all four ODS alloys, which extended 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO2 product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb-17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module.

  20. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    PubMed Central

    Nelson, William C.; Stegen, James C.

    2015-01-01

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in a broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. “Housekeeping” genes and genes for biosynthesis of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides, and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle, or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest that the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum. PMID:26257709

  1. Evaluation of Pb-17Li compatibility of ODS Fe-12Cr-5Al alloys

    DOE PAGES

    Unocic, Kinga A.; Hoelzer, David T.

    2016-07-09

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb–17Li and He) blanket concept requires improved Pb–17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y2O3 (125Y), (2) Y2O3+ZrO2 (125YZ), (3) Y2O3+HfO2 (125YH), and (4) Y2O3+TiO2 (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb–17Li for 1000 h at 700°C. Alloys showed promising compatibility with Pb–17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experiencedmore » the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO2 on all four alloys. A small decrease (~1 at.%) in Al content beneath the oxide scale was observed in all 4 ODS alloys, which extended through 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO2 product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb–17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module.« less

  2. Evaluation of Pb-17Li compatibility of ODS Fe-12Cr-5Al alloys

    SciTech Connect

    Unocic, Kinga A.; Hoelzer, David T.

    2016-07-09

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb–17Li and He) blanket concept requires improved Pb–17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y2O3 (125Y), (2) Y2O3+ZrO2 (125YZ), (3) Y2O3+HfO2 (125YH), and (4) Y2O3+TiO2 (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb–17Li for 1000 h at 700°C. Alloys showed promising compatibility with Pb–17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experienced the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO2 on all four alloys. A small decrease (~1 at.%) in Al content beneath the oxide scale was observed in all 4 ODS alloys, which extended through 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO2 product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb–17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module.

  3. Advanced TEM characterization of oxide nanoparticles in ODS Fe–12Cr–5Al alloys

    DOE PAGES

    Unocic, Kinga A; Hoelzer, David T; Pint, Bruce A

    2016-01-01

    For oxide nanoparticles present in three oxide-dispersion-strengthened (ODS) Fe–12Cr–5Al alloys containing additions of (1) Y2O3 (125Y), (2) Y2O3 + ZrO2 (125YZ), and (3) Y2O3 + HfO2 (125YH), were investigated using transmission and scanning transmission electron microscopy. Furthermore, in all three alloys nano-sized (<3.5 nm) oxide particles distributed uniformly throughout the microstructure were characterized using advanced electron microscopy techniques. In the 125Y alloy, mainly Al2O3 and yttrium–aluminum garnet (YAG) phases (Y3Al5O12) were present, while in the 125YZ alloy, additional Zr(C,N) precipitates were identified. The 125YH alloy had the most complex precipitation sequence whereby in addition to the YAG and Al2O3 phases,more » Hf(C,N), Y2Hf2O7, and HfO2 precipitates were also found. The presence of HfO2 was mainly due to the incomplete incorporation of HfO2 powder during mechanical alloying of the 125YH alloy. The alloy having the highest total number density of the oxides, the smallest grain size, and the highest Vickers hardness was the 125YZ alloy indicating, that Y2O3 + ZrO2 additions had the strongest effect on grain size and tensile properties. Finally, high-temperature mechanical testing will be addressed in the near future, while irradiation studies are underway to investigate the irradiation resistance of these new ODS FeCrAl alloys.« less

  4. Measuring the Fracture Toughness of TZM and ODS Molybdenum Alloys Using Standard and Sub-Sized Bend Specimens

    SciTech Connect

    Cockeram, B. V.

    2002-12-01

    Oxide Dispersion Strengthened (ODS) and TZM molybdenum have excellent creep resistance and strength at high temperatures in inert atmospheres. Fracture toughness and tensile testing was performed at temperatures between -150 degrees C and 450 degrees C to characterize 6.35 mm thick plate material of ODS and TZM molybdenum. A transition from low fracture toughness values (5.8 to 29.6 MPa square root m) to values greater than 30 MPa square root m is observed for TZM molybdenum in the longitudinal orientation at 100 degrees C and in the transverse orientation at 150 degrees C. These results are consistent with data reported in literature for molybdenum. A transition to low fracture toughness values (less than 30 MPa square root m) was not observed for longitudinal ODS molybdenum at temperatures greater than or equal to -150 degrees C, while a transition to low fracture toughness values (12.6 to 25.4 MPa square root m) was observed for the transverse orientation at room-temperature. The fi ne spacing of La-oxide precipitates that are present in ODS molybdenum result in a transition temperature that is significantly lower than any molybdenum alloy reported to date, with upper bound fracture toughness values that bound the literature data. A comparison of fracture toughness values obtained using a 1T, 0.5T, and 0.25T Charpy shows that a 0.5T Charpy could be used as a sub-sized specimen geometry.

  5. A Safe Place to Stay Sharp: Action Learning Meets Cooperative Inquiry in the Service of NHS OD Capacity Building

    ERIC Educational Resources Information Center

    Traeger, James; Norgate, Carolyn

    2015-01-01

    This is an account of practice. It explores the meeting point between action learning and action research, as a way of doing capacity building in organisational development (OD) in the NHS in the UK. The authors were part of a short cooperative inquiry (Heron, J. 1996. "Co-operative Inquiry: Research into the Human Condition." London:…

  6. Corrosion property of 9Cr-ODS steel in nitric acid solution for spent nuclear fuel reprocessing

    SciTech Connect

    Takeuchi, M.; Koizumi, T.; Inoue, M.; Koyama, S.I.

    2013-07-01

    Corrosion tests of oxide dispersion strengthened with 9% Cr (9Cr-ODS) steel, which is one of the desirable materials for cladding tube of sodium-cooled fast reactors, in pure nitric acid solution, spent FBR fuel solution, and its simulated solution were performed to understand the corrosion behavior in a spent nuclear fuel reprocessing. In this study, the 9Cr-ODS steel with lower effective chromium content was evaluated to understand the corrosion behavior conservatively. As results, the tube-type specimens of the 9Cr-ODS steels suffered severe weight loss owing to active dissolution at the beginning of the immersion test in pure nitric acid solution in the range from 1 to 3.5 M. In contrast, the weight loss was decreased and they showed a stable corrosion in the higher nitric acid concentration, the dissolved FBR fuel solution, and its simulated solution by passivation. The corrosion rates of the 9Cr-ODS steel in the dissolved FBR fuel solution and its simulated solution were 1-2 mm/y and showed good agreement with each other. The passivation was caused by the shift of corrosion potential to noble side owing to increase in nitric acid concentration or oxidative ions in the dissolved FBR fuel solution and the simulated spent fuel solution. (authors)

  7. Ion-molecule reaction dynamics: Velocity map imaging studies of N+ and O+ with CD3OD

    NASA Astrophysics Data System (ADS)

    Pei, Linsen; Farrar, James M.

    2015-08-01

    We present a study of the charge transfer reactions of the atomic ions N+and O+ with methanol in the collision energy range from ˜2 to 4 eV. Charge transfer is driven primarily by energy resonance, although the widths of the product kinetic energy distributions suggest that significant interchange between relative translation and product vibration occurs. Charge transfer with CD3OD is more exoergic for N+, and the nascent parent ion products appear to be formed in excited B ˜ and C ˜ electronic states, and fragment to CD2OD+ by internal conversion and vibrational relaxation to the ground electronic state. The internal excitation imparted to the parent ion is sufficient to result in loss of one or two D atoms from the carbon atom. The less exoergic charge transfer reaction of O+ forms nascent parent ions in the excited A ˜ state, and internal conversion to the ground state only results in ejection of single D atom. Selected isotopomers of methanol were employed to identify reaction products, demonstrating that deuterium atom loss from nascent parent ions occurs by C-D bond cleavage. Comparison of the kinetic energy distributions for charge transfer to form CD3OD+ and CD2OD+ by D atom loss with the known dynamics for hydride abstraction from a carbon atom provides strong evidence that the D loss products are formed by dissociative charge transfer rather than hydride (deuteride) transfer. Isotopic labeling also demonstrates that chemical reaction in the N+ + CD3OD system to form NO+ + CD4 does not occur in the energy range of these experiments, contrary to earlier speculation in the literature.

  8. Characterization of Tubing from Advanced ODS alloy (FCRD-NFA1)

    SciTech Connect

    Maloy, Stuart Andrew; Aydogan, Eda; Anderoglu, Osman; Lavender, Curt; Anderson, Iver; Rieken, Joel; Lewandowski, John; Hoelzer, Dave; Odette, George R.

    2016-09-20

    Fabrication methods are being developed and tested for producing fuel clad tubing of the advanced ODS 14YWT and FCRD-NFA1 ferritic alloys. Three fabrication methods were based on plastically deforming a machined thick-wall tube sample of the ODS alloys by pilgering, hydrostatic extrusion or drawing to decrease the outer diameter and wall thickness and increase the length of the final tube. The fourth fabrication method consisted of the additive manufacturing approach involving solid-state spray deposition (SSSD) of ball milled and annealed powder of 14YWT for producing thin-wall tubes. Of the four fabrication methods, two methods were successful at producing tubing for further characterization: production of tubing by high-velocity oxy-fuel spray forming and production of tubing using high-temperature hydrostatic extrusion. The characterization described shows through neutron diffraction the texture produced during extrusion while maintaining the beneficial oxide dispersion. In this research, the parameters for innovative thermal spray deposition and hot extrusion processing methods have been developed to produce the final nanostructured ferritic alloy (NFA) tubes having approximately 0.5 mm wall thickness. Effect of different processing routes on texture and grain boundary characteristics has been investigated. It was found that hydrostatic extrusion results in combination of plane strain and shear deformations which generate rolling textures of α- and γ-fibers on {001}<110> and {111}<110> together with a shear texture of ζ-fiber on {011}<211> and {011}<011>. On the other hand, multi-step plane strain deformation in cross directions leads to a strong rolling textures of θ- and ε-fiber on {001}<110> together with weak γ-fiber on {111}<112>. Even though the amount of the equivalent strain is similar, shear deformation leads to much lower texture indexes compared to the plane strain deformations. Moreover, while 50% of hot rolling brings about a large number of

  9. Advanced TEM characterization of oxide nanoparticles in ODS Fe–12Cr–5Al alloys

    SciTech Connect

    Unocic, Kinga A; Hoelzer, David T; Pint, Bruce A

    2016-01-01

    For oxide nanoparticles present in three oxide-dispersion-strengthened (ODS) Fe–12Cr–5Al alloys containing additions of (1) Y2O3 (125Y), (2) Y2O3 + ZrO2 (125YZ), and (3) Y2O3 + HfO2 (125YH), were investigated using transmission and scanning transmission electron microscopy. Furthermore, in all three alloys nano-sized (<3.5 nm) oxide particles distributed uniformly throughout the microstructure were characterized using advanced electron microscopy techniques. In the 125Y alloy, mainly Al2O3 and yttrium–aluminum garnet (YAG) phases (Y3Al5O12) were present, while in the 125YZ alloy, additional Zr(C,N) precipitates were identified. The 125YH alloy had the most complex precipitation sequence whereby in addition to the YAG and Al2O3 phases, Hf(C,N), Y2Hf2O7, and HfO2 precipitates were also found. The presence of HfO2 was mainly due to the incomplete incorporation of HfO2 powder during mechanical alloying of the 125YH alloy. The alloy having the highest total number density of the oxides, the smallest grain size, and the highest Vickers hardness was the 125YZ alloy indicating, that Y2O3 + ZrO2 additions had the strongest effect on grain size and tensile properties. Finally, high-temperature mechanical testing will be addressed in the near future, while irradiation studies are underway to investigate the irradiation resistance of these new ODS FeCrAl alloys.

  10. Spectrally narrowed lasing of a self-injection KrF excimer laser

    NASA Astrophysics Data System (ADS)

    Shimada, Yasuhiro; Wani, Koichi; Miki, Tadaaki; Kawahara, Hidehito; Mimasu, Mutsumi; Ogata, Yoshiro

    1990-08-01

    Spectrally nantwed lasing of a KrF excimer laser has teen ahieved by a self-injection technique using abeam splitter for power extraction aixi intravity etalons for spectral-narrowing. The laser cavity is divithi into an amplifying branch aix! a spectralnarrowing branch. The spectral bandwidth was narrowed to <3pm FWHM with air-sed etalons placed in the spectral-narrowing branch. A laser propagation model was intrOdUced for describing the laser intensity traveling in the laser cavity. The calculated intensityincident onthe intracavityetalons wassmaller thanthat in theconventional Fabry-Perotcavity withplane-parallel mirrors.

  11. Effect of microstructure on low cycle fatigue properties of ODS steels

    NASA Astrophysics Data System (ADS)

    Kubena, Ivo; Fournier, Benjamin; Kruml, Tomas

    2012-05-01

    Low cycle fatigue properties at room temperature, 650 °C and 750 °C of three high chromium steels (9%Cr ferritic-martensitic and two 14%Cr ferritic steels) strengthened by oxide dispersion were studied and compared. Cyclic softening/hardening curves, cyclic deformation curves, S-N curves and Coffin-Manson curves are presented together with microstructural observations. Differences in cyclic response, stress level and fatigue life are attributed to differences in the matrix microstructure. The oxide particles stabilize the cyclic response, even if cyclic softening is detected for some experimental conditions. The strength of these steels is discussed in terms of strengthening mechanisms such as grain size effect, particle-dislocations interaction and dislocation density. Comparing three different ODS steels offers an opportunity to tests the contribution of individual mechanisms to the cyclic strength. The reduction of fatigue life in one of the ferritic steels is explained by the presence of large grains, facilitating the fatigue crack nucleation and the early growth.

  12. High-cycle fatigue properties of the ODS-alloy MA 6000 at 850 C

    SciTech Connect

    Hoffelner, W.; Singer, R.F.

    1985-03-01

    The high cycle fatigue (HCF) and cyclic crack growth rate (CCGR) properties of the dispersion strengthened ODS-alloy MA 6000 were investigated with smooth bars and with fracture mechanics samples at 850 C. The material was very coarse-grained with the grains elongated in the rolling direction. The fatigue limit of samples cut parallel to the grain elongation direction (p-samples) was almost a factor of 2 higher than the one of samples cut transverse to the elongation direction (t-samples). Inclusions were found to be responsible for crack initiation. For p-samples a reasonable agreement between particle size, fatigue limit, and crack growth behavior was found. For t-type samples such an agreement also exists, provided differences in the crack growth behavior of short cracks and long cracks are taken into consideration. The low fatigue strength of t-samples could be linked with low Young's modulus in this direction. The crack propagation rate of long cracks is lower in t-samples than in p-samples due to crack branching along the grain boundaries. HCF-strength of MA 6000 is high compared to conventional cast alloys mainly because of reduced size of crack nucleation sites and higher fatigue threshold stress intensity range, as a result of higher Young's modulus. 15 references.

  13. Magnetic Structure and Spin Waves in Co2(OD)3Cl

    NASA Astrophysics Data System (ADS)

    Dissanayake, Sachith; Ji, S.; Chan, C.; Ng, T. K.; Lee, J.; Qiu, Y.; Rule, K. C.; Lake, B.; Green, M.; Zheng, X. G.; Lee, S.-H.

    2012-02-01

    We have examined the magnetic structure of Co2(OD)3Cl with magnetic Co^2+ (3d^7; s= 3/2) ions using neutron powder diffraction data. Magnetic structure that yields the best refinement factor is an ``umbrella''-type antiferromagnetic structure with ab-components of magnetic moments in the kagome plane forming a q=0 120^o structure and the moments are canted out of the plane by ˜ 40^o. The magnetic moments in the triangular plane are aligned ferromagnetically along the c-axis. We have performed linear spin wave calculations considering the nearest neighbor interactions J within the kagome plane and JF between the kagome and the triangular plane. The effects of JF/J and the canting angle to the spin wave dispersion was studied thoroughly, to find out an effective spin hamiltonian that explains our inelastic neutron scattering data with two prominent excitation modes centered at 3 meV and 19 meV. Single ion-type anisotropy was also included in the spin hamiltonian to study its effect to the spin wave excitation.

  14. Deuterium ordering found in new ferroelectric compound Co2(OD)3Cl

    NASA Astrophysics Data System (ADS)

    Meng, Dong-Dong; Zheng, Xu-Guang; Liu, Xiao-Dong; Xu, Xing-Liang; Guo, Qi-Xin

    2015-07-01

    A detailed temperature-dependent Raman spectroscopic study revealed a new type of deuterium-order ferroelectrics in a geometrically frustrated magnet Co2(OD)3Cl at Tɛ = 229 K. Significant changes in the parameters of the Raman vibration modes were observed near Tɛ, suggesting a strong phonon-charge coupling. Additional asymmetric phonon bands appeared below around Tɛ, which are consistently interpreted by phonon folding processes due to a small local structural change resulting from the ordering of deuterium. The wavenumber and intensity changes of the Raman-active modes, as well as the normalized intensities of the additional bands, all follow a power-law fit Δω, ΔI, I ∝ (1 - T/TC)2β, wherein TC = 230 K ˜ Tɛ and β = 0.35(2), clearly demonstrating an ordering process below Tɛ. The critical exponent is reminiscent of a second order transition. Our study presents a rare and new type of multiferroic material with ferroelectricity arising from the deuterium ordering in geometrically frustrated magnets.

  15. High temperature Oxidation of ODS alloy with zirconia dispersions synthesized using Arc Plasma Sintering

    NASA Astrophysics Data System (ADS)

    Bandriyana; Sujatno, A.; Salam, R.; Sugeng, B.; Dimyati, A.

    2017-02-01

    Microstructure formation and oxidation behaviour of the Oxide Dispersion Strengthened (ODS) steels for application as structure material in Nuclear Power Plant was investigated. A mixture composed of Fe and 12 wt. % Cr powder with addition of 0.5 and 1 wt.% ZrO2 particles was milled and isostatic pressed to form a sample coin. The coin was then consolidated in the Arc Plasma Sintering (APS) for 4 minutes. The samples were subjected to the high temperature oxidation test in the Magnetic Suspension Balance (MSB). The oxidation test was carried out at 700°C for 6 hours to evaluate the oxide growth in the early stage of it formation by extraction the mass gain curve. The Scanning Electron Microscope (SEM) imaging and X-ray Diffraction Spectroscopy (EDX) elemental mapping were performed to study the microstructure change and compositional distribution. SEM and EDX observation revealed the time dependent development of the Fe-Cr-phases during consolidation. The oxidation rate behaviour of the samples followed the parabolic rate characteristic for inward oxidation process driven by oxygen inward diffusion through the oxide scale with the maximum weight gain around of 60 g/m2. The oxidation resistance was strongly affected by the formation of the oxide protective layer on the surface. In so far, addition of zirconia particles has played no significant role to the oxidation behaviour.

  16. Structural and chemical evolution in neutron irradiated and helium-injected ferritic ODS PM2000 alloy

    NASA Astrophysics Data System (ADS)

    Jung, Hee Joon; Edwards, Dan J.; Kurtz, Richard J.; Yamamoto, Takuya; Wu, Yuan; Odette, G. Robert

    2017-02-01

    An investigation of the influence of helium on damage evolution under neutron irradiation of an 11 at% Al, 19 at% Cr ODS ferritic PM2000 alloy was carried out in the High Flux Isotope Reactor (HFIR) using a novel in situ helium injection (ISHI) technique. Helium was injected into adjacent TEM discs from thermal neutron 58Ni(nth,γ) 59Ni(nth,α) reactions in a thin NiAl layer. The PM2000 undergoes concurrent displacement damage from the high-energy neutrons. The ISHI technique allows direct comparisons of regions with and without high concentrations of helium since only the side coated with the NiAl experiences helium injection. The corresponding microstructural and microchemical evolutions were characterized using both conventional and scanning transmission electron microscopy techniques. The evolutions observed include formation of dislocation loops and associated helium bubbles, precipitation of a variety of phases, amorphization of the Al2YO3 oxides (which also variously contained internal voids), and several manifestations of solute segregation. Notably, high concentrations of helium had a significant effect on many of these diverse phenomena. These results on PM2000 are compared and contrasted to the evolution of so-called nanostructured ferritic alloys (NFA).

  17. Study of the deformation mechanisms in a Fe-14% Cr ODS alloy

    NASA Astrophysics Data System (ADS)

    Praud, M.; Mompiou, F.; Malaplate, J.; Caillard, D.; Garnier, J.; Steckmeyer, A.; Fournier, B.

    2012-09-01

    In this present work, the plasticity of a rod bar of a 14% Cr ferritic ODS steel is examined through a multiscale approach based on both macroscopic and microscopic results. This bar was elaborated at CEA by powder metallurgy and consolidated by hot extrusion. The microstructure of the material has been characterized. First, the tensile behavior of this material is studied in a wide range of temperatures. Thereafter, through in situ Transmission Electron Microscopy (TEM) straining experiments, dislocation/dislocation and dislocation/precipitates interactions are observed. The collapse of the tensile properties noticed from 400 °C can be explained by a change in the deformation mechanism. At lower temperatures, the hardening seems to be due to the precipitates, dislocations are pinned on oxides. At higher temperatures, the hardening role of the precipitates is still observed, but the dislocations seem to move in a more steady way, thermal activation of dislocations sources is observed and leads to formation of cavities at the grain boundaries.

  18. The metallurgical and mechanical properties of ODS alloy MA 956 friction welds

    SciTech Connect

    Shinozaki, K.; Kang, C.Y.; Kim, Y.C.; Nakao, Y.; Aritoshi, M.; North, T.H.

    1997-08-01

    The metallurgical and mechanical properties of friction welded MA 956 oxide dispersion strengthened (ODS) iron-based superalloy material were investigated. The mechanical properties of friction welded joints were evaluated using a combination of room temperature and elevated temperature tensile testing and creep rupture testing. The microstructural features and particle characteristics were examined using optical and transmission electron microscopy. The distribution of residual stress in completed joints was analyzed using FEM analysis. The room temperature and elevated temperature tensile strengths of friction welded joints were similar to those of as-received MA 956 base material and, in all cases, failure occurred away from the weld interface. However, the creep rupture properties of friction welded joints were much poorer than those of as-received MA 956 base material. The friction welding operation created low-aspect-ratio, fully recrystallized grains at the joint centerline and substantially altered the oxide particle chemistry, dimensions and shape in the joint region. It is speculated that the coarse, irregularly shaped particles in regions immediately adjacent to the weld interface were produced as a result of a strain-induced agglomeration of small-diameter yttria dispersoids with larger-diameter alumina and Ti(C,N) particles.

  19. Relaxation pathways of the OD stretch fundamental of HOD in liquid H2O.

    PubMed

    Miguel, Beatriz; Zúñiga, José; Requena, Alberto; Bastida, Adolfo

    2016-12-28

    The molecular dynamics with quantum transitions method is used to study the vibrational relaxation of the OD stretching mode of HOD dissolved in liquid H2O water at 303 K. All the vibrational modes of the solute and solvent molecules that participate in the relaxation process are described by quantum mechanics, while the rotational and translational degrees of freedom are treated classically. A modification of the water intramolecular SPC/E (Simple Point Charge/Extended) force field providing vibrational frequencies in solution closer to the experimental values is proposed to analyze the influence of the vibrational energy gaps on the relaxation channels. The relaxation times obtained are in satisfactory agreement with experimental values. The energy transfer during the relaxation process alters significantly the H-bond network around the HOD molecule. The analysis of the vibrational transitions during the relaxation process reveals a complex mechanism which involves the participation of both intra- and intermolecular channels and provides a compromise for the different interpretations of the experimental data reported for this system in recent years.

  20. Unusual respiratory capacity and nitrogen metabolism in a Parcubacterium (OD1) of the Candidate Phyla Radiation

    PubMed Central

    Castelle, Cindy J.; Brown, Christopher T.; Thomas, Brian C.; Williams, Kenneth H.; Banfield, Jillian F.

    2017-01-01

    The Candidate Phyla Radiation (CPR) is a large group of bacteria, the scale of which approaches that of all other bacteria. CPR organisms are inferred to depend on other community members for many basic cellular building blocks and all appear to be obligate anaerobes. To date, there has been no evidence for any significant respiratory capacity in an organism from this radiation. Here we report a curated draft genome for ‘Candidatus Parcunitrobacter nitroensis’ a member of the Parcubacteria (OD1) superphylum of the CPR. The genome encodes versatile energy pathways, including fermentative and respiratory capacities, nitrogen and fatty acid metabolism, as well as the first complete electron transport chain described for a member of the CPR. The sequences of all of these enzymes are highly divergent from sequences found in other organisms, suggesting that these capacities were not recently acquired from non-CPR organisms. Although the wide respiration-based repertoire points to a different lifestyle compared to other CPR bacteria, we predict similar obligate dependence on other organisms or the microbial community. The results substantially expand the known metabolic potential of CPR bacteria, although sequence comparisons indicate that these capacities are very rare in members of this radiation. PMID:28067254

  1. Anomalous H+ and D+ conductance in H2O-D2O mixtures

    NASA Astrophysics Data System (ADS)

    Weingärtner, H.; Chatzidimttriou-Dreismann, C. A.

    1990-08-01

    A KNOWLEDGE of proton-transfer dynamics and hydrogen-bonding in water and aqueous solutions is necessary for the understanding of many important chemical and biological processes. For example, quantum effects related to proton transfer (or tunnelling) in H+(H2O)n clusters of liquid water (where n = 1,2,· · ·) are known to have a dominant role in the proton conductance mechanism1,2 and are responsible for the high conductances of H+ and OH- in water. A new quantum theoretical approach to this process has been presented3, which is based on the hypothesis that there are quantum correlations4-8 between each H+ and the protons of the surrounding water molecules, leading to the formation of coherent dissipative structures3,8. From further investigations, one of us predicted that an anomalous decrease of H+ conductance in H2O-D2O mixtures would take place9. Having thought of an experiment to test these predictions9 we now report the experimental results and conclude that an anomalous decrease in proton conductance does indeed occur.

  2. Temporal trends and spatial variations of ozone-depleting substances (ODS) in the Pearl River Delta (PRD) region, southern China

    NASA Astrophysics Data System (ADS)

    Zhang, Yanli; Wang, Xinming; Blake, Donald; Simpson, Isobel

    2014-05-01

    Long-term observation of mixing ratios of ozone-depleting substances (ODS) in ambient air can help to assess the implementation of the Montreal Protocol and Its Amendments in regional and national scales. Here we present our measurement of ODS such as CFCs, HCFCs, halons and other halocarbons in ambient air since 2000 in the Pearl River Delta (PRD) region, one of the most densely populated and highly industrialized regions that was supposed to be a hotspot for ODS emission in China. These halocarbons in the PRD region were found to have 5-348% enhancements when compared to their global background levels. CFC-12 and CFC-11 in the region, for example, were 37-56% and 12-43%, respectively, above their global background levels. CFC replacement compounds showed even larger enhancements. In average mixing ratios of HCFC-22, HCFC-141b, and HCFC-142b were 89%, 87%, and 86% above their background levels of 148 ppt, 12.1 ppt, and 12.1 ppt in the year of 2000, respectively; and 72%, 125%, and 52% over their background levels of 205 ppt, 20.2 ppt, and 20.0 ppt in the year of 2009, respectively. During 2000-2009, CFCs in the PRD region showed decline trends with the decreasing rates of -3.0, -5.9, and -9.4 ppt/yr for CFC-12, CFC-11, and CFC-113, respectively; these rates were faster than that at the global background sites, which were -0.91, -2.12, and -0.69 ppt/yr, respectively. The CFCs substitutes HCFC-22, HCFC-141b, and HCFC-142b, however, showed increasing trends with the increasing rates of 8.0, 2.6, and 0.9 ppt/yr, respectively. HFC-134a, a refrigerant used for mobile air conditioning, showed rapid increase with a rate of 15 ppt/yr from 2000 to 2009 in the region. As for other halocarbons, methyl chloroform and carbon tetrachloride decreased with rates of 21 and 1 ppt/yr during the period. The mixing ratios of methyl chloride in the region showed unusual rapid increase at a rate of 64 ppt/yr when compared to its increasing rate of 1.3 ppt/yr at the global background

  3. The H2O/D2O isotope effect in crystalline lanthanide sulfates at photo-, radio-, and triboluminescence

    NASA Astrophysics Data System (ADS)

    Sharipov, G. L.; Tukhbatullin, A. A.; Mescheryakova, E. S.

    2016-02-01

    We comparatively studied the H2O/D2O isotope effect of lanthanide sulfate crystallohydrates on photo-, radio-, and triboluminescence and lifetimes of the excited Ln3+ ions. Replacing H2O by D2O leads to an increase in the luminescence intensity whereas this process does not affect the maxima positions in photo-, radio-, and triboluminescence spectra. This isotope effect agrees with the known concepts of changes in luminescence quantum yields of the Ln3+ ions being the main emitters. The bands of OH and OD radicals arise in triboluminescence spectra of lanthanide sulfate crystallohydrates (with H2O or D2O) registered in argon atmosphere in UV region. This supports the proposition that water destruction occurs at the degradation of the crystallohydrates.

  4. Synchrotron-based double imaging photoelectron/photoion coincidence spectroscopy of radicals produced in a flow tube: OH and OD

    SciTech Connect

    Garcia, Gustavo A.; Tang, Xiaofeng; Gil, Jean -Francois; Nahon, Laurent; Ward, Michael; Batut, Sebastien; Fittschen, Christa; Taatjes, Craig A.; Osborn, David L.; Loison, Jean -Christophe

    2015-04-23

    In this study, we present a microwave discharge flow tube coupled with a double imaging electron/ion coincidence device and vacuum ultraviolet (VUV) synchrotron radiation. The system has been applied to the study of the photoelectron spectroscopy of the well-known radicals OH and OD. The coincidence imaging scheme provides a high selectivity and yields the spectra of the pure radicals, removing the ever-present contributions from excess reactants, background, or secondary products, and therefore obviating the need for a prior knowledge of all possible byproducts. The photoelectron spectra encompassing the X3Σ ground state of the OH+ and OD+ cations have been extracted and the vibrational constants compared satisfactorily to existing literature values. Future advantages of this approach include measurement of high resolution VUV spectroscopy of radicals, their absolute photoionization cross section, and species/isomer identification in chemical reactions as a function of time.

  5. Synchrotron-based double imaging photoelectron/photoion coincidence spectroscopy of radicals produced in a flow tube: OH and OD

    SciTech Connect

    Garcia, Gustavo A.; Tang, Xiaofeng; Gil, Jean-François; Nahon, Laurent; Ward, Michael; Batut, Sebastien; Fittschen, Christa; Taatjes, Craig A.; Osborn, David L.; Loison, Jean-Christophe

    2015-04-28

    We present a microwave discharge flow tube coupled with a double imaging electron/ion coincidence device and vacuum ultraviolet (VUV) synchrotron radiation. The system has been applied to the study of the photoelectron spectroscopy of the well-known radicals OH and OD. The coincidence imaging scheme provides a high selectivity and yields the spectra of the pure radicals, removing the ever-present contributions from excess reactants, background, or secondary products, and therefore obviating the need for a prior knowledge of all possible byproducts. The photoelectron spectra encompassing the X{sup 3}Σ{sup −} ground state of the OH{sup +} and OD{sup +} cations have been extracted and the vibrational constants compared satisfactorily to existing literature values. Future advantages of this approach include measurement of high resolution VUV spectroscopy of radicals, their absolute photoionization cross section, and species/isomer identification in chemical reactions as a function of time.

  6. Synchrotron-based double imaging photoelectron/photoion coincidence spectroscopy of radicals produced in a flow tube: OH and OD

    DOE PAGES

    Garcia, Gustavo A.; Tang, Xiaofeng; Gil, Jean -Francois; ...

    2015-04-23

    In this study, we present a microwave discharge flow tube coupled with a double imaging electron/ion coincidence device and vacuum ultraviolet (VUV) synchrotron radiation. The system has been applied to the study of the photoelectron spectroscopy of the well-known radicals OH and OD. The coincidence imaging scheme provides a high selectivity and yields the spectra of the pure radicals, removing the ever-present contributions from excess reactants, background, or secondary products, and therefore obviating the need for a prior knowledge of all possible byproducts. The photoelectron spectra encompassing the X3Σ– ground state of the OH+ and OD+ cations have been extractedmore » and the vibrational constants compared satisfactorily to existing literature values. Future advantages of this approach include measurement of high resolution VUV spectroscopy of radicals, their absolute photoionization cross section, and species/isomer identification in chemical reactions as a function of time.« less

  7. Triplet extinction coefficients of some laser dyes I

    SciTech Connect

    Pavlopoulos, T.G.; Golich, D.J.

    1988-07-15

    We measured the triplet extinction coefficients epsilon/sub T/ over the laser action spectral region of Rhodamine 6G; Rhodamine B; Rhodamine 110; Fluorol-7GA; Coumarin 540A; Coumarin 522; Coumarin 1; Coumarin 120; 4,4'-diphenyl stilbene; and 2,7-bis-(4-methoxy-phenyl)-9,9-dipropylfluorene. We employed the different lines from an argon ion cw laser for excitation. McClure's method was used to obtain the triplet extinction coefficients epsilon/sub T/. The method requires the measurement of triplet optical densities OD/sub T/ as a function of different cw laser excitation intensities (powers) I/sub ex/ . The importance of triplet-state losses on dye laser efficiency is reviewed. The laser action properties of the laser dyes we studied are briefly discussed as they relate to the measured epsilon/sub T/ values.

  8. Microstructural study of an ODS stainless steel obtained by Hot Uni-axial Pressing

    NASA Astrophysics Data System (ADS)

    Sornin, D.; Grosdidier, T.; Malaplate, J.; Tiba, I.; Bonnaillie, P.; Allain-Bonasso, N.; Nunes, D.

    2013-08-01

    This study focuses on the consolidation of an ODS Fe-14Cr-1W-0.3Ti-0.3Y2O3 alloy obtained by powder metallurgy. The powder was sintered for 1 h at 1100 °C in a soft steel can and compacted by Hot Uni-axial Pressing (HUP) under 900 MPa within less than 5 s before air cooling. The HUPped material microstructure is prospected to determine relative density as well as microstructure and nano-precipitation. The HUP, which mimics the early stage of hot extrusion (HE), produces a fully dense metallurgical state. The HUPped microstructure is shown to be rather similar to the one obtained by HIPping for equivalent dwell time at high temperature. In both cases heterogeneous grain size microstructure was obtained. It is shown that the bigger grains come from static recrystallization occurring during the dwell time in furnace. Compared to HIP, the effect of the HUP is mainly to introduce intra-granular misorientations within these large recrystallized grains. During Hot Unidirectional Pressing the initially loose powder is fully consolidated. The relative density is rather similar to the HE and HIP process. Even with a uni-axial loading the HUPed material is homogeneous and does not presents any gradients of hardness. The obtained microstructure for the HUPed shows a bimodal grain size distribution and precipitates strings at grain boundaries. This material can be compared to HIP of similar composition grades [10]. Large grains are issued from an incomplete static recrystallization. Precipitation of nano-clusters is very similar for HUPed and HE materials. Nanometer scale precipitates are observed both within the large and small grains. One of the effects of the HUP compared to pure heat treatment is that the large grains that recrystallized during the early stages of the heat treatment present significant internal crystallographic misorientations. This is due to the plastic strain generated by the rapid compaction during HUP consolidation process.

  9. Microstructural characterization of a new mechanically alloyed Ni-base ODS superalloy powder

    SciTech Connect

    Seyyed Aghamiri, S.M.; Shahverdi, H.R.; Ukai, S.; Oono, N.; Taya, K.; Miura, S.; Hayashi, S.; Okuda, T.

    2015-02-15

    The microstructure of a new Ni-base oxide dispersion strengthened superalloy powder was studied for high temperature gas turbine applications after the mechanical alloying process. In this study, an atomized powder with a composition similar to the CMSX-10 superalloy was mechanically alloyed with yttria and Hf powders. The mechanically alloyed powder included only the supersaturated solid solution γ phase without γ′ and yttria provided by severe plastic deformation, while after the 3-step aging, the γ′ phase was precipitated due to the partitioning of Al and Ta to the γ′ and Co, Cr, Re, W, and Mo to the γ phase. Mechanical alloying modified the morphology of γ′ to the new coherent γ–γ′ nanoscale lamellar structure to minimize the elastic strain energy of the precipitation, which yielded a low lattice misfit of 0.16% at high temperature. The γ′ lamellae aligned preferentially along the elastically soft [100] direction. Also, the precipitated oxide particles were refined in the γ phase by adding Hf from large incoherent YAlO{sub 3} to fine semi-coherent Y{sub 2}Hf{sub 2}O{sub 7} oxide particles with the average size of 7 nm and low interparticle spacing of 76 nm. - Highlights: • A new Ni-base ODS superalloy powder was produced by mechanical alloying. • The nanoscale γ–γ′ lamellar structure was precipitated after the aging treatment. • Fine semi-coherent Y{sub 2}Hf{sub 2}O{sub 7} oxide particles were precipitated by addition of Hf.

  10. Influence of hot rolling and high speed hydrostatic extrusion on the microstructure and mechanical properties of an ODS RAF steel

    NASA Astrophysics Data System (ADS)

    Oksiuta, Z.; Lewandowska, M.; Kurzydlowski, K. J.; Baluc, N.

    2011-02-01

    An argon gas atomized, pre-alloyed Fe-14Cr-2W-0.3Ti (wt.%) reduced activation ferritic (RAF) steel powder was mechanically alloyed with 0.3wt.% Y 2O 3 nano-particles in an attritor ball mill and consolidated by hot isostatic pressing at 1150 °C under a pressure of 200 MPa for 3 h. In the aim to improve its mechanical properties the ODS steel was then submitted to a thermo-mechanical treatment (TMT): hot rolling (HR) at 850 °C or high speed hydrostatic extrusion (HSHE) at 900 °C, followed by heat treatment (HT). Transmission electron microscopy (TEM) observations of the ODS alloys after TMT and heat treatment revealed the presence of elongated grains in the longitudinal direction, with an average width of 8 μm and an average length of 75 μm, and equiaxed grains, a few microns in diameter, in the transverse direction. Two populations of oxide particles were observed by TEM: large Ti-Al-O particles, up to 250 nm in diameter, usually located at the grain boundaries and small Y-Ti-O nanoclusters, about 2.5 nm in diameter, uniformly distributed in the matrix. Charpy impact tests revealed that the HSHE material exhibits a larger upper shelf energy (5.8 J) than the HR material (2.9 J). The ductile-to-brittle transition temperature of both alloys is relatively high, in the range of 55-72 °C. Tensile mechanical properties of both ODS alloys were found satisfactory over the full range of investigated temperatures (23-750 °C). The HSHE material exhibits better tensile strength and ductility than the HR material. These results indicate that HSHE can be considered as a promising TMT method for improving the mechanical properties of ODS RAF steels.

  11. Dynamics of the reactions of O(1D) with CD3OH and CH3OD studied with time-resolved Fourier-transform IR spectroscopy

    NASA Astrophysics Data System (ADS)

    Huang, Chong-Kai; Xu, Zhen-Feng; Nakajima, Masakazu; Nguyen, Hue M. T.; Lin, M. C.; Tsuchiya, Soji; Lee, Yuan-Pern

    2012-10-01

    We investigated the reactivity of O(1D) towards two types of hydrogen atoms in CH3OH. The reaction was initiated on irradiation of a flowing mixture of O3 and CD3OH or CH3OD at 248 nm. Relative vibration-rotational populations of OH and OD (1 ≤ v ≤ 4) states were determined from their infrared emission recorded with a step-scan time-resolved Fourier-transform spectrometer. In O(1D) + CD3OH, the rotational distribution of OD is nearly Boltzmann, whereas that of OH is bimodal; the product ratio [OH]/[OD] is 1.56 ± 0.36. In O(1D) + CH3OD, the rotational distribution of OH is nearly Boltzmann, whereas that of OD is bimodal; the product ratio [OH]/[OD] is 0.59 ± 0.14. Quantum-chemical calculations of the potential energy and microcanonical rate coefficients of various channels indicate that the abstraction channels are unimportant and O(1D) inserts into the C-H and O-H bonds of CH3OH to form HOCH2OH and CH3OOH, respectively. The observed three channels of OH are consistent with those produced via decomposition of the newly formed OH or the original OH moiety in HOCH2OH or decomposition of CH3OOH. The former decomposition channel of HOCH2OH produces vibrationally more excited OH because of incomplete intramolecular vibrational relaxation, and decomposition of CH3COOH produces OH with greater rotational excitation, likely due to a large torque angle during dissociation. The predicted [OH]/[OD] ratios are 1.31 and 0.61 for O(1D) + CD3OH and CH3OD, respectively, at collision energy of 26 kJ mol-1, in satisfactory agreement with the experimental results. These predicted product ratios vary weakly with collision energy.

  12. Laser apparatus

    NASA Technical Reports Server (NTRS)

    Koepf, G. A. (Inventor)

    1979-01-01

    A laser apparatus having a pump laser device for producing pump laser energy upon being excited is disclosed. The pump laser device has a resonating cavity for oscillating and amplifying the pump laser energy. A source laser device is used for producing source laser energy upon being excited by the pump laser energy. The source laser device has a resonating cavity for oscillating and amplifying the source laser energy. The source laser's resonating cavity is coupled within a portion of the pump laser's resonating cavity.

  13. Microstructure of HIPed and SPSed 9Cr-ODS steel and its effect on helium bubble formation

    NASA Astrophysics Data System (ADS)

    Lu, Chenyang; Lu, Zheng; Xie, Rui; Liu, Chunming; Wang, Lumin

    2016-06-01

    Two 9Cr-ODS steels with the same nominal composition were consolidated by hot isostatic pressing (HIP, named COS-1) and spark plasma sintering (SPS, named COS-2). Helium ions were implanted into COS-1, COS-2 and non-ODS Eurofer 97 steels up at 673 K. Microstructures before and after helium ion implantations were carefully characterized. The results show a bimodal grain size distribution in COS-2 and a more uniform grain size distribution in COS-1. Nanoscale clusters of GP-zone type Y-Ti-O and Y2Ti2O7 pyrochlore as well as large spinel Mn(Ti)Cr2O4 particles are all observed in the two ODS steels. The Y-Ti-enriched nano-oxides in COS-1 exhibit higher number density and smaller size than in COS-2. The Y-Ti-enriched nano-oxides in fine grains of COS-2 show higher number density and smaller size than that in coarse grains of COS-2. Nano-oxides effectively trap helium atoms and lead to the formation of high density and ultra-fine helium bubbles.

  14. Fe-Cr-Mo based ODS alloys via spark plasma sintering: A combinational characterization study by TEM and APT

    SciTech Connect

    Y. Q. Wu; K. N. Allahar; J. Burns; B. Jacques; I Charit; D. P. Butt; J. I. Cole

    2013-08-01

    Nanoscale oxides play an important role in oxide dispersion strengthened (ODS) alloys for improved high temperature creep resistance and enhanced radiation damage tolerance. In this study, transmission electron microscopy (TEM) and atom probe tomography (APT) were combined to investigate two novel Fe-16Cr-3Mo (wt.%) based ODS alloys. Spark plasma sintering (SPS) was used to consolidate the ODS alloys from powders that were milled with 0.5 wt.% Y2O3 powder only or with Y2O3 powder and 1 wt.% Ti. TEM characterization revealed that both alloys have a bimodal structure of nanometer-size (~ 100 – 500 nm) and micron-size grains with nanostructured oxide precipitates formed along and close to grain boundaries with diameters ranging from five to tens of nanometers. APT provides further quantitative analyses of the oxide precipitates, and also reveals Mo segregation at grain boundaries next to oxide precipitates. The alloys with and without Ti are compared based on their microstructures.

  15. Influence of microstructure on impact properties of 9-18%Cr ODS steels for fusion/fission applications

    NASA Astrophysics Data System (ADS)

    Hadraba, H.; Fournier, B.; Stratil, L.; Malaplate, J.; Rouffié, A.-L.; Wident, P.; Ziolek, L.; Béchade, J.-L.

    2011-04-01

    The paper describes the influence of the microstructure (coming from the extrusion shape, the chemical composition and the thermo-mechanical treatments) of (9-18%)Cr-W-Ti-Y 2O 3 ODS steels on their impact fracture properties. The extrusion shape plays a major role on the impact properties, materials extruded as a rod present a higher upper shelf energy (USE) and a lower ductile to brittle transition temperature (DBTT) compared to materials extruded as plates. The DBTT for the non-recrystallized 14%Cr ferritic steels was shifted towards higher temperatures compared to the 9%Cr tempered ferritic-martensitic steel. Increasing the W and Ti content in 9%Cr tempered ferritic-martensitic ODS steel leads to a USE and a DBTT shifted towards higher energies and higher temperatures respectively. Increasing the yttria content leads to a drop of the impact energy and a shift of the DBTT of ferritic ODS steel towards higher temperatures. The present study highlights extensive splitting of the fracture surfaces and a dependency of the impact energy on the fracture plane orientation according to the microstructure anisotropy.

  16. Effect of heat treatment on microstructure and hardness of Eurofer 97, Eurofer ODS and T92 steels

    NASA Astrophysics Data System (ADS)

    Lu, Z.; Faulkner, R. G.; Riddle, N.; Martino, F. D.; Yang, K.

    2009-04-01

    Eurofer ODS steel is a potential candidate for fusion reactor application due to its excellent swelling resistance, low thermal expansion coefficient and high temperature properties. One of the main issues is that high fluence neutron irradiation induces a significant increase of ductile-to-brittle transition temperature (DBTT) at temperatures below 400 °C which restricts its application. The aim of this study is to explore the methods to lower the initial DBTT of Eurofer ODS steel by heat treatment optimization. Two heats of Eurofer ODS steels with different C contents are heat-treated at different normalizing temperatures, cooling rates and tempering conditions, and are compared with Eurofer 97 and T92 steels heat-treated with similar conditions. The microstructure is characterized by optical microscopy, FEG-TEM and OIM-EBSD techniques. The effect of normalization, cooling rate and temper on grain size, precipitation, grain boundary misorientation and hardness are investigated. The influences of these properties on DBTT are discussed.

  17. Suppression effect of nano-sized oxide particles on helium irradiation hardening in F82H-ODS steel

    NASA Astrophysics Data System (ADS)

    Chen, S.; Wang, Y.; Tadaki, K.; Hashimoto, N.; Ohnuki, S.

    2014-12-01

    Helium implantation was performed to investigate irradiation hardening in ferritic/martensitic steels. Depth dependence of nano-hardness was obtained using a Berkovich nano-indenter, and then nano-hardness was extracted from Nix-Gao model. The correlation between irradiation hardening and the concentration 500-2000 appm of helium was plotted. Nano-hardness increases as a function of helium concentration. F82H-ODS with a higher nano-hardness provides a lower irradiation hardening than F82H-IEA. Cross-sectional transmission electron microscopy (XTEM) revealed that cavities with a uniform distribution were formed after helium implantation at 2000 appm helium concentration, showing a mean size of 1.1 nm with an average number density of 4.9 × 1023 m-3 in F82H-IEA and 1.3 nm with 7.4 × 1023 m-3 in F82H-ODS. Orowan model was applied to evaluate the hardening from dispersed cavities. The significant difference of hardening between calculation and nano-indentation result of F82H-ODS indicates that oxide particles may shield the hardening effect from cavities because of the complex multi-interaction.

  18. Time-Resolved Frequency Comb Spectroscopy for Studying the Kinetics and Branching Ratio of OD+CO

    NASA Astrophysics Data System (ADS)

    Bui, Thinh Quoc; Bjork, Bryce J.; Heckl, Oliver H.; Changala, Bryan; Spaun, Ben; Okumura, Mitchio; Ye, Jun

    2016-06-01

    The chemical kinetics of the OH+CO reaction plays important roles in combustion and atmospheric processes. OH+CO has two product channels, H+CO_2 and the stabilized HOCO intermediate, with a branching ratio that is highly pressure dependent. Therefore, establishing an accurate kinetic model for this chemical system requires knowledge of the reaction rates and product yields, and the lifetimes of all molecules along a particular reaction pathway. We report the application of time-resolved frequency comb spectroscopy (TRFCS) in the mid-infrared (3.7 μm) spectral region to address the complex reaction kinetics of OD+CO at room temperature. We use the deuterated forms to avoid atmospheric water interference. This technique allows us to detect the lowest energy conformer trans-DOCO intermediate with high time-resolution and sensitivity while also permitting the direct determination of rotational state distributions of all relevant molecules. We simultaneously observe the time-dependent concentrations of trans-DOCO, OD, and D_2O which are used in conjunction with kinetics modeling to obtain the pressure- and collision partner-dependent branching ratio of OD+CO.

  19. Measurement of oxygen saturation in small retinal vessels with adaptive optics confocal scanning laser ophthalmoscope.

    PubMed

    Li, Hao; Lu, Jing; Shi, Guohua; Zhang, Yudong

    2011-11-01

    We have used an adaptive optics confocal scanning laser ophthalmoscope to assess oxygen saturation in small retinal vessels. Images of the vessels with a diameter smaller than 50 μm are recorded at oxygen sensitive and isosbestic wavelengths (680 and 796 nm, respectively). The vessel optical densities (ODs) are determined by a computer algorithm. Then, OD ratios (ODRs), which are inversely proportional to oxygen saturation, are calculated. The results show that arterial ODRs are significantly smaller than venous ODRs, indicating that oxygen saturation in the artery is higher than that in the vein. To the best of our knowledge, this is the first noninvasive measurement of oxygen saturation in small retinal vessels.

  20. Accumulation and annealing of radiation defects under low-temperature electron and neutron irradiation of ODS steel and Fe-Cr alloys

    NASA Astrophysics Data System (ADS)

    Arbuzov, V. L.; Goshchitskii, B. N.; Sagaradze, V. V.; Danilov, S. E.; Kar'kin, A. E.

    2010-10-01

    The processes of accumulation and annealing of radiation defects at low-temperature (77 K) electron and neutron irradiation and their effect on the physicomechanical properties of Fe-Cr alloys and oxide dispersion strengthened (ODS) steel have been studied. It has been shown that the behavior of radiation defects in ODS steel and Fe-Cr alloys is qualitatively similar. Above 250 K, radiation-induced processes of the solid solution decomposition become conspicuous. These processes are much less pronounced in ODS steel because of specific features of its microstructure. Processes related to the overlapping of displacement cascades under neutron irradiation have been considered. It has been shown that, in this case, it is the increase in the size of vacancy clusters, rather than the growth of their concentration, that is prevailing. Possible mechanisms of the radiation hardening of the ODS steel and the Fe-13Cr alloy upon irradiation and subsequent annealing have been discussed.

  1. Oxidation behavior of ferritic-martensitic and ODS steels in supercritical water

    NASA Astrophysics Data System (ADS)

    Bischoff, Jeremy

    Ferritic-martensitic and ODS alloys are primary candidates for application as cladding and structural material in Generation IV nuclear power plants, especially the supercritical water reactor. One of the main in-service degradation mechanisms for these alloys is uniform corrosion, thus this project focuses on understanding the oxidation behavior of these alloys in the supercritical water (SCW) environment. This understanding is acquired through the analysis of the oxide microstructure using microbeam synchrotron radiation diffraction and fluorescence associated with electron microscopy (both SEM and TEM). The microbeam synchrotron radiation diffraction and fluorescence technique provides unique microstructural data of the oxide. This technique simultaneously probes elemental and phase information step by step with a sub-micron spatial resolution throughout the oxide layers. Thus we were able to locate specific phases, such as Cr2O3, at specific locations in the oxide layer, mainly the interfaces. The electron microscopy complemented this analysis by imaging the oxide layers, to yield detailed information on the oxide morphology. All the alloys studied exhibited the same three-layer structure with an outer layer containing only Fe3O4, an inner layer containing a mixture of Fe3O4 and FeCr2O 4, and a diffusion layer containing a mixture of chromium-rich precipitates (Cr2O3 and FeCr2O4) and metal grains. By analyzing samples with various exposure times, we were able to follow the evolution of the oxide microstructure with exposure time. To obtain the corroded samples, several corrosion experiments were performed: some in supercritical water (at 500°C and 600°C) and one experiment in 500°C steam. The test in steam was undertaken to obtain more data points in the kinetic curves, because we thought the corrosion in steam and supercritical water at the same temperature would result in similar kinetics. This turned out not to be the case and the samples in supercritical

  2. Dissociative photoionization mechanism of methanol isotopologues (CH3OH, CD3OH, CH3OD and CD3OD) by iPEPICO: energetics, statistical and non-statistical kinetics and isotope effects.

    PubMed

    Borkar, Sampada; Sztáray, Bálint; Bodi, Andras

    2011-07-28

    The dissociative photoionization of energy selected methanol isotopologue (CH(3)OH, CD(3)OH, CH(3)OD and CD(3)OD) cations was investigated using imaging Photoelectron Photoion Coincidence (iPEPICO) spectroscopy. The first dissociation is an H/D-atom loss from the carbon, also confirmed by partial deuteration. Somewhat above 12 eV, a parallel H(2)-loss channel weakly asserts itself. At photon energies above 15 eV, in a consecutive hydrogen molecule loss to the first H-atom loss, the formation of CHO(+)/CDO(+) dominates as opposed to COH(+)/COD(+) formation. We see little evidence for H-atom scrambling in these processes. In the photon energy range corresponding to the B[combining tilde] and C[combining tilde] ion states, a hydroxyl radical loss appears yielding CH(3)(+)/CD(3)(+). Based on the branching ratios, statistical considerations and ab initio calculations, this process is confirmed to take place on the first electronically excited Ã(2)A' ion state. Uncharacteristically, internal conversion is outcompeted by unimolecular dissociation due to the apparently weak Renner-Teller-like coupling between the X[combining tilde] and the à ion states. The experimental 0 K appearance energies of the ions CH(2)OH(+), CD(2)OH(+), CH(2)OD(+) and CD(2)OD(+) are measured to be 11.646 ± 0.003 eV, 11.739 ± 0.003 eV, 11.642 ± 0.003 eV and 11.737 ± 0.003 eV, respectively. The E(0)(CH(2)OH(+)) = 11.6454 ± 0.0017 eV was obtained based on the independently measured isotopologue results and calculated zero point effects. The 0 K heat of formation of CH(2)OH(+), protonated formaldehyde, was determined to be 717.7 ± 0.7 kJ mol(-1). This yields a 0 K heat of formation of CH(2)OH of -11.1 ± 0.9 kJ mol(-1) and an experimental 298 K proton affinity of formaldehyde of 711.6 ± 0.8 kJ mol(-1). The reverse barrier to homonuclear H(2)-loss from CH(3)OH(+) is determined to be 36 kJ mol(-1), whereas for heteronuclear H(2)-loss from CH(2)OH(+) it is found to be 210 kJ mol(-1).

  3. A Real-Time Orbit Determination Method for Smooth Transition from Optical Tracking to Laser Ranging of Debris

    PubMed Central

    Li, Bin; Sang, Jizhang; Zhang, Zhongping

    2016-01-01

    A critical requirement to achieve high efficiency of debris laser tracking is to have sufficiently accurate orbit predictions (OP) in both the pointing direction (better than 20 arc seconds) and distance from the tracking station to the debris objects, with the former more important than the latter because of the narrow laser beam. When the two line element (TLE) is used to provide the orbit predictions, the resultant pointing errors are usually on the order of tens to hundreds of arc seconds. In practice, therefore, angular observations of debris objects are first collected using an optical tracking sensor, and then used to guide the laser beam pointing to the objects. The manual guidance may cause interrupts to the laser tracking, and consequently loss of valuable laser tracking data. This paper presents a real-time orbit determination (OD) and prediction method to realize smooth and efficient debris laser tracking. The method uses TLE-computed positions and angles over a short-arc of less than 2 min as observations in an OD process where simplified force models are considered. After the OD convergence, the OP is performed from the last observation epoch to the end of the tracking pass. Simulation and real tracking data processing results show that the pointing prediction errors are usually less than 10″, and the distance errors less than 100 m, therefore, the prediction accuracy is sufficient for the blind laser tracking. PMID:27347958

  4. Phase Stability under Irradiation of Precipitates and Solid Solutions in Model ALloys and in ODS Alloys Relevant for Gen IV

    SciTech Connect

    Arthur T. Motta; Robert C. Birtcher

    2007-10-17

    The overall objective of this program is to investigate the irradiation-altered phase stability of oxide precipitates in ODS steels and of model alloy solid solutions of associated systems. This information can be used to determine whether the favorable mechanical propertiies of these steels are maintained under irradiation, thus addressing one of the main materials research issues for this class of steels as identified by the GenIV working groups. The research program will also create fundamental understanding of the irradiation precipitation/dissolution problem by studying a "model" system in which the variables can be controlled and their effects understood individually.

  5. Mechanical and Microstructure Study of Nickel-Based ODS Alloys Processed by Mechano-Chemical Bonding and Ball Milling

    NASA Astrophysics Data System (ADS)

    Amare, Belachew N.

    Due to the need to increase the efficiency of modern power plants, land-based gas turbines are designed to operate at high temperature creating harsh environments for structural materials. The elevated turbine inlet temperature directly affects the materials at the hottest sections, which includes combustion chamber, blades, and vanes. Therefore, the hottest sections should satisfy a number of material requirements such as high creep strength, ductility at low temperature, high temperature oxidation and corrosion resistance. Such requirements are nowadays satisfied by implementing superalloys coated by high temperature thermal barrier coating (TBC) systems to protect from high operating temperature required to obtain an increased efficiency. Oxide dispersive strengthened (ODS) alloys are being considered due to their high temperature creep strength, good oxidation and corrosion resistance for high temperature applications in advanced power plants. These alloys operating at high temperature are subjected to different loading systems such as thermal, mechanical, and thermo-mechanical combined loads at operation. Thus, it is critical to study the high temperature mechanical and microstructure properties of such alloys for their structural integrity. The primary objective of this research work is to investigate the mechanical and microstructure properties of nickel-based ODS alloys produced by combined mechano-chemical bonding (MCB) and ball milling subjected to high temperature oxidation, which are expected to be applied for high temperature turbine coating with micro-channel cooling system. Stiffness response and microstructure evaluation of such alloy systems was studied along with their oxidation mechanism and structural integrity through thermal cyclic exposure. Another objective is to analyze the heat transfer of ODS alloy coatings with micro-channel cooling system using finite element analysis (FEA) to determine their feasibility as a stand-alone structural

  6. Cyclic oxidation of coated Oxide Dispersion Strengthened (ODS) alloys in high velocity gas streams at 1100 deg C

    NASA Technical Reports Server (NTRS)

    Gedwill, M. A.

    1978-01-01

    Several overlay coatings on ODS NiCrAl's were tested in Mach 1 and Mach 0.3 burner rigs to examine oxidation and thermal fatigue performance. The coatings were applied by various methods. Based on weight change, macroscopic, and metallographic observations in Mach 1 tests Nascoat 70 on TD-NiCrAl exhibited the best oxidation resistance. In Mach 0.3 tests PWA 267 and ATD-1, about equally, were the best coatings on YD-NiCrAl (Nascoat 70 was not tested in Mach 0.3 rigs).

  7. Laser-Stimulated Surface Processes and Heterogeneous Catalysis.

    DTIC Science & Technology

    1980-11-01

    A07-AC94 337 ROCHESTER UNIV NY DEPT OF CI4EMISTRY F/* 7/5 LASER-STINULATED SURFACE PROCESSES AND HETEROGENEOUS CATALYSIS . (Ul UN, NOV 80 J LIN N00014...Contra" W014-80-C-OD472 Task No. NR 056-749 __ TECHNICAL REPORT NO. 8 I Laser-Stimulated Surface Processes) *.and Heterogeneous Catalysis .) by / J...Repor HETEROGENEOUS CATALYSIS InterimTechnical_______ 6. PERFORMING ORG. REPORT NUMBER 7. AUTHOR(*) S. CONTRACT OR GRANT NUMSER(.) Jui-teng Lin N00014

  8. Post-Irradiation Fracture Toughness of Unalloyed Molybdenum, ODS molybdenum, and TZM molybdenum following irradiation at 244C to 507C

    SciTech Connect

    Cockeram, Brian V; Byun, Thak Sang; Leonard, Keith J; Snead, Lance Lewis

    2013-01-01

    Commercially available unalloyed molybdenum (Low Carbon Arc Cast (LCAC)), Oxide Dispersion Strengthened (ODS) molybdenum, and TZM molybdenum were neutron irradiated at temperatures of nominally 244 C, 407 C, and 509 C to neutron fluences between 1.0 to 4.6x1025 n/m2 (E>0.1 MeV). Post-irradiation fracture toughness testing was performed. All alloys exhibited a Ductile to Brittle Transition Temperature that was defined to occur at 30 4 MPa-m1/2. The highest post-irradiated fracture toughness values (26-107 MPa-m1/2) and lowest DBTT (100-150 C) was observed for ODS molybdenum in the L-T orientation. The finer grain size for ODS molybdenum results in fine laminates that improve the ductile laminate toughening. The results for ODS molybdenum are anisotropic with lower post-irradiated toughness values (20-30 MPa-m1/2) and higher DBTT (450-600 C) in the T-L orientation. The results for T-L ODS molybdenum are consistent or slightly better than those for LCAC molybdenum (21-71 MPa-m1/2 and 450-800 C DBTT). The fracture toughness values measured for LCAC and T-L ODS molybdenum at temperatures below the DBTT were determined to be 8-18 MPa-m1/2. Lower non-irradiated fracture toughness values were measured for TZM molybdenum that are attributed to the large carbide precipitates serving as preferential fracture initiation sites. The role of microstructure and grain size on post-irradiated fracture toughness was evaluated by comparing the results for LCAC molybdenum and ODS molybdenum.

  9. Modulation of human Nav1.7 channel gating by synthetic α-scorpion toxin OD1 and its analogs

    PubMed Central

    Motin, Leonid; Durek, Thomas; Adams, David J.

    2016-01-01

    ABSTRACT Nine different voltage-gated sodium channel isoforms are responsible for inducing and propagating action potentials in the mammalian nervous system. The Nav1.7 channel isoform plays an important role in conducting nociceptive signals. Specific mutations of this isoform may impair gating behavior of the channel resulting in several pain syndromes. In addition to channel mutations, similar or opposite changes in gating may be produced by spider and scorpion toxins binding to different parts of the voltage-gated sodium channel. In the present study, we analyzed the effects of the α-scorpion toxin OD1 and 2 synthetic toxin analogs on the gating properties of the Nav1.7 sodium channel. All toxins potently inhibited channel inactivation, however, both toxin analogs showed substantially increased potency by more than one order of magnitude when compared with that of wild-type OD1. The decay phase of the whole-cell Na+ current was substantially slower in the presence of toxins than in their absence. Single-channel recordings in the presence of the toxins revealed that Na+ current inactivation slowed due to prolonged flickering of the channel between open and closed states. Our findings support the voltage-sensor trapping model of α-scorpion toxin action, in which the toxin prevents a conformational change in the domain IV voltage sensor that normally leads to fast channel inactivation. PMID:26646206

  10. Formation of nano-size oxide particles and δ-ferrite at elevated temperature in 9Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Kim, Sawoong; Ohtsuka, Satoshi; Kaito, Takeji; Yamashita, Shinichiro; Inoue, Masaki; Asayama, Tai; Shobu, Takahisa

    2011-10-01

    Excellent high-temperature strength and resistance to radiation damage of 9Cr Oxide Dispersion Strengthened (9Cr-ODS) martensitic steel have been realized by nano-size Y-Ti-O complex oxide particles dispersed in the matrix and a dual phase structure consisting of α'-martensite and δ-ferrite. These are produced by mechanically alloying Fe-Cr-Ti powders with Y 2O 3 followed by a hot-consolidation process. Therefore, the hot-consolidation process is the issue to be clarified for the formation of nano-size oxide particle and δ-ferrite. The temperature dependence of the formation and development of nano-size oxide particles and δ-ferrite using mechanically alloyed 9Cr-ODS raw powder were investigated applying X-ray Diffraction and Small Angle X-ray Scattering measurement at SPring-8 and by Electron Probe Micro Analysis. In situ heating measurement techniques with XRD and SAXS enabled real-time observation of phase transformations and allowed correlation between formation of nano-size oxide particle and δ-ferrite.

  11. High temperature deformation mechanism of 15CrODS ferritic steels at cold-rolled and recrystallized conditions

    NASA Astrophysics Data System (ADS)

    Sugino, Yoshito; Ukai, Shigeharu; Oono, Naoko; Hayashi, Shigenari; Kaito, Takeji; Ohtsuka, Satoshi; Masuda, Hiroshi; Taniguchi, Satoshi; Sato, Eiichi

    2015-11-01

    The ODS ferritic steels realize potentially higher operating temperature due to structural stability by the dispersed nano-size oxide particles. The deformation process and mechanism of 15CrODS ferritic steels were investigated at 1073 K and 1173 K for the cold-rolled and recrystallized conditions. Tensile and creep tests were conducted at the stress in parallel (LD) and perpendicular (TD) directions to the grain boundaries. Strain rate varied from 10-1 to 10-9 s-1. For the LD specimens, deformation in the cold rolled and recrystallized conditions is reinforced by finely dispersed oxide particles. The dominant deformation process for the recrystallized TD specimen is controlled through the grain boundary sliding and stress accommodation via diffusional creep at temperature of 1173 K and lower strain rate less than 10-4 s-1. The grain boundary sliding couldn't be rate-controlling process at 1073 K for the as-cold rolled TD specimen, where a dynamic recovery of the dislocation produced by cold-rolling is related to the deformation process.

  12. Modulation of human Nav1.7 channel gating by synthetic α-scorpion toxin OD1 and its analogs.

    PubMed

    Motin, Leonid; Durek, Thomas; Adams, David J

    2016-01-01

    Nine different voltage-gated sodium channel isoforms are responsible for inducing and propagating action potentials in the mammalian nervous system. The Nav1.7 channel isoform plays an important role in conducting nociceptive signals. Specific mutations of this isoform may impair gating behavior of the channel resulting in several pain syndromes. In addition to channel mutations, similar or opposite changes in gating may be produced by spider and scorpion toxins binding to different parts of the voltage-gated sodium channel. In the present study, we analyzed the effects of the α-scorpion toxin OD1 and 2 synthetic toxin analogs on the gating properties of the Nav1.7 sodium channel. All toxins potently inhibited channel inactivation, however, both toxin analogs showed substantially increased potency by more than one order of magnitude when compared with that of wild-type OD1. The decay phase of the whole-cell Na(+) current was substantially slower in the presence of toxins than in their absence. Single-channel recordings in the presence of the toxins revealed that Na(+) current inactivation slowed due to prolonged flickering of the channel between open and closed states. Our findings support the voltage-sensor trapping model of α-scorpion toxin action, in which the toxin prevents a conformational change in the domain IV voltage sensor that normally leads to fast channel inactivation.

  13. Impact of the use of the ferritic/martensitic ODS steels cladding on the fuel reprocessing PUREX process

    NASA Astrophysics Data System (ADS)

    Gwinner, B.; Auroy, M.; Mas, D.; Saint-Jevin, A.; Pasquier-Tilliette, S.

    2012-09-01

    Some ferritic/martensitic oxide dispersed strengthened (F/M ODS) steels are presently developed at CEA for the fuel cladding of the next generation of sodium fast nuclear reactors. The objective of this work is to study if this change of cladding could have any consequences on the spent fuel reprocessing PUREX process. During the fuel dissolution stage the cladding can actually be corroded by nitric acid. But some process specifications impose not to exceed a limit concentration of the corrosion products such as iron and chromium in the dissolution medium. For that purpose the corrosion behavior of these F/M ODS steels is studied in hot and concentrated nitric acid. The influence of some metallurgical parameters such as the chromium content, the elaboration process and the presence of the yttrium oxides is first discussed. The influence of environmental parameters such as the nitric acid concentration, the temperature and the presence of oxidizing species coming from the fuel is then analyzed. The corrosion rate is characterized by mass loss measurements and electrochemical tests. Analyses of the corroded surface are carried out by X-ray photoelectron spectroscopy.

  14. QCT dynamics study of OH/OD + GeH4 reactions. The problem of water bending excitation.

    PubMed

    Espinosa-Garcia, J; Corchado, J C

    2017-01-04

    Using a full-dimensional analytical potential energy surface describing the OH/OD + GeH4 hydrogen abstraction reactions (J. Espinosa-Garcia, C. Rangel and J. C. Corchado, Phys. Chem. Chem. Phys., 2016, 18, 16941), quasi-classical trajectory calculations were performed at 298 K to simulate the scarce experimental data at this temperature. This system presents wells in the entrance and exit channels, influencing product angular distribution, which is practically isotropic. Moreover, isotopic effects were not observed. It was found that the GeH3 co-product presents little internal energy (11% of the total available energy), although not negligible, and that the water product receives the major part of the available energy, mainly in the newly formed OH bond, while the initial OH/OD reactant bond acts as a spectator mode. These results reproduce the experimental evidence, the larger discrepancy being in the water bending vibrational distribution, which is broader in the experiment. Several factors were analyzed to account for this discrepancy, and it was concluded that the zero-point energy violation per mode is the main, but not the only, cause.

  15. Texture analysis of oxide dispersion strengthened (ODS) Fe alloys by X-ray and neutron diffraction

    NASA Astrophysics Data System (ADS)

    Béchade, J. L.; Mathon, M. H.; Branger, V.; Réglé, H.; Alamo, A.

    2002-07-01

    The ferritic ODS alloys studied were obtained by mechanical alloying. This strengthening method is very attractive, in particular for nuclear applications. In order to ensure the alloy a good compromise between mechanical resistance and ductility at high temperatures, it is necessary to control the microstructure and in particular the evolution during the recrystallization. First, a preliminary study, performed by X ray diffraction and optical microscopy, shows several grain growth mechanisms ; in particular, the “abnormal” grain growth mechanism which conducts to a large grain size [1], [2]. After annealing (3600s at 1470^{circ}C), the 30% cold-worked (swaging) alloys exhibit an heterogeneous microstructure with a large grains size ( 200 to 500 μm) in the heart and near the surface of the material when the intermediate zone is inhabited by small grains ( 1 μm). Fora higher cold-work level (60%), large size grains are only present in the periphery of the material. On account of the large grain size and strong heterogeneity of the microstructure, texture analysis using laboratory x-ray beam in not well adapted and so we have decided to use neutron beam. The neutron diffraction texture analysis has been performed at the Laboratoire Léon Brillouin on the 6T1 diffractometer on 2 different rods of the alloy (corresponding to the reduction ratios of 30% and 60%). Specific samples have been machined to characterise separately the zones with a different microstructure. After deformation, the alloys exhibit a typical α-fibre texture \\{ hkl \\} <1l0> whatever the area of the sample and the reduction ratio. After recrystallization, a very inhomogeneous texture is evidenced through the thickness of the sample, in particular for the rod deformed with a reduction ratio of 30% : in the heart and in the periphery of the rod, a “single-crystal” type texture is observed; the a fibre remains for the intermediate diameter of the rod. For the rod cold rolled with a

  16. Correlation of microstructure and low cycle fatigue properties for 13.5Cr1.1W0.3Ti ODS steel

    NASA Astrophysics Data System (ADS)

    He, P.; Klimenkov, M.; Möslang, A.; Lindau, R.; Seifert, H. J.

    2014-12-01

    Reduced activation oxide dispersion strengthened (ODS) steels are prospective structural materials for the blanket system and first wall components in Tokamak-type fusion reactors. Under the pulsed operation, these components will be predominantly subjected to cyclic thermal-mechanical loading which leads to inevitable fatigue damage. In this work, strain controlled isothermal fatigue tests were conducted for 13.5Cr1.1W0.3Ti ODS steel at 550 °C. The total strain range varied from 0.54% to 0.9%. After thermomechanical processing, 13.5CrWTi-ODS steel exhibits a remarkable lifetime extension with a factor of 10-20 for strain ranges Δε ⩽ 0.7%. 13.5Cr ODS steel shows no cyclic softening at all during the whole testing process irrespective of the strain range. TEM observations reveal ultrastable grain structure and constant dislocation densities around 1014 m-2, independent of the number of cycles or the applied strain amplitude. The presence of the stabilized ultrafine Y-Ti-O dispersoids enhances the microstructural stability and therefore leads to outstanding fatigue resistance for 13.5Cr1.1W0.3Ti-ODS steel.

  17. Energy-filtered TEM imaging and EELS study of ODS particles and argon-filled cavities in ferritic-martensitic steels.

    PubMed

    Klimiankou, M; Lindau, R; Möslang, A

    2005-01-01

    Oxide-dispersion-strengthened (ODS) ferritic-martensitic steels with yttrium oxide (Y(2)O(3)) have been produced by mechanical alloying and hot isostatic pressing for use as advanced material in fusion power reactors. Argon gas, usually widely used as inert gas during mechanical alloying, was surprisingly detected in the nanodispersion-strengthened materials. Energy-filtered transmission electron microscopy (EFTEM) and electron energy loss spectroscopy (EELS) led to the following results: (i) chemical composition of ODS particles, (ii) voids with typical diameters of 1-6 nm are formed in the matrix, (iii) these voids are filled with Ar gas, and (iv) the high-density nanosized ODS particles serve as trapping centers for the Ar bubbles. The Ar L(3,2) energy loss edge at 245 eV as well as the absorption features of the ODS particle elements were identified in the EELS spectrum. The energy resolution in the EEL spectrum of about 1.0 eV allows to identify the electronic structure of the ODS particles.

  18. Orally active desulfated low molecular weight heparin and deoxycholic acid conjugate, 6ODS-LHbD, suppresses neovascularization and bone destruction in arthritis.

    PubMed

    Hwang, Seung Rim; Seo, Dong-Hyun; Al-Hilal, Taslim A; Jeon, Ok-Cheol; Kang, Jin Hee; Kim, Sung-Hyun; Kim, Han Sung; Chang, Young-Tae; Kang, Young Mo; Yang, Victor C; Byun, Youngro

    2012-11-10

    The regulation of angiogenesis is an interesting area to consider for novel therapeutic approaches to rheumatoid arthritis (RA). Chemically modified heparins have been developed as possible candidates for angiogenesis inhibitor; however, they have a major clinical drawback in exhibiting poor oral bioavailability. Here, orally absorbable O-desulfated low molecular weight heparin (ODS-LMWH) derivatives were newly synthesized by conjugating 2-O- or 6-O-desulfated LMWH with deoxycholic acid (DOCA) or bisDOCA (a dimer of DOCA), and their physicochemical properties, antiangiogenic potency and pharmacokinetic profiles were assessed. After selecting the best candidate among those derivatives, its therapeutic efficacy on arthritis was investigated in a murine collagen antibody-induced arthritis (CAIA) model. ODS-LMWH derivatives significantly inhibited the capillary-like tube formation of human umbilical vein endothelial cells (HUVECs) and basic fibroblast growth factor (bFGF)-induced angiogenesis in the Matrigel plug assay. Among all the compounds, 6ODS-LHbD showed the highest oral bioavailability in rats (19.3%). In the CAIA mouse model, 6ODS-LHbD (10 mg/kg, p.o., S.I.D.) significantly inhibited neovascularization in the joint, the increase of hind-paw thickness, and the structural damage in the bone. Therefore, 6ODS-LHbD would be a promising candidate for an orally active drug for the treatment of RA.

  19. Triplet-extinction coefficients of some laser dyes. 1

    SciTech Connect

    Pavlopoulos, T.G.; Golich, D.J.

    1989-03-01

    For flashlamp-pumped dye lasers, the negative effect of triplet-state losses on laser action efficiency is well known. Oscilloscope traces of laser pulses showed that laser action diminishes much sooner than the flashlamp excitation pulse. This effect was attributed to the buildup of triplet-state dye molecules during the excitation from the flashlamp pulse. Triplet-extinction coefficients epsilon(T) were measured over the laser-action spectral region of Rhodamine 6G; Rhodamine B; Rhodamine 110; Fluorol-7GA; Coumarin 540A; Coumarin 522; Coumarin 1; Coumarin 120; 4,4'-diphenyl stilbene; and 2,7-bis(4-methoxy-phenyl)-9,9-dipropylfluorene. The different lines from an argon-ion cw laser were employed for excitation. McClure's method was used to obtain the triplet extinction coefficients Epsilon(T). The method requires the measurement of triplet optical densities OD(T) as a function of different cw laser-excitation intensities (powers) I(ex). The importance of triplet-state losses on dye-laser efficiency is reviewed. The laser action properties of the laser dyes studied are briefly discussed as they relate to the measured epsilon=(T) values.

  20. Selective laser sintering of MA956 oxide dispersion strengthened steel

    NASA Astrophysics Data System (ADS)

    Hunt, Ryan M.; Kramer, Kevin J.; El-Dasher, Bassem

    2015-09-01

    Oxide Dispersion Strengthened (ODS) steels' qualities of radiation damage resistance and high strength at high temperature make them promising nuclear structural materials. However, the dispersed yttria that gives ODS steel its beneficial qualities are generally compromised during joining processes, making fabrication difficult and expensive. The selective laser sintering process offers a potential path through this barrier by which net-shape parts can feasibly be built via additive manufacturing without fully melting the structure. Rastering a 400 W laser over a 110 μm MA956 ODS steel powder bed, we additively built parts with varying build conditions. Although density was achieved to within 97% of the wrought MA956, ultimate tensile strengths achieved only 65% of the wrought strength. Spectroscopy analysis points to the agglomeration of the yttria nano-particles as a possible explanation for the loss in strength. Further study might benefit from exploration of other parameters such as thinner powder build layers which would require less energy input to achieve sintering while minimizing time above the melting temperature.

  1. Bilateral Symmetry before and Six Months after Aberration-Free™ Correction with the SCHWIND AMARIS TotalTech Laser: Clinical Outcomes

    PubMed Central

    Arbelaez, Maria Clara; Vidal, Camila; Arba-Mosquera, Samuel

    2010-01-01

    Purpose To compare the preoperative and postoperative bilateral symmetry between OD and OS eyes that have undergone femto-LASIK using the Ziemer LDV femtosecond laser system, the SCHWIND AMARIS Excimer Laser and the Aberrationfree™ profiles implemented in the SCHWIND Custom Ablation Manager software. Methods A total of 25 LASIK patients were bilaterally evaluated at the six-month follow-up visit. In all cases standard examinations, pre- and postoperative analysis with corneal wavefront topography (OPTIKON Scout) were performed. Aberration-free™ aspheric treatments were devised using the Custom Ablation Manager software and ablations were performed by means of the SCHWIND AMARIS flying-spot excimer laser system (both SCHWIND eyetech- solutions). In all cases LASIK flaps were created using an LDV femtosecond laser (Ziemer Group). The OD/OS bilateral symmetry was evaluated in terms of corneal wavefront aberration. Results Preoperatively, 11 Zernike terms showed significant bilateral (OS-vs.-OD) symmetry, and only 6 Zernike terms were significantly different. Overall, 23 out of the 25 patients showed significant bilateral symmetry, and only 2 out of 25 patients showed significant differences. None of the aberration metrics changed from pre- to postoperative values by a clinically relevant amount. At the 6-month postoperative visit, 12 Zernike terms showed significant symmetry, and 8 terms were significantly different. Overall, 22 out of 25 patients showed significant bilateral symmetry (OS vs. OD), and only 3 out of 25 patients showed significant differences. Also, this postoperative examination revealed that 6 Zernike terms lost significant OS-vs.-OD symmetry, but 4 Zernike terms gained significant symmetry. Finally, 4 patients lost significant bilaterality, and 2 patients gained significant bilaterality: bilateral symmetry between eyes was better maintained in those patients with a clear preoperative bilateral symmetry. Conclusions Aberration-Free Treatments with

  2. The OD/OH Isotope Ratio in Comets 8P/Tuttle and C/2012 F6 (Lemmon)

    NASA Astrophysics Data System (ADS)

    Rousselot, Philippe; Jehin, Emmanuel; Hutsemekers, Damien; Manfroid, Jean; Decock, Alice; Bockelee-Morvan, Dominique

    2016-10-01

    The determination of isotopic ratios in solar system objects is an important source of information about their origin, especially for comets. Among these ratios the D/H is of particular importance because of its sensitivity to fractionation processes and physical environment, and the abundance of hydrogen in the solar system. The main molecule used to derive this ratio in comets is water. So far, apart water, only HCN has permitted to derive D/H ratio and not only upper limits.Most of the existing determinations of D/H in water molecules have been obtained by spectroscopic observations of water lines in the sub-mm or near infrared range [1,2]. So far only one measurement has been based on OD/OH emission lines radicals in the near-UV [3] and another one on the Lyman-alpha D emission [4]. In situ measurements have also been obtained in comets 1P/Halley and 67P/Churyumov-Gerasimenko using mass spectrometer [5,6,7,8].In this work we have used the OH and OD ultraviolet bands at 310 nm observed with the ESO 8-m Very Large Telescope feeding the Ultraviolet-Visual Echelle Spectrograph (UVES) for measuring the D/H ratio in comets 8P/Tuttle and C/2012 F6 (Lemmon). The OH and OD being the photodissociation products of H2O and HDO such observations allow to derive D/H ratio for water molecules. This work constitutes an independant determination of the D/H ratios already published for these comets and based on observations performed in the sub-mm and near infrared range of H2O and HDO lines. We present our modeling, data analysis and numerical values obtained for this ratio.[1] D. Bockelée-Morvan et al., 2015, SSR 197, 47-83 [2] N. Biver et al., 2016, A&A 589, id A78, 11p [3] D. Hutsemékers et al., 2008, A&A 490, L31 [4] H.A. Weaver et al., 2008, LPI Contributions 1405, 8216 [5] H. Balsiger, K. Altwegg, J. Geiss, 1995, JGR 100, 5827 [6] P. Eberhardt et al., 1995, A&A 302, 301 [7] R.H. Brown et al., 2012, PSS 60, 166 [8] K. Alwegg et al., 2015, Science 347, article id. 1261952

  3. OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels.

    PubMed

    Jalali, Amir; Bosmans, Frank; Amininasab, Mehriar; Clynen, Elke; Cuypers, Eva; Zaremirakabadi, Abbas; Sarbolouki, Mohammad-Nabi; Schoofs, Liliane; Vatanpour, Hossein; Tytgat, Jan

    2005-08-01

    In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Na(v)1.2/beta1, Na(v)1.5/beta1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC50 = 80+/-14 nM) while Na(v)1.2/beta1 still was not affected at concentrations up to 5 microM. Na(v)1.5/beta1 was influenced at micromolar concentrations.

  4. Hot rolling and annealing effects on the microstructure and mechanical properties of ODS austenitic steel fabricated by electron beam selective melting

    NASA Astrophysics Data System (ADS)

    Gao, Rui; Ge, Wen-jun; Miao, Shu; Zhang, Tao; Wang, Xian-ping; Fang, Qian-feng

    2016-03-01

    The grain morphology, nano-oxide particles and mechanical properties of oxide dispersion strengthened (ODS)-316L austenitic steel synthesized by electron beam selective melting (EBSM) technique with different post-working processes, were explored in this study. The ODS-316L austenitic steel with superfine nano-sized oxide particles of 30-40 nm exhibits good tensile strength (412 MPa) and large total elongation (about 51%) due to the pinning effect of uniform distributed oxide particles on dislocations. After hot rolling, the specimen exhibits a higher tensile strength of 482 MPa, but the elongation decreases to 31.8% owing to the introduction of high-density dislocations. The subsequent heat treatment eliminates the grain defects induced by hot rolling and increases the randomly orientated grains, which further improves the strength and ductility of EBSM ODS-316L steel.

  5. Microstructural characterization of oxide dispersion strengthened (ODS) Fe-12Cr-0.5Y2O3 alloy

    NASA Astrophysics Data System (ADS)

    Shamsudin, Farha Mizana; Radiman, Shahidan; Abdullah, Yusof; Hamid, Nasri A.

    2016-11-01

    Oxide dispersion strengthened (ODS) ferritic alloy containing 12wt% Cr and 0.5wt% Y2O3 was prepared by mechanical alloying (MA) method and then compacted into bulk shape. Field emission scanning electron microscopy (FESEM) was performed to characterize the microstructure of milled alloy powder. The fragments and nanoclusters of Y2O3 were observed in this alloy powder. FESEM-EDS mapping on the milled alloy powder reveal the uniformity of the element distribution achieved by the alloy. The Y element is finely dispersed into the alloy matrix and the O element is observed indicating the presence of oxides throughout the alloy sample. The compacted alloy was then heat treated at 1050°C and analyzed by field emission scanning electron microscope (FESEM). The formations of nano-scale Y2O3 were observed after the heat treatment process of alloy indicating the dispersion and incorporation of Y2O3 nanoparticles into the alloy matrix.

  6. Use of neutron and X-ray diffraction to study the precipitation mechanisms of oxides in ODS materials

    NASA Astrophysics Data System (ADS)

    Toualbi, L.; Ratti, M.; André, G.; Onimus, F.; de Carlan, Y.

    2011-10-01

    It is usually accepted that the formation of nano-clusters inside Oxide Dispersion Strengthened (ODS) materials is due to the dissolution of the yttrium oxide during the mechanical alloying and to the precipitation of the nano-oxides during the consolidation process. A study was conducted to follow the dissolution and the re-precipitation of the phases after mechanical alloying and different heat treatments. A Fe-9Cr powder was milled during different milling times with 10 wt.% of yttria and/or titanium in a planetary mill. Using neutron and X-ray diffractions and the Rietveld method, the dissolution and re-precipitation of yttria was investigated. Even with a content of 10 wt.%, the yttria particles disappear during milling to form a structure which can be described as Fe crystallites coexisting with amorphous domains composed of Y and O atoms. After annealing Y and O atoms re-precipitate into the matrix to form yttria crystallites.

  7. Short Communication on "Coarsening of Y-rich oxide particles in 9%Cr-ODS Eurofer steel annealed at 1350 °C"

    NASA Astrophysics Data System (ADS)

    Sandim, M. J. R.; Souza Filho, I. R.; Bredda, E. H.; Kostka, A.; Raabe, D.; Sandim, H. R. Z.

    2017-02-01

    Oxide-dispersion strengthened (ODS) Eurofer steel is targeted for structural applications in future fusion nuclear reactors. Samples were cold rolled down to 80% reduction in thickness and annealed at 1350 °C up to 8 h. The microstructural characterization was performed using Vickers microhardness testing, electron backscatter diffraction, scanning and scanning transmission electron microscopies. Experimental results provide evidence of coarsening of the Y-rich oxide particles in ODS-Eurofer steel annealed at 1350 °C within delta ferrite phase field.

  8. Laser clock

    SciTech Connect

    Facklam, R.L.

    1983-05-26

    A laser clock includes a linear laser in one embodiment of the clock and a ring laser gyro in the other embodiment. The linear laser is frequency stabilized and utilizes a single active medium in the form of a low pressure gas, such as He-Ne, with a Doppler broadened gain curve. The ring laser gyro is a four frequency laser with a Faraday rotor. Detector and electronic circuitry associated with the laser of each embodiment detects a beat frequency and convert it to a clock signal.

  9. Blue Laser.

    DTIC Science & Technology

    1985-12-01

    HOLLOW CATHODE LASER FABRICATION 13 4. EXPERIENCE WITH THE BLUE LASER 18 4.1 Operational and Processing Experience 18 4.2 Performance Testing 20 5...34 -. - . •. SECTION 3 BLUE HOLLOW CATHODE LASER FABRICATION This section presents an overview of the steps taken in creating a HCL. There is...to the laser assembly. These steps can actually be considered as the final steps in laser fabrication because some of them involve adding various

  10. Characteristic results and prospects of the 13Cr-1W-0.3Ti-0.3Y 2O 3 ODS steel

    NASA Astrophysics Data System (ADS)

    Eiselt, Ch. Ch.; Klimenkov, M.; Lindau, R.; Möslang, A.

    2009-04-01

    For specific blanket and divertor applications in future fusion power reactors a replacement of presently considered reduced activation ferritic martensitic (RAFM) steels as structural material by suitable oxide dispersion strengthened (ODS) ferritic martensitic steels would allow a substantial increase of the operating temperature from ˜550 °C to about 650 °C. Temperatures above 700 °C in the He cooled modular divertor concept necessitates the use of ferritic (RAF) ODS steels, which are not limited by a phase transition. Therefore a 13Cr-1W-0.3Ti-0.3Y 2O 3 ferritic ODS steel is being developed, using an Attritor with varying milling parameters. Afterwards the mechanically alloyed powders were encapsulated, sealed and consolidated in a hot isostatic press device. In this work, the effects of several parameter variations on the microstructure of the produced ferritic ODS-alloys, analysed by optical microscopy (OM) and high resolution TEM, as well as results of conducted mechanical tests are presented.

  11. Dual and Triple Ion-Beam Irradiations of Fe, Fe(Cr) and Fe(Cr)-ODS Final Report: IAEA SMoRE CRP

    SciTech Connect

    Fluss, M J; Hsiung, L L; Marian, J

    2011-11-20

    Structures of nanoparticles in Fe-16Cr-4.5Al-0.3Ti-2W-0.37Y2O3 (K3) and Fe-20Cr-4.5Al-0.34Ti-0.5Y2O3 (MA956) oxide dispersion strengthened (ODS) ferritic steels produced by mechanical alloying (MA) and followed by hot extrusion have been studied using high-resolution transmission electron microscopy (HRTEM) techniques to gain insight about the formation mechanism of nanoparticles in MA/ODS steels. The observations of Y-Al-O complex-oxide nanoparticles in both ODS steels imply that decomposition of Y2O3 in association with internal oxidation of Al occurred during mechanical alloying. While the majority of oxide nanoparticles formed in both steels is Y4Al2O9, a few oxide particles of YAlO3 are also occasionally observed. These results reveal that Ti (0.3 wt %) plays an insignificant role in forming oxide nanoparticles in the presence of Al (4.5 wt %). HRTEM observations of crystalline nanoparticles larger than {approx}2 nm and amorphous or disordered cluster domains smaller than {approx}2 nm provide an insight into the formation mechanism of oxide nanoparticle in MA/ODS steels, which we believe from our observations involves a solid-state amorphous precursor followed by recrystallization. Dual ion-beam irradiations using He{sup +} + Fe{sup +8} ions were employed to gain more detailed insight about the role of nanoparticles in suppressing radiation-induced swelling. This is elaborated through TEM examinations of cavity distributions in ion-irradiated Fe-14Cr and K3-ODS ferritic steels. HRTEM observations of helium-filled cavities (helium bubbles) preferably trapped at nanoscale oxide particles and clusters in ion-irradiated K3-ODS are presented. Finally, we describe the results from triple ion-beam irradiations using H{sup +} + He{sup +} + Fe{sup +8} ions to emulate fusion first wall radiation effects. Preliminary work is reported that confirms the existence of significant hydrogen synergistic effects described earlier by Tanaka et al., for Fe(Cr) and by Wakai et al

  12. Raman Laser Spectrometer internal Optical Head current status: opto-mechanical redesign to minimize the excitation laser trace

    NASA Astrophysics Data System (ADS)

    Sanz, Miguel; Ramos, Gonzalo; Moral, Andoni; Pérez, Carlos; Belenguer, Tomás; del Rosario Canchal, María; Zuluaga, Pablo; Rodriguez, Jose Antonio; Santiago, Amaia; Rull, Fernando; Instituto Nacional de Técnica Aeroespacial (INTA), Universidad de Valladolid (UVa), Ingeniería de Sistemas para la Defesa de España S.A. (ISDEFE)

    2016-10-01

    Raman Laser Spectrometer (RLS) is the Pasteur Payload instruments of the ExoMars mission, within the ESA's Aurora Exploration Programme, that will perform for the first time in an out planetary mission Raman spectroscopy. RLS is composed by SPU (Spectrometer Unit), iOH (Internal Optical Head), and ICEU (Instrument Control and Excitation Unit). iOH focuses the excitation laser on the samples (excitation path), and collects the Raman emission from the sample (collection path, composed on collimation system and filtering system). The original design presented a high laser trace reaching to the detector, and although a certain level of laser trace was required for calibration purposes, the high level degrades the Signal to Noise Ratio confounding some Raman peaks.The investigation revealing that the laser trace was not properly filtered as well as the iOH opto-mechanical redesign are reported on. After the study of the Long Pass Filters Optical Density (OD) as a function of the filtering stage to the detector distance, a new set of filters (Notch filters) was decided to be evaluated. Finally, and in order to minimize the laser trace, a new collection path design (mainly consisting on that the collimation and filtering stages are now separated in two barrels, and on the kind of filters to be used) was required. Distance between filters and collimation stage first lens was increased, increasing the OD. With this new design and using two Notch filters, the laser trace was reduced to assumable values, as can be observed in the functional test comparison also reported on this paper.

  13. Fragmentation of doubly-protonated peptide ion populations labeled by H/D exchange with CD3OD

    NASA Astrophysics Data System (ADS)

    Herrmann, Kristin A.; Kuppannan, Krishna; Wysocki, Vicki H.

    2006-03-01

    Doubly-protonated bradykinin (RPPGFSPFR) and an angiotensin III analogue (RVYIFPF) were subjected to hydrogen/deuterium (H/D) exchange with CD3OD in a Fourier transform ion cyclotron resonance (FT-ICR) mass spectrometer. A bimodal distribution of deuterium incorporation was present for bradykinin after H/D exchange for 90 s at a CD3OD pressure of 4 × 10-7 Torr, indicating the existence of at least two distinct populations. Bradykinin ion populations corresponding to 0-2 and 5-11 deuteriums (i.e., D0, D1, D2, D5, D6, D7, D8, D9, D10, and D11) were each monoisotopically selected and fragmented via sustained off-resonance irradiation (SORI) collision-induced dissociation (CID). The D0-D2 ion populations, which correspond to the slower exchanging population, consistently require lower SORI amplitude to achieve a similar precursor ion survival yield as the faster-reacting (D5-D11) populations. These results demonstrate that conformation/protonation motif has an effect on fragmentation efficiency for bradykinin. Also, the partitioning of the deuterium atoms into fragment ions suggests that the C-terminal arginine residue exchanges more rapidly than the N-terminal arginine. Total deuterium incorporation in the b1/y8 and b2/y7 ion pairs matches very closely the theoretical values for all ion populations studied, indicating that the ions of a complementary pair are likely formed during the same fragmentation event, or that no scrambling occurs upon SORI. Deuterium incorporation into the y1/a8 pseudo-ion pair does not closely match the expected theoretical values. The other peptide, doubly-protonated RVYIFPF, has a trimodal distribution of deuterium incorporation upon H/D exchange with CD3OD at a pressure of 1 × 10-7 Torr for 600 s, indicating at least three distinct ion populations. After 90 s of H/D exchange where at least two distinct populations are detected, the D0-D7 ion populations were monoisotopically selected and fragmented via SORI-CID over a range of SORI

  14. Characterization of HR coatings for the megajoule laser transport mirrors

    SciTech Connect

    Fornier, A.; Cordillot, C.; Bernardino, D.; Lam, O.; Roussel, A.

    1997-12-01

    One of the concerns with the Megajoule Laser design is the laser-induced damage threshold of the transport mirrors. Earlier studies have shown that the main constraint on the laser damage threshold comes from nodules at the mirror surface. It is therefore important to restrict the number of such nodules. SFIM-ODS, in close collaboration with CEL-V, has initiated a special study to characterize these nodules as precisely as possible. The objective of the study is twofold: (1) to determine the origin of the nodules and subsequently to adapt the mirror fabrication process in order to limit their formation, (2) to analyze their shapes and dimensions in order to ascertain which nodules are critical for laser-induced damage. To understand the origin of the nodules and their effect on the laser damage threshold, the mirrors are characterized using various methods, (3) absorption and scatter mapping: does the presence of nodules result in specific absorption patterns? (4) surface analysis by atomic force microscopy: to characterize nodule shape and dimensions, (5) Focused Ion Beam (FIB) cutting of nodules: to locate the seed initiating the nodule (on the substrate or in the stack), and to characterize the seed shape and composition (contamination, material spatter during evaporation, etc.), and (6) laser damage threshold measurements: to determine the laser damage threshold of the mirror and study the behavior of nodules under laser irradiation depending on their dimensions and shape.

  15. Lasers of All Sizes

    NASA Astrophysics Data System (ADS)

    Balcou, Philippe; Forget, Sébastien Robert-Philip, Isabelle

    2015-10-01

    * Introduction * The Laser in All Its Forms * Gas lasers * Dye lasers * Solid-state lasers * Lasers for Every Taste * The rise of lasers * Lasers of all sizes * The colors of the rainbow... and beyond * Shorter and shorter lasers * Increasingly powerful lasers * Lasers: A Universal Tool? * Cutting, welding, and cleaning * Communicating * Treating illnesses * Measuring * Supplying energy? * Entertaining * Understanding * Conclusion

  16. High-rate and low-cost production of very large flat optical debris shields for the French Megajoule laser project

    NASA Astrophysics Data System (ADS)

    Garret, Thierry; Chabassier, Genevieve; Roussel, Andre

    1997-12-01

    Sfim ODS is involved in the French Megajoule Project managed by the Commissariat a l'Energie Atomique. It is a high power UV-laser using 240 square beams (410 mm X 410 mm). Sfim ODS achieved a technical and economical analysis concerning the production of flat-parallel debris-shields in silica (430 X 430 X 6 mm, transmitted wavefront: (lambda) /2, 2 500 shields/year) using large and specific dual-side fine- grinding and polishing machines. This analysis was supported by trials using half-scale windows (same stiffness equals> thickness equals 1.7 mm) showing the ability to reach the specifications with low production costs.

  17. High-rate and low-cost production of very large flat optical debris shields for the French high-power UV laser project

    NASA Astrophysics Data System (ADS)

    Garret, Thierry; Chabassier, Genevieve; Roussel, Andre

    1996-08-01

    SFIM ODS is involved in the French MEGAJOULE Project managed by the Commissariat a l'Energie Atomique. It is a high power UV-laser using 240 square beams. SFIM ODS achieved a technical and economical analysis concerning the production of flat-parallel debris-shields in silica using large and specific dual-side fine-grinding and polishing machines. This analysis was supported by trials using half-scale windows showing the ability to reach the specifications with low production costs.

  18. Laser microphone

    DOEpatents

    Veligdan, James T.

    2000-11-14

    A microphone for detecting sound pressure waves includes a laser resonator having a laser gain material aligned coaxially between a pair of first and second mirrors for producing a laser beam. A reference cell is disposed between the laser material and one of the mirrors for transmitting a reference portion of the laser beam between the mirrors. A sensing cell is disposed between the laser material and one of the mirrors, and is laterally displaced from the reference cell for transmitting a signal portion of the laser beam, with the sensing cell being open for receiving the sound waves. A photodetector is disposed in optical communication with the first mirror for receiving the laser beam, and produces an acoustic signal therefrom for the sound waves.

  19. Near infrared (NIR) laser mediated surface activation of graphene oxide nanoflakes for efficient antibacterial, antifungal and wound healing treatment.

    PubMed

    Shahnawaz Khan, M; Abdelhamid, Hani Nasser; Wu, Hui-Fen

    2015-03-01

    Photothermal treatment of graphene oxide (GO) for antibacterial, antifungal and controlling the wound infection treatment using near infrared laser (NIR, Nd-YAG (λ=1064 nm) were reported. Various pathogenic bacteria (Pseudomonas aeruginosa, Staphylococcus aureus) and fungi (Saccharomyces cerevisiae and Candida utilis) were investigated. The cytotoxicity was measured using the proteomic analysis by matrix assisted laser desorption/ionization mass spectrometry (MALDI-MS), optical density (OD600), standard microdilution procedures, transmission electron microscopy (TEM) and epifluorescence microscopy. The laser mediated the surface activation of GO offer high efficiency for antifungal and antibacterial. Wide broad cells with various instruments approved that graphene oxide is promising material for nanomedicine in the near future.

  20. Laser ignition

    DOEpatents

    Early, James W.; Lester, Charles S.

    2004-01-13

    Sequenced pulses of light from an excitation laser with at least two resonator cavities with separate output couplers are directed through a light modulator and a first polarzing analyzer. A portion of the light not rejected by the first polarizing analyzer is transported through a first optical fiber into a first ignitor laser rod in an ignitor laser. Another portion of the light is rejected by the first polarizing analyzer and directed through a halfwave plate into a second polarization analyzer. A first portion of the output of the second polarization analyzer passes through the second polarization analyzer to a second, oscillator, laser rod in the ignitor laser. A second portion of the output of the second polarization analyzer is redirected by the second polarization analyzer to a second optical fiber which delays the beam before the beam is combined with output of the first ignitor laser rod. Output of the second laser rod in the ignitor laser is directed into the first ignitor laser rod which was energized by light passing through the first polarizing analyzer. Combined output of the first ignitor laser rod and output of the second optical fiber is focused into a combustible fuel where the first short duration, high peak power pulse from the ignitor laser ignites the fuel and the second long duration, low peak power pulse directly from the excitation laser sustains the combustion.

  1. Laser sampling

    NASA Astrophysics Data System (ADS)

    Gorbatenko, A. A.; Revina, E. I.

    2015-10-01

    The review is devoted to the major advances in laser sampling. The advantages and drawbacks of the technique are considered. Specific features of combinations of laser sampling with various instrumental analytical methods, primarily inductively coupled plasma mass spectrometry, are discussed. Examples of practical implementation of hybrid methods involving laser sampling as well as corresponding analytical characteristics are presented. The bibliography includes 78 references.

  2. Atmospherically Related Studies of O(D-1) and O2 (b'Sigma(sub g, sup +)

    NASA Technical Reports Server (NTRS)

    Slanger, Tom G.

    1998-01-01

    For the third year of the grant, we propose to investigate the (beta)'(Sigma)(sub g, sup +). Our earlier value of 0.77 +/- 0.23, which has been used for a long time, should be updated, and the error limits reduced. Current measurements in J. Barker's group at the University of Michigan have assigned a value closer to 0.9, and we will conduct a new evaluation. The goals of this project are to investigate various aspects of the photochemistry of O('D) and O2(beta)'(Sigma)(sub g, sup +) that are of relevance to the photochemistry and energy balance of the terrestrial atmosphere. Over the last six months, we have obtained new sky spectra data files from the Keck telescope via Don Osterbrock at UC Santa Cruz, and now 120 hours of data have been accumulated. Thus, we have been able to make large signal/noise improvements of the O2(b'(Sigma)(sub g, sup +) - X(sup 3)(Sigma)(Sub g, sup -) Atmospheric Band data that we are collecting.

  3. Morphology-dependent optical anisotropies in the n -type polymer P(NDI2OD-T2)

    NASA Astrophysics Data System (ADS)

    Brown, Steven J.; Schlitz, Ruth A.; Chabinyc, Michael L.; Schuller, Jon A.

    2016-10-01

    Organic semiconductors tend to self-assemble into highly ordered and oriented morphologies with anisotropic optical properties. Studying these optical anisotropies provides insight into processing-dependent structural properties and informs the photonic design of organic photovoltaic and light-emitting devices. Here we measure the anisotropic optical properties of spin-cast films of the n -type polymer P(NDI2OD-T2) using momentum-resolved absorption and emission spectroscopies. We quantify differences in the optical anisotropies of films deposited with distinct face-on and edge-on morphologies. In particular, we infer a substantially larger out-of-plane tilt angle of the optical transition dipole moment in high temperature annealed, edge-on films. Measurements of spectral differences between in-plane and out-of-plane dipoles, further indicate regions of disordered polymers in low temperature annealed face-on films that are otherwise obscured in traditional x-ray and optical characterization techniques. The methods and analysis developed in this work provide a way to identify and quantify subtle optical and structural anisotropies in organic semiconductors that are important for understanding and designing highly efficient thin film devices.

  4. Development of an HPLC Method with an ODS Column to Determine Low Levels of Aspartame Diastereomers in Aspartame

    PubMed Central

    Ohtsuki, Takashi; Nakamura, Ryoichiro; Kubo, Satoru; Otabe, Akira; Oobayashi, Yoko; Suzuki, Shoko; Yoshida, Mika; Yoshida, Mitsuya; Tatebe, Chiye; Sato, Kyoko; Akiyama, Hiroshi

    2016-01-01

    α-L-Aspartyl-D-phenylalanine methyl ester (L, D-APM) and α-D-aspartyl-L-phenylalanine methyl ester (D, L-APM) are diastereomers of aspartame (N-L-α-Aspartyl-L-phenylalanine-1-methyl ester, L, L-APM). The Joint FAO/WHO Expert Committee on Food Additives has set 0.04 wt% as the maximum permitted level of the sum of L, D-APM and D, L-APM in commercially available L, L-APM. In this study, we developed and validated a simple high-performance liquid chromatography (HPLC) method using an ODS column to determine L, D-APM and D, L-APM in L, L-APM. The limits of detection and quantification, respectively, of L, D-APM and D, L-APM were found to be 0.0012 wt% and 0.004 wt%. This method gave excellent accuracy, repeatability, and reproducibility in a recovery test performed on five different days. Moreover, the method was successfully applied to the determination of these diastereomers in commercial L, L-APM samples. Thus, the developed method is a simple, useful, and practical tool for determining L, D-APM and D, L-APM levels in L, L-APM. PMID:27015640

  5. Development of an HPLC Method with an ODS Column to Determine Low Levels of Aspartame Diastereomers in Aspartame.

    PubMed

    Ohtsuki, Takashi; Nakamura, Ryoichiro; Kubo, Satoru; Otabe, Akira; Oobayashi, Yoko; Suzuki, Shoko; Yoshida, Mika; Yoshida, Mitsuya; Tatebe, Chiye; Sato, Kyoko; Akiyama, Hiroshi

    2016-01-01

    α-L-Aspartyl-D-phenylalanine methyl ester (L, D-APM) and α-D-aspartyl-L-phenylalanine methyl ester (D, L-APM) are diastereomers of aspartame (N-L-α-Aspartyl-L-phenylalanine-1-methyl ester, L, L-APM). The Joint FAO/WHO Expert Committee on Food Additives has set 0.04 wt% as the maximum permitted level of the sum of L, D-APM and D, L-APM in commercially available L, L-APM. In this study, we developed and validated a simple high-performance liquid chromatography (HPLC) method using an ODS column to determine L, D-APM and D, L-APM in L, L-APM. The limits of detection and quantification, respectively, of L, D-APM and D, L-APM were found to be 0.0012 wt% and 0.004 wt%. This method gave excellent accuracy, repeatability, and reproducibility in a recovery test performed on five different days. Moreover, the method was successfully applied to the determination of these diastereomers in commercial L, L-APM samples. Thus, the developed method is a simple, useful, and practical tool for determining L, D-APM and D, L-APM levels in L, L-APM.

  6. {sup 252}Cf-source-correlated transmission measurements for uranyl fluoride deposit in a 24-in.-OD process pipe

    SciTech Connect

    Uckan, T.; Mihalczo, J.T.; Valentine, T.E.; Mullens, J.A.; Wyatt, M.S.; Hannon, T.F.

    1998-06-01

    Characterization of a hydrated uranyl fluoride (UO{sub 2}F{sub 2}{center_dot}nH{sub 2}O) deposit in a 17-ft-long, 24-in.-OD process pipe at the former Oak Ridge Gaseous Diffusion Plant was successfully performed by using {sup 252}Cf-source-correlated time-of-flight (TOF) transmission measurements. These measurements of neutrons and gamma rays through the pipe from an external {sup 2521}Cf fission source were used to measure the deposit profile and its distribution along the pipe, the hydration (or H/U), and the total uranium mass. The measurements were performed with a source in an ionization chamber on one side of the pipe and detectors on the other. Scanning the pipe vertically and horizontally produced a spatial and time-dependent radiograph of the deposit in which transmitted gamma rays and neutrons were separated in time. The cross-correlation function between the source and the detector was measured with the Nuclear Weapons Identification System. After correcting for pipe effects, the deposit thickness was determined from the transmitted neutrons and H/U from the gamma rays. Results were consistent with a later intrusive observation of the shape and the color of the deposit; i.e., the deposit was annular and was on the top of the pipe at some locations, demonstrating the usefulness of this method for deposit characterization.

  7. Annealing effects on the microstructure and mechanical properties of hot-rolled 14Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Gao, R.; Zhang, T.; Ding, H. L.; Jiang, Y.; Wang, X. P.; Fang, Q. F.; Liu, C. S.

    2015-10-01

    The oxide dispersion strengthened ferritic steels with nominal composition (weight percent) of Fe-14Cr-2W-0.5Ti-0.06Si-0.2V-0.1Mn-0.05Ta-0.03C-0.3Y2O3 were fabricated by sol-gel method, mechanical alloying, and hot isostatic pressing techniques. The evolution of microstructure and mechanical properties of the hot-rolled specimens with heat treatment was investigated. Tensile strength and hardness of hot-rolled ODS steel are significantly enhanced due to the formation of mechanical twins and high density dislocations. Uniformly dispersed oxide particles (10-40 nm) and fine-grained structure (200-400 nm) are responsible for the superior mechanical properties of the hot-rolled specimen annealed between 650 °C and 850 °C. With further increasing annealing temperature, the grain size of the hot-rolled specimens increases while the size of oxide particles decreases, which leads to lower strength and hardness but better ductility. The tensile strength and total elongation of samples in the rolling direction are higher than those in the transverse direction after the same treatments owing to the grain anisotropy induced by the large mechanical deformation.

  8. Structural damage detection and estimation using a scanning laser vibrometer

    NASA Astrophysics Data System (ADS)

    Pai, Perngjin F.; Lee, Seung-Yoon; Schulz, Mark J.

    2001-07-01

    This paper presents a model-independent boundary effect evaluation (BEE) method for pinpointing crack locations and estimating crack sizes using only operational deflection shapes (ODSs) measured by a scanning laser vibrometer. An ODS consists of central and boundary solutions. Central solutions are periodic functions, and boundary solutions are exponentially decaying functions due to boundary constraints. The BEE method uses a sliding-window curve-fitting technique to extract boundary solutions from an experimental ODS. Because cracks introduce localized small boundaries to a structure, boundary solutions exist around cracks as well as structural boundaries. Since crack-induced boundary solutions show characteristics different from those of actual boundaries, cracks can be easily located. A local strain energy method is derived for estimating crack sizes. In the method, the crack-induced strain energy extracted from an ODS is compared with the one calculated using fracture mechanics to estimate the crack size. To verify the capability and accuracy of this BEE method, experiments are performed on six 22' X 1' X 0.25' 2024-T4 aluminum beams each having a through-the-width Mode I crack at its midpoint. These cracks are slots having a width of 0.039' and depths of 0.0625' (25% of the beam thickness), 0.05' (20%), 0.0375' (15%), 0.025' (10%), 0.0125' (5%), and 0.005' (2%), respectively. Results show that this BEE method is capable of locating and estimating small cracks.

  9. A Miniaturized, 1.9F Integrated Optical Fiber and Stone Basket for Use in Thulium Fiber Laser Lithotripsy.

    PubMed

    Wilson, Christopher R; Hutchens, Thomas C; Hardy, Luke A; Irby, Pierce B; Fried, Nathaniel M

    2015-10-01

    The thulium fiber laser (TFL) is being explored as an alternative laser lithotripter to the standard holmium:yttrium-aluminum-garnet laser. The more uniform beam profile of the TFL enables higher power transmission through smaller fibers. In this study, a 100-μm core, 140-μm outer-diameter (OD) silica fiber with 5-mm length hollow steel tip was integrated with 1.3F (0.433-mm OD) nitinol wire basket to form a 1.9F (0.633-mm OD) device. TFL energy of 30 mJ, 500 μs pulse duration, and 500 Hz pulse rate was delivered to human uric acid stones, ex vivo. Stone ablation rates measured 1.5 ± 0.2 mg/s, comparable to 1.7 ± 0.3 mg/s using bare fiber tips separately with stone basket. With further development, this device may minimize stone retropulsion, allowing more efficient TFL lithotripsy at higher pulse rates. It may also provide increased flexibility, higher saline irrigation rates through the ureteroscope working channel, reduce fiber degradation compared with separate fiber and basket manipulation, and reduce laser-induced nitinol wire damage.

  10. INTERACTION OF LASER RADIATION WITH MATTER. LASER PLASMA: Propagation of an optical discharge through optical fibres upon interference of modes

    NASA Astrophysics Data System (ADS)

    Bufetov, I. A.; Frolov, A. A.; Shubin, A. V.; Likhachev, M. E.; Lavrishchev, S. V.; Dianov, E. M.

    2008-05-01

    The propagation of an optical discharge (OD) through optical fibres upon interference of LP01 and LP02 modes is studied. Under these conditions after the OD propagation through the fibre, the formation of an axially-symmetric group sequence of voids with a spatial period equal to that of mode interference (200—500 μm depending on the parameters of the fibre) is observed. The groups of voids are formed near the sections of the fibre with a minimal diameter of the intensity distribution of laser radiation. Large spaces between voids in the fibre have allowed us to measure accurately the difference Δn of refractive indices of the fibre core and cladding and distribution of dopants in different cross sections of the fibre after the OD propagation. A substantial increase in Δn (up to ten times) is observed. Approximately half this increase is caused by compression and densification of the fibre material after the propagation of the optical discharge.

  11. CW laser pumped emerald laser

    SciTech Connect

    Shand, M.L.; Lai, S.T.

    1984-02-01

    A CW laser-pumped emerald laser is reported. A 34 percent output power slope efficiency is observed with longitudinal pumping by a krypton laser in a nearly concentric cavity. The laser has been tuned from 728.8 to 809.0 nm. Losses in emerald are larger than those of alexandrite determined in a similar cavity. The present data also indicate that the excited state absorption minimum is shifted from that of alexandrite. 13 references.

  12. Laser device

    DOEpatents

    Scott, Jill R.; Tremblay, Paul L.

    2007-07-10

    A laser device includes a target position, an optical component separated a distance J from the target position, and a laser energy source separated a distance H from the optical component, distance H being greater than distance J. A laser source manipulation mechanism exhibits a mechanical resolution of positioning the laser source. The mechanical resolution is less than a spatial resolution of laser energy at the target position as directed through the optical component. A vertical and a lateral index that intersect at an origin can be defined for the optical component. The manipulation mechanism can auto align laser aim through the origin during laser source motion. The laser source manipulation mechanism can include a mechanical index. The mechanical index can include a pivot point for laser source lateral motion and a reference point for laser source vertical motion. The target position can be located within an adverse environment including at least one of a high magnetic field, a vacuum system, a high pressure system, and a hazardous zone. The laser source and an electro-mechanical part of the manipulation mechanism can be located outside the adverse environment. The manipulation mechanism can include a Peaucellier linkage.

  13. Laser device

    DOEpatents

    Scott, Jill R.; Tremblay, Paul L.

    2004-11-23

    A laser device includes a target position, an optical component separated a distance J from the target position, and a laser energy source separated a distance H from the optical component, distance H being greater than distance J. A laser source manipulation mechanism exhibits a mechanical resolution of positioning the laser source. The mechanical resolution is less than a spatial resolution of laser energy at the target position as directed through the optical component. A vertical and a lateral index that intersect at an origin can be defined for the optical component. The manipulation mechanism can auto align laser aim through the origin during laser source motion. The laser source manipulation mechanism can include a mechanical index. The mechanical index can include a pivot point for laser source lateral motion and a reference point for laser source vertical motion. The target position can be located within an adverse environment including at least one of a high magnetic field, a vacuum system, a high pressure system, and a hazardous zone. The laser source and an electro-mechanical part of the manipulation mechanism can be located outside the adverse environment. The manipulation mechanism can include a Peaucellier linkage.

  14. Laser ignition

    DOEpatents

    Early, James W.; Lester, Charles S.

    2003-01-01

    In the apparatus of the invention, a first excitation laser or other excitation light source is used in tandem with an ignitor laser to provide a compact, durable, engine deployable fuel ignition laser system. Reliable fuel ignition is provided over a wide range of fuel conditions by using a single remote excitation light source for one or more small lasers located proximate to one or more fuel combustion zones. In a third embodiment, alternating short and long pulses of light from the excitation light source are directed into the ignitor laser. Each of the embodiments of the invention can be multiplexed so as to provide laser light energy sequentially to more than one ignitor laser.

  15. Particles control in selective laser melting in-situ oxide dispersion strengthened method

    NASA Astrophysics Data System (ADS)

    Zhou, Xin; An, Zhibin; Shen, Zhijian; Liu, Wei; Yao, Chenguang

    2017-01-01

    Stainless steel selective laser melting (SLM) can be considered as a new possible approach for in-situ formation of oxide dispersion strengthened (ODS) steels because of the dispersion of amorphous oxide nano-particles due to the trace amounts of laser chamber oxygen and in-situ internal oxidation of reactive elements. In this paper it is demonstrated that the particle sizes and distributions can be adjusted by choosing different chamber oxygen level through controlling the quantity of initial reactive cores and the available reactive solutes of each core.

  16. C-Terminal residues in small potassium channel blockers OdK1 and OSK3 from scorpion venom fine-tune the selectivity.

    PubMed

    Kuzmenkov, Alexey I; Peigneur, Steve; Chugunov, Anton O; Tabakmakher, Valentin M; Efremov, Roman G; Tytgat, Jan; Grishin, Eugene V; Vassilevski, Alexander A

    2017-02-04

    We report isolation, sequencing, and electrophysiological characterization of OSK3 (α-KTx 8.8 in Kalium and Uniprot databases), a potassium channel blocker from the scorpion Orthochirus scrobiculosus venom. Using the voltage clamp technique, OSK3 was tested on a wide panel of 11 voltage-gated potassium channels expressed in Xenopus oocytes, and was found to potently inhibit Kv1.2 and Kv1.3 with IC50 values of ~331nM and ~503nM, respectively. OdK1 produced by the scorpion Odontobuthus doriae differs by just two C-terminal residues from OSK3, but shows marked preference to Kv1.2. Based on the charybdotoxin-potassium channel complex crystal structure, a model was built to explain the role of the variable residues in OdK1 and OSK3 selectivity.

  17. Strong magnetic-dielectric-lattice coupling in transition metal hydroxyhalides and ferroelectric response in rhombohedral Co2(OD)3X (X=Cl, Br)

    NASA Astrophysics Data System (ADS)

    Zheng, X. G.; Fujihala, M.; Kitajima, S.; Maki, M.; Kato, K.; Takata, M.; Xu, C. N.

    2013-05-01

    Hydroxyl salts of the type M2(OH)3X, and M(OH)X, where M represents a transition metal ion and X represents a halogen ion, widely exist as minerals and were recently reported to be geometrically frustrated magnets. Here, we report the finding of ferroelectric response in them. First, we observed strong magnetic-lattice-dielectric couplings in all of them as witnessed during their magnetic transitions at low temperatures. Secondly, we identified apparent ferroelectric responses in the deuterated hydroxyl salts of high crystal symmetries, i.e., rhombohedral Co2(OD)3Cl and Co2(OD)3Br, at high temperatures of 220-230 K through an isotope effect. The present work shows that multiferroicity may be a potentially universal phenomenon in magnetic hydroxyl salts. Meanwhile, it provides the first link between magnetic geometric frustration and hydrogen-bonded soft-mode ferroelectrics.

  18. Observation of the Q(3/2) Λ-doublet transitions for X2Π3/2 OD in helium nanodroplets

    NASA Astrophysics Data System (ADS)

    Raston, Paul L.; Liang, Tao; Douberly, Gary E.

    2014-01-01

    The deuteroxyl radical (OD) has been isolated in superfluid helium nanodroplets and characterised by infrared depletion spectroscopy. Two resolved Q(3/2) lines are observed, with a separation that is 4.88 (10) times larger than in the gas phase. This is similar to that previously reported for He-solvated OH (5.30 (2)), for which it was shown that the splitting could be reproduced by a model that assumes a small parity dependence of the rotor's effective moment of inertia [P.L. Raston, T. Liang, and G.E. Douberly, J. Phys. Chem. A (2013). DOI:10.1021/jp312335q]. With this model, the OD Λ-doublet splitting in liquid He is reproduced with Be and Bf rotational constants that differ by ≈0.24%.

  19. H/D exchange in reactions of OH(-) with D2 and of OD(-) with H2 at low temperatures.

    PubMed

    Mulin, Dmytro; Roučka, Štěpán; Jusko, Pavol; Zymak, Illia; Plašil, Radek; Gerlich, Dieter; Wester, Roland; Glosík, Juraj

    2015-04-14

    Using a cryogenic linear 22-pole rf ion trap, rate coefficients for H/D exchange reactions of OH(-) with D2 (1) and OD(-) with H2 (2) have been measured at temperatures between 11 K and 300 K with normal hydrogen. Below 60 K, we obtained k1 = 5.5 × 10(-10) cm(3) s(-1) for the exoergic . Upon increasing the temperature above 60 K, the data decrease with a power law, k1(T) ∼T(-2.7), reaching ≈1 × 10(-10) cm(3) s(-1) at 200 K. This observation is tentatively explained with a decrease of the lifetime of the intermediate complex as well as with the assumption that scrambling of the three hydrogen atoms is restricted by the topology of the potential energy surface. The rate coefficient for the endoergic increases with temperature from 12 K up to 300 K, following the Arrhenius equation, k2 = 7.5 × 10(-11) exp(-92 K/T) cm(3) s(-1) over two orders of magnitude. The fitted activation energy, EA-Exp = 7.9 meV, is in perfect accordance with the endothermicity of 24.0 meV, if one accounts for the thermal population of the rotational states of both reactants. The low mean activation energy in comparison with the enthalpy change in the reaction is mainly due to the rotational energy of 14.7 meV contributed by ortho-H2 (J = 1). Nonetheless, one should not ignore the reactivity of pure para-H2 because, according to our model, it already reaches 43% of that of ortho-H2 at 100 K.

  20. Genetics of reproductive isolation in the Drosophila simulans clade: DNA marker-assisted mapping and characterization of a hybrid-male sterility gene, Odysseus (Ods).

    PubMed

    Perez, D E; Wu, C I; Johnson, N A; Wu, M L

    1993-05-01

    In this study, we address the question of whether there exist major genes that cause complete male sterility in the interspecific hybrids of Drosophila and, if they do, how these genes may be characterized at the molecular level. Our approach is to introgress small segments of the X chromosome from Drosophila mauritiana (or Drosophila sechellia) into Drosophila simulans by repeated backcrosses for more than 20 generations. The introgressions are monitored by both visible mutations and a series of DNA markers. We compare the extent of introgressions that cause male sterility with those that do not. If a major sterility factor exists, there should be a sharp boundary between these two classes of introgressions and their breakpoints should demarcate such a gene. Furthermore, if male sterility is the only major fitness effect associated with the introgression, recombination analysis should yield a pattern predicted by the classical three-point cross. Both the genetic and molecular analyses suggest the presence of a major sterility factor from D. mauritiana, which we named Odysseus (Ods), in the cytological interval of 16D. We thus formalize three criteria for inferring the existence of a major gene within an introgression: (1) complete penetrance of sterility, (2) complementarity in recombination analysis, and (3) physical demarcation. Introgressions of Ods from D. sechellia do not cause sterility. Twenty-two introgressions in our collection have breakpoints in this interval of about 500 kb, making it possible to delineate Ods more precisely for molecular identification. The recombination analysis also reveals the complexity of the introgressed segments--even relatively short ones may contain a second male sterility factor and partial viability genes and may also interfere with crossovers. The spermatogenic defects associated with Ods and/or a second factor were characterized by phase-contrast microscopy.

  1. Effect of crack length-to-width ratio on crack resistance of high Cr-ODS steels at high temperature for fuel cladding application

    NASA Astrophysics Data System (ADS)

    Chaouadi, R.; Ramesh, M.; Gavrilov, S.

    2013-11-01

    Oxide dispersion strengthened (ODS) steels with high Cr-content are extensively investigated in Europe, Japan and United States by the nuclear materials community for application to both advanced fission reactors and fusion systems. In comparison to standard high Cr-steels, the expected operation temperature range can be extended to 650 °C or more because of their improved creep resistance. However, their crack resistance behavior in the high temperature range was less investigated.The aim of the present paper is to provide some insight on their fracture behavior at high temperature and different crack configurations, in particular shallow crack. Crack resistance measurements were performed on a 12%Cr-ODS steel using compact tension specimens at 650 °C considering both shallow and deep crack configurations. Finite element calculations were performed on a typical fuel cladding tube geometry to assess the performances in terms of crack resistance. It is found that the temperature gradient across the wall should be maintained low enough to avoid cracking. After irradiation in corrosive environment, the boundary conditions might be further affected limiting therefore the lifetime of ODS cladding.

  2. Retrospective Study of Pegaspargase, Gemicitabine, Oxaliplatin and Dexamethasone (Peg-GemOD) as a First-Line Therapy for Advanced-Stage Extranodal NK/T Cell Lymphoma.

    PubMed

    Yao, Yi-Yun; Tang, Yong; Zhuang, Yan; Zou, Li-Fang; Dou, Hong-Ju; Wang, Lei; Zhu, Qi

    2017-03-01

    This study was conducted to retrospectively investigate the efficacy and safety of pegaspargase, gemicitabine, oxaliplatin and dexamethasone (Peg-GemOD) combination chemotherapy as a first-line therapy for advanced-stage extranodal NK/T cell lymphoma (ENKTL). Eighteen patients with newly diagnosed stage III/IV ENKTL were subjected to 3-6 cycles of Peg-GemOD chemotherapy. After 3 cycles of therapy, the overall response rate was 67 % (12/18) with a complete response rate of 28 % (5/18) and a partial response rate of 39 % (7/18). The median overall survival (OS) and progression-free survival (PFS) time were 10 and 8.5 months respectively. For those responders, the median OS and PFS time were significantly better than those of non-responders (median OS, 15 vs. 10 months; P = 0.001 and median PFS, 15 vs. 7 months; P = 0.001). Furthermore, patients with low plasma EBV-DNA levels after induction chemotherapy had a remarkably longer OS and PFS time. The toxicity of Peg-GemOD regimen was acceptable.

  3. Quantum-spin-liquid states in the two-dimensional kagome antiferromagnets ZnxCu4-x(OD)6Cl2.

    PubMed

    Lee, S-H; Kikuchi, H; Qiu, Y; Lake, B; Huang, Q; Habicht, K; Kiefer, K

    2007-11-01

    A three-dimensional system of interacting spins typically develops static long-range order when it is cooled. If the spins are quantum (S=1/2), however, novel quantum paramagnetic states may appear. The most highly sought state among them is the resonating-valence-bond state, in which every pair of neighbouring quantum spins forms an entangled spin singlet (valence bonds) and these singlets are quantum mechanically resonating among themselves. Here we provide an experimental indication for such quantum paramagnetic states existing in frustrated antiferromagnets, Zn(x)Cu(4-x)(OD)(6)Cl(2), where the S=1/2 magnetic Cu2+ moments form layers of a two-dimensional kagome lattice. We find that in Cu(4)(OD)(6)Cl(2), where distorted kagome planes are weakly coupled, a dispersionless excitation mode appears in the magnetic excitation spectrum below approximately 20 K, whose characteristics resemble those of quantum spin singlets in a solid state, known as a valence-bond solid, that breaks translational symmetry. Doping with non-magnetic Zn2+ ions reduces the distortion of the kagome lattice, and weakens the interplane coupling but also dilutes the magnetic occupancy of the kagome lattice. The valence-bond-solid state is suppressed, and for ZnCu(3)(OD)(6)Cl(2), where the kagome planes are undistorted and 90% occupied by the Cu2+ ions, the low-energy spin fluctuations become featureless.

  4. Biocavity Lasers

    SciTech Connect

    Gourley, P.L.; Gourley, M.F.

    2000-10-05

    Laser technology has advanced dramatically and is an integral part of today's healthcare delivery system. Lasers are used in the laboratory analysis of human blood samples and serve as surgical tools that kill, burn or cut tissue. Recent semiconductor microtechnology has reduced the size o f a laser to the size of a biological cell or even a virus particle. By integrating these ultra small lasers with biological systems, it is possible to create micro-electrical mechanical systems that may revolutionize health care delivery.

  5. Laser apparatus

    DOEpatents

    Lewis, Owen; Stogran, Edmund M.

    1980-01-01

    Laser apparatus is described wherein an active laser element, such as the disc of a face-pumped laser, is mounted in a housing such that the weight of the element is supported by glass spheres which fill a chamber defined in the housing between the walls of the housing and the edges of the laser element. The uniform support provided by the spheres enable the chamber and the pump side of the laser element to be sealed without affecting the alignment or other optical properties of the laser element. Cooling fluid may be circulated through the sealed region by way of the interstices between the spheres. The spheres, and if desired also the cooling fluid may contain material which absorbs radiation at the wavelength of parasitic emissions from the laser element. These parasitic emissions enter the spheres through the interface along the edge surface of the laser element and it is desirable that the index of refraction of the spheres and cooling fluid be near the index of refraction of the laser element. Thus support, cooling, and parasitic suppression functions are all accomplished through the use of the arrangement.

  6. Laser ignition

    DOEpatents

    Early, James W.; Lester, Charles S.

    2002-01-01

    In the apparatus of the invention, a first excitation laser or other excitation light source capable of producing alternating beams of light having different wavelengths is used in tandem with one or more ignitor lasers to provide a compact, durable, engine deployable fuel ignition laser system. Reliable fuel ignition is provided over a wide range of fuel conditions by using the single remote excitation light source for pumping one or more small lasers located proximate to one or more fuel combustion zones with alternating wavelengths of light.

  7. The relaxation of OH (v=1) and OD (v=1) by H2O and D2O at temperatures from 251 to 390 K.

    PubMed

    McCabe, D C; Rajakumar, B; Marshall, P; Smith, I W M; Ravishankara, A R

    2006-10-21

    We report rate coefficients for the relaxation of OH(v=1) and OD(v=1) by H2O and D2O as a function of temperature between 251 and 390 K. All four rate coefficients exhibit a negative dependence on temperature. In Arrhenius form, the rate coefficients for relaxation (in units of 10(-12) cm3 molecule-1 s-1) can be expressed as: for OH(v=1)+H2O between 263 and 390 K: k=(2.4+/-0.9) exp((460+/-115)/T); for OH(v=1)+D2O between 256 and 371 K: k=(0.49+/-0.16) exp((610+/-90)/T); for OD(v=1)+H2O between 251 and 371 K: k=(0.92+/-0.16) exp((485+/-48)/T); for OD(v=1)+D2O between 253 and 366 K: k=(2.57+/-0.09) exp((342+/-10)/T). Rate coefficients at (297+/-1 K) are also reported for the relaxation of OH(v=2) by D2O and the relaxation of OD(v=2) by H2O and D2O. The results are discussed in terms of a mechanism involving the formation of hydrogen-bonded complexes in which intramolecular vibrational energy redistribution can occur at rates competitive with re-dissociation to the initial collision partners in their original vibrational states. New ab initio calculations on the H2O-HO system have been performed which, inter alia, yield vibrational frequencies for all four complexes: H2O-HO, D2O-HO, H2O-DO and D2O-DO. These data are then employed, adapting a formalism due to Troe (J. Troe, J. Chem. Phys., 1977, 66, 4758), in order to estimate the rates of intramolecular energy transfer from the OH (OD) vibration to other modes in the complexes in order to explain the measured relaxation rates-assuming that relaxation proceeds via the hydrogen-bonded complexes.

  8. Multimegajoule laser design. [Glass lasers

    SciTech Connect

    Manes, K.R.; Ozarski, R.G.; Hagen, W.F.; Holzrichtr, J.F.

    1985-08-01

    New technologies make multimegajoule glass lasers economically feasible. We have devised new laser architectures using harmonic switchout, target-plane holographic injection, phase conjugation, continuous apodization, and higher amplifier efficiencies. Our plan for building a multimegajoule laser for a recurring cost under $300 million relies on the following manufacturing economies of scale: high-volume glass production, rapid harmonic-crystal growth, capacitor sizing and packing to increase energy capacity, and part standardization.

  9. Laser safety in design of near-infrared scanning LIDARs

    NASA Astrophysics Data System (ADS)

    Zhu, X.; Elgin, D.

    2015-05-01

    3D LIDARs (Light Detection and Ranging) with 1.5μm nanosecond pulse lasers have been increasingly used in different applications. The main reason for their popularity is that these LIDARs have high performance while at the same time can be made eye-safe. Because the laser hazard effect on eyes or skin at this wavelength region (<1.4μm) is mainly from the thermal effect accumulated from many individual pulses over a period of seconds, scanning can effectively reduce the laser beam hazard effect from the LIDARs. Neptec LIDARs have been used in docking to the International Space Station, military helicopter landing and industrial mining applications. We have incorporated the laser safety requirements in the LIDAR design and conducted laser safety analysis for different operational scenarios. While 1.5μm is normally said to be the eye-safe wavelength, in reality a high performance 3D LIDAR needs high pulse energy, small beam size and high pulse repetition frequency (PRF) to achieve long range, high resolution and high density images. The resulting radiant exposure of its stationary beam could be many times higher than the limit for a Class 1 laser device. Without carefully choosing laser and scanning parameters, including field-of-view, scan speed and pattern, a scanning LIDAR can't be eye- or skin-safe based only on its wavelength. This paper discusses the laser safety considerations in the design of eye-safe scanning LIDARs, including laser pulse energy, PRF, beam size and scanning parameters in two basic designs of scanning mechanisms, i.e. galvanometer based scanner and Risley prism based scanner. The laser safety is discussed in terms of device classification, nominal ocular hazard distance (NOHD) and safety glasses optical density (OD).

  10. Heterodyne laser spectroscopy system

    DOEpatents

    Wyeth, Richard W.; Paisner, Jeffrey A.; Story, Thomas

    1989-01-01

    A heterodyne laser spectroscopy system utilizes laser heterodyne techniques for purposes of laser isotope separation spectroscopy, vapor diagnostics, processing of precise laser frequency offsets from a reference frequency and the like, and provides spectral analysis of a laser beam.

  11. Heterodyne laser spectroscopy system

    DOEpatents

    Wyeth, Richard W.; Paisner, Jeffrey A.; Story, Thomas

    1990-01-01

    A heterodyne laser spectroscopy system utilizes laser heterodyne techniques for purposes of laser isotope separation spectroscopy, vapor diagnostics, processing of precise laser frequency offsets from a reference frequency, and provides spectral analysis of a laser beam.

  12. Past research and fabrication conducted at SCK•CEN on ferritic ODS alloys used as cladding for FBR's fuel pins

    NASA Astrophysics Data System (ADS)

    De Bremaecker, Anne

    2012-09-01

    -destructive tests (ultrasonic and eddy currents) were also developed. In-pile creep in argon and in liquid sodium was deeply studied on pressurized segments irradiated up to 75 dpaNRT. Finally two fuel assemblies cladded with such ODS alloys were irradiated in Phenix to the max dose of 90 dpa. Creep deformation and swelling were limited but the irradiation-induced embrittlement became acute. The programme was stopped shortly after the Chernobyl disaster, before the embrittlement problem was solved.

  13. Co Laser.

    DTIC Science & Technology

    1976-01-01

    newsletter setvice covering the moj-t recent research findings in 25 areas of industrial, technological , and sociological interest— invaluable information...service will be backdated to furnish you microfiche of reports issued earlier. Because of contractual arrangements with several Special Technology ...pressure electrical CO laser and, thereby, to develop the technology for high pres- sure, scalable, electric CO lasers exhibiting properties of

  14. Laser device

    DOEpatents

    Scott, Jill R.; Tremblay, Paul L.

    2008-08-19

    A laser device includes a virtual source configured to aim laser energy that originates from a true source. The virtual source has a vertical rotational axis during vertical motion of the virtual source and the vertical axis passes through an exit point from which the laser energy emanates independent of virtual source position. The emanating laser energy is collinear with an orientation line. The laser device includes a virtual source manipulation mechanism that positions the virtual source. The manipulation mechanism has a center of lateral pivot approximately coincident with a lateral index and a center of vertical pivot approximately coincident with a vertical index. The vertical index and lateral index intersect at an index origin. The virtual source and manipulation mechanism auto align the orientation line through the index origin during virtual source motion.

  15. High throughput laser processing

    SciTech Connect

    Harley, Gabriel; Pass, Thomas; Cousins, Peter John; Viatella, John

    2016-12-27

    A solar cell is formed using a solar cell ablation system. The ablation system includes a single laser source and several laser scanners. The laser scanners include a master laser scanner, with the rest of the laser scanners being slaved to the master laser scanner. A laser beam from the laser source is split into several laser beams, with the laser beams being scanned onto corresponding wafers using the laser scanners in accordance with one or more patterns. The laser beams may be scanned on the wafers using the same or different power levels of the laser source.

  16. Laser goniometer

    DOEpatents

    Fairer, George M.; Boernge, James M.; Harris, David W.; Campbell, DeWayne A.; Tuttle, Gene E.; McKeown, Mark H.; Beason, Steven C.

    1993-01-01

    The laser goniometer is an apparatus which permits an operator to sight along a geologic feature and orient a collimated lamer beam to match the attitude of the feature directly. The horizontal orientation (strike) and the angle from horizontal (dip), are detected by rotary incremental encoders attached to the laser goniometer which provide a digital readout of the azimuth and tilt of the collimated laser beam. A microprocessor then translates the square wave signal encoder outputs into an ASCII signal for use by data recording equipment.

  17. Laser propulsion

    NASA Technical Reports Server (NTRS)

    Rom, F. E.; Putre, H. A.

    1972-01-01

    The use of an earth-based high-power laser beam to provide energy for earth-launched rocket vehicle is investigated. The laser beam energy is absorbed in an opaque propellant gas and is converted to high-specific-impulse thrust by expanding the heated propellant to space by means of a nozzle. This laser propulsion scheme can produce specific impulses of several thousand seconds. Payload to gross-weight fractions about an order of magnitude higher than those for conventional chemical earth-launched vehicles appear possible. There is a potential for a significant reduction in cost per payload mass in earth orbit.

  18. Explosive laser

    DOEpatents

    Robinson, C.P.; Jensen, R.J.; Davis, W.C.; Sullivan, J.A.

    1975-09-01

    This patent relates to a laser system wherein reaction products from the detonation of a condensed explosive expand to form a gaseous medium with low translational temperature but high vibration population. Thermal pumping of the upper laser level and de-excitation of the lower laser level occur during the expansion, resulting in a population inversion. The expansion may be free or through a nozzle as in a gas-dynamic configuration. In one preferred embodiment, the explosive is such that its reaction products are CO$sub 2$ and other species that are beneficial or at least benign to CO$sub 2$ lasing. (auth)

  19. In-situ Fracture Studies and Modeling of the Toughening Mechanism Present in Wrought LCAC, TZM, and ODS Molybdenum Flat Products

    SciTech Connect

    Cockerman, B. V. and Chan, K. S.

    2007-07-01

    In-situ testing, ultrasonic C-scans, and metallography were used to show that a crack-divider delamination form of thin-sheet toughening occurs in wrought Low Carbon Arc Cast (LCAC) unalloyed molybdenum, Oxide Dispersion Strengthened (ODS) molybdenum, and TZM molybdenum at temperatures {ge} the Ductile to Brittle Transition Temperature (DBTT). Cracking along boundaries relieves mechanical constraint to free ligaments that may plastically stretch to produce toughening. Anisotropy in fracture toughness with lower values in the short-transverse direction is shown to produce the crack divider delaminations at the crack tip in the LT and TL orientations. The delamination zone increases with increasing stress-intensity to sizes significantly larger than the plastic zone, which leads to large increases in fracture toughness by the thin sheet toughening mechanism. Fracture in ODS Mo-alloys proceeds mainly along grain boundaries to produce small ligaments that exhibit ductility for both LT and TL orientations resulting in a lower DBTT and higher toughness values at lower temperatures than observed in LCAC and TZM. A combination of grain boundary fracture and cleavage is prevalent in LCAC molybdenum and TZM. The predominance for microcracking along grain boundaries to leave fine, ductile ligaments in ODS molybdenum can be attributed to a fine-grained microstructure with {approx} 1-2 {micro}m thickness of sheet-like grains. The presence of mixed grain boundary fracture and cleavage in LCAC and TZM can be attributed to a microstructure with a larger thickness of sheet-like grains (4-15 {micro}m).

  20. Preparation of magnetic ODS-PAN thin-films for microextraction of quetiapine and clozapine in plasma and urine samples followed by HPLC-UV detection.

    PubMed

    Li, Dan; Zou, Juan; Cai, Pei-Shan; Xiong, Chao-Mei; Ruan, Jin-Lan

    2016-06-05

    In this study, conventional thin-film microextraction (TFME) was endowed with magnetic by introducing superparamagnetic SiO2@Fe3O4 nanoparticles in thin-films. Novel magnetic octadecylsilane (ODS)-polyacrylonitrile (PAN) thin-films were prepared by spraying, and used for the microextraction of quetiapine and clozapine in plasma and urine samples, followed by the detection of HPLC-UV. The influencing factors on the extraction efficiency of magnetic ODS-PAN TFME, including pH, extraction time, desorption solvent, desorption time, and ion strength were investigated systematically. Under the optimal conditions, both analytes showed good linearity over ranges of 0.070-9.000μgmL(-1) and 0.012-9.000μgmL(-1) in plasma and urine samples, respectively, with correlation coefficients (R(2)) above 0.9990. Limits of detection (LODs) for quetiapine in plasma and urine samples were 0.013 and 0.003μgmL(-1), respectively. LODs for clozapine in plasma and urine samples were 0.015 and 0.003μgmL(-1), respectively. The relative standard deviations (RSDs) for quetiapine and clozapine were less than 9.23%. After the validation, the protocol was successfully applied for the determination of quetiapine and clozapine in patients' plasma and urine samples with satisfactory recoveries between 99-110%. The proposed magnetic ODS-PAN TFME was very simple, fast and easy to handle. It showed high potential as a powerful pretreatment technology for routine therapeutic drug monitoring (TDM) in plasma and urine samples.

  1. Effects of in vivo exposure to UV filters (4-MBC, OMC, BP-3, 4-HB, OC, OD-PABA) on endocrine signaling genes in the insect Chironomus riparius.

    PubMed

    Ozáez, Irene; Martínez-Guitarte, José Luis; Morcillo, Gloria

    2013-07-01

    There is increasing evidence indicating that several UV filters might have endocrine disruptive effects. Numerous studies have evaluated hormonal effects in vertebrates, mainly reporting estrogenic and androgenic activities in mammals and fishes. There is only limited knowledge about potential endocrine activity in invertebrate hormonal systems. In this work, the effects on endocrine signaling genes of six frequently used UV filters were investigated in Chironomus riparius, a reference organism in aquatic toxicology. The UV filters studied were: octyl-p-methoxycinnamate (OMC) also called 2-ethylhexyl-4-methoxycinnamate (EHMC); 4-methylbenzylidene camphor (4-MBC); benzophenone-3 (BP-3); 4-hidroxybenzophenone (4-HB); octocrylene (OC); and octyldimethyl-p-aminobenzoate (OD-PABA). After in vivo exposure at different dosages, expression levels of the genes coding for the ecdysone receptor (EcR), the ultraspiracle (usp, ortholog of the RXR) and the estrogen-related receptor (ERR) were quantified by Real Time PCR. The EcR gene was significantly upregulated by 4-MBC, OMC/EHMC and OD-PABA, with a dose-related response following 24h exposure. In contrast, the benzophenones, BP-3 and 4-HB, as well as OC did not alter this gene at the same exposure conditions. The transcription profiles of the usp and ERR genes were not significantly affected, except for BP-3 that inhibited the usp gene at the highest concentration. To our knowledge, this is the first experimental evidence in invertebrates of a direct effect of UV filters on endocrine-related genes, and is consistent with the known effects on vertebrate hormonal receptor genes. The capability of 4-MBC, OMC/EHMC and OD-PABA to stimulate the expression of the ecdysone receptor, a key transcription factor for the ecdysone-genomic response in arthropods, suggests the possibility of a broad and long-term effect on this hormonal pathway. These findings strengthen the need for further research about the ecotoxicological implications

  2. Simultaneous spectral and temporal analyses of kinetic energies in nonequilibrium systems: theory and application to vibrational relaxation of O-D stretch mode of HOD in water.

    PubMed

    Jeon, Jonggu; Lim, Joon Hyung; Kim, Seongheun; Kim, Heejae; Cho, Minhaeng

    2015-05-28

    A time series of kinetic energies (KE) from classical molecular dynamics (MD) simulation contains fundamental information on system dynamics. It can also be analyzed in the frequency domain through Fourier transformation (FT) of velocity correlation functions, providing energy content of different spectral regions. By limiting the FT time span, we have previously shown that spectral resolution of KE evolution is possible in the nonequilibrium situations [Jeon and Cho, J. Chem. Phys. 2011, 135, 214504]. In this paper, we refine the method by employing the concept of instantaneous power spectra, extending it to reflect an instantaneous time-correlation of velocities with those in the future as well as with those in the past, and present a new method to obtain the instantaneous spectral density of KE (iKESD). This approach enables the simultaneous spectral and temporal resolution of KE with unlimited time precision. We discuss the formal and novel properties of the new iKESD approaches and how to optimize computational methods and determine parameters for practical applications. The method is specifically applied to the nonequilibrium MD simulation of vibrational relaxation of the OD stretch mode in a hydrated HOD molecule by employing a hybrid quantum mechanical/molecular mechanical (QM/MM) potential. We directly compare the computational results with the OD band population relaxation time profiles extracted from the IR pump-probe measurements for 5% HOD in water. The calculated iKESD yields the OD bond relaxation time scale ∼30% larger than the experimental value, and this decay is largely frequency-independent if the classical anharmonicity is accounted for. From the integrated iKESD over intra- and intermolecular bands, the major energy transfer pathways were found to involve the HOD bending mode in the subps range, then the internal modes of the solvent until 5 ps after excitation, and eventually the solvent intermolecular modes. Also, strong hydrogen

  3. Experimental studies of the dissociative recombination processes for the dimethyl ether ions CD3OCD2+ and (CD3)2OD+

    NASA Astrophysics Data System (ADS)

    Hamberg, M.; Österdahl, F.; Thomas, R. D.; Zhaunerchyk, V.; Vigren, E.; Kaminska, M.; Af Ugglas, M.; Källberg, A.; Simonsson, A.; Paál, A.; Larsson, M.; Geppert, W. D.

    2010-05-01

    Aims: Determination of branching fractions, cross sections and thermal rate coefficients for the dissociative recombination of CD3OCD2+ (0-0.3 eV) and (CD3)2OD+ (0-0.2 eV) at the low relative kinetic energies encountered in the interstellar medium. Methods: The measurements were carried out using merged electron and ion beams at the CRYRING storage ring, Stockholm, Sweden. Results: For (CD3)2OD+ we have experimentally determined the branching fraction for ejection of a single hydrogen atom in the DR process to be maximally 7% whereas 49% of the reactions involve the break up of the COC chain into two heavy fragments and 44% ruptures both C-O bonds. The DR of CD3OCD2+ is dominated by fragmentation of the COC chain into two heavy fragments. The measured thermal rate constants and cross sections are k(T) = 1.7±0.5 × 10-6(T/300)-0.77±0.01 cm3 s-1, σ = 1.2±0.4 × 10-15(Ecm[eV])-1.27±0.01 cm2 and k(T) = 1.7±0.6 × 10-6(T/300)-0.70 ± 0.02 cm3 s-1, σ = 1.7±0.6 × 10-15(Ecm[eV])-1.20±0.02 cm2 for CD3OCD2+ and (CD3)2OD+, respectively.

  4. The rotational spectrum and dynamical structure of LiOH and LiOD: a combined laboratory and ab initio study.

    PubMed

    Higgins, Kelly J; Freund, Samuel M; Klemperer, William; Apponi, Aldo J; Ziurys, Lucy M

    2004-12-15

    Millimeter wave rotational spectroscopy and ab initio calculations are used to explore the potential energy surface of LiOH and LiOD with particular emphasis on the bending states and bending potential. New measurements extend the observed rotational lines to J=7<--6 for LiOH and J=8<--7 for LiOD for all bending vibrational states up to (03(3)0). Rotation-vibration energy levels, geometric expectation values, and dipole moments are calculated using extensive high-level ab initio three-dimensional potential energy and dipole moment surfaces. Agreement between calculation and experiment is superb, with predicted Bv values typically within 0.3%, D values within 0.2%, ql values within 0.7%, and dipole moments within 0.9% of experiment. Shifts in Bv values with vibration and isotopic substitution are also well predicted. A combined theoretical and experimental structural analysis establishes the linear equilibrium structure with re(Li-O)=1.5776(4) A and re(O-H)=0.949(2) A. Predicted fundamental vibrational frequencies are v1=923.2, v2=318.3, and v3=3829.8 cm(-1) for LiOH and v1=912.9, v2=245.8, and v3=2824.2 cm(-1) for LiOD. The molecule is extremely nonrigid with respect to angular deformation; the calculated deviation from linearity for the vibrationally averaged structure is 19.0 degrees in the (000) state and 41.9 degrees in the (03(3)0) state. The calculation not only predicts, in agreement with previous work [P. R. Bunker, P. Jensen, A. Karpfen, and H. Lischka, J. Mol. Spectrosc. 135, 89 (1989)], a change from a linear to a bent minimum energy configuration at elongated Li-O distances, but also a similar change from linear to bent at elongated O-H distances.

  5. [The search for "od." Karl Ludwig Freiheer von Reichenbach (1788-1869) and Karl Wilhelm Mayrhofer (1806-1853), two joined against Justus von Liebig].

    PubMed

    Habacher, M

    1980-05-01

    The author describes the controversy between Justus von Liebig on one side and Reichenbach and Mayrhofer on the other side. It is a controversy about problems of science and medicine which are characteristic for the late 18th and the first half of the 19th century, when Mesmerism and similar ideas of occultic and comparative phenomenona were discussed and often refused as being "not scientific". Justus von Liebig and Karl Ludwig Freiherr von Reichenbach were both chemists, both interested in scientific progress and working in this field. They were friends in the years 1830 to 1848. But later on this friendship ended when Reichenbach--who in the mean time moved to Vienna--became more and more interested in phenomenons seen by sensitive persons concerning effects of light. Although Reichenbach himself was not able to recognize the phenomenons he was sure that other persons had this ability. He had the impression that there is a special force floating through the universe, and this force he called "od". Liebig, who was not able to follow this theory and rejected it has speculation, turned against Reichenbach in 1852-3. So the controversy began and their old friendship came to an end. Reichenbach's theory of the "od", characteristic for the time of the romanticism and leading back to Mesmerism was accepted and supported by the Austrian physician Dr. Karl Wilhelm Mayrhofer who had aroused his interest by describing similar phenomenos some of this patients had. The letters of both men, the chemist and the doctor, which are well preserved (Technical Museum of Vienna) and discussed here, give a good impression of Reichenbach's ideas concerning his theory of the "od" and his philosophical ideas. As Reichenbach tried to find a philosophy corresponding to his theory and as he meant to have found this in the philosophy of Friedrich Eduard Beneke his remarks in those letters give a good information about Beneke's discussion of Reichenbach's theory. Mayrhofer, on the other hand

  6. Fatigue properties of MA 6000E, a gamma-prime strengthened ODS alloy. [Oxide Dispersion Strengthened Ni-base alloy for gas turbine blade applications

    NASA Technical Reports Server (NTRS)

    Kim, Y. G.; Merrick, H. F.

    1980-01-01

    MA 6000E is a corrosion resistant, gamma-prime strengthened ODS alloy under development for advanced turbine blade applications. The high temperature, 1093 C, rupture strength is superior to conventional nickel-base alloys. This paper addresses the fatigue behavior of the alloy. Excellent properties are exhibited in low and high cycle fatigue and also thermal fatigue. This is attributed to a unique combination of microstructural features, i.e., a fine distribution of dispersed oxides and other nonmetallics, and the highly elongated grain structure which advantageously modify the deformation characteristics and crack initiation and propagation modes from that characteristic of conventional gamma-prime hardened superalloys.

  7. [Laser myringotomy].

    PubMed

    Hassmann-Poznańska, Elzbieta; Skotnicka, Bozena

    2002-01-01

    The aim of the study was assessment of the qualities of laser-assisted myringotomy (LAM) as a treatment for acute and secretory otitis media. Laser-assisted myringotomy was performed on 65 children (113 ears) mean age 6.2 years diagnosed with secretory otitis media (80%), recurrent secretory otitis media (11%) and acute otitis media (9%). Myringotomy was performed under general anesthesia using the OtoLAM device (ESC/Sharplan, Israel). In 64 ears pressure equalisation tubes were inserted after fenestration of the tympanic membrane with laser. Adenoidectomy alone or with tonsillectomy was performed at the same time in 51 cases. Laser tympanostomies remained patent for 7-32 days. All tympanostomies healed with no noticeable scarring. LAM appears to be a safe, and easy to performed, alternative technique in the treatment of otitis media.

  8. Laser fusion

    SciTech Connect

    Smit, W.A.; Boskma, P.

    1980-12-01

    Unrestricted laser fusion offers nations an opportunity to circumvent arms control agreements and develop thermonuclear weapons. Early laser weapons research sought a clean radiation-free bomb to replace the fission bomb, but this was deceptive because a fission bomb was needed to trigger the fusion reaction and additional radioactivity was induced by generating fast neutrons. As laser-implosion experiments focused on weapons physics, simulating weapons effects, and applications for new weapons, the military interest shifted from developing a laser-ignited hydrogen bomb to more sophisticated weapons and civilian applications for power generation. Civilian and military research now overlap, making it possible for several countries to continue weapons activities and permitting proliferation of nuclear weapons. These countries are reluctant to include inertial confinement fusion research in the Non-Proliferation Treaty. 16 references. (DCK)

  9. Laser barometer

    SciTech Connect

    Abercrombie, K.R.; Shiels, D.; Rash, T.

    1998-04-01

    This paper describes an invention of a pressure measuring instrument which uses laser radiation to sense the pressure in an enclosed environment by means of measuring the change in refractive index of a gas - which is pressure dependent.

  10. Laser Cutting

    DTIC Science & Technology

    1988-06-01

    lasers that are optically modified to produce high beam quality at reduced power levels for precision drilling and trepanning. * Nd:YAG lasers with...a smooth, dross-free cut face while the marking consists of a series of precisely placed shallow pits where surface finish and dross are not usually...neodymium:yttrium-aluminum-garnet (Nd:YAG) pulsed cutting data because the technique is considered vital in meeting the detailed precision cutting

  11. Laser Technology

    NASA Technical Reports Server (NTRS)

    1989-01-01

    Amoco Laser Company, a subsidiary of Amoco Corporation, has developed microlasers for the commercial market based on a JPL concept for optical communications over interplanetary distances. Lasers emit narrow, intense beams of light or other radiation. The beams transmit communication signals, drill, cut or melt materials or remove diseased body tissue. The microlasers cover a broad portion of the spectrum, and performance is improved significantly. Current applications include medical instrumentation, color separation equipment, telecommunications, etc.

  12. Laser Angioplasty

    NASA Technical Reports Server (NTRS)

    1990-01-01

    The principal method of dealing with coronary artery blockage is bypass surgery. A non-surgical alternative available to some patients is balloon angioplasty. For several years, medical researchers have been exploring another alternative that would help a wider circle of patients than the balloon treatment and entail less risk than bypass surgery. A research group is on the verge of an exciting development: laser angioplasty with a 'cool' type of laser, called an excimer laser, that does not damage blood vessel walls and offers non-surgical cleansing of clogged arteries with extraordinary precision. The system is the Dymer 200+ Excimer Laser Angioplasty System, developed by Advanced Intraventional Systems. Used in human clinical tests since 1987, the system is the first fully integrated 'cool' laser capable of generating the requisite laser energy and delivering the energy to target arteries. Thirteen research hospitals in the U.S. have purchased Dymer 200+ systems and used them in clinical trials in 121 peripheral and 555 coronary artery cases. The success rate in opening blocked coronary arteries is 85 percent, with fewer complications than in balloon angioplasty. Food and Drug Administration approval for the system is hoped for in the latter part of 1990. * Advanced Intraventional Systems became Spectranetics in 1994 and discontinued the product.

  13. Laser optomechanics

    PubMed Central

    Yang, Weijian; Adair Gerke, Stephen; Wei Ng, Kar; Rao, Yi; Chase, Christopher; Chang-Hasnain, Connie J.

    2015-01-01

    Cavity optomechanics explores the interaction between optical field and mechanical motion. So far, this interaction has relied on the detuning between a passive optical resonator and an external pump laser. Here, we report a new scheme with mutual coupling between a mechanical oscillator supporting the mirror of a laser and the optical field generated by the laser itself. The optically active cavity greatly enhances the light-matter energy transfer. In this work, we use an electrically-pumped vertical-cavity surface-emitting laser (VCSEL) with an ultra-light-weight (130 pg) high-contrast-grating (HCG) mirror, whose reflectivity spectrum is designed to facilitate strong optomechanical coupling, to demonstrate optomechanically-induced regenerative oscillation of the laser optomechanical cavity. We observe >550 nm self-oscillation amplitude of the micromechanical oscillator, two to three orders of magnitude larger than typical, and correspondingly a 23 nm laser wavelength sweep. In addition to its immediate applications as a high-speed wavelength-swept source, this scheme also offers a new approach for integrated on-chip sensors. PMID:26333804

  14. Tri-wave laser therapy for spinal cord injury, neuropathic pain management, and restoration of motor function

    NASA Astrophysics Data System (ADS)

    Chariff, Mark D.; Olszak, Peter

    2015-03-01

    A laser therapy device using three combined wavelengths 532nm, 808nm, and 1064nm has been demonstrated in clinical studies. Primarily, therapeutic lasers have used wavelengths in the ranges of 632nm through 1064nm, where the optical density (OD) < 5, to achieve pain relief and tissue regeneration. Conventional wisdom would argue against using wavelengths in the region of 532nm, due to poor penetration (OD ~ 8); however, the author's observations are to the contrary. The 532nm light is efficiently absorbed by chromophores such as oxyhemoglobin, deoxyhemoglobin, and cytochrome c oxidase thereby providing energy to accelerate the healing process. The 808nm light is known to result in Nitric Oxide production thereby reducing inflammation and oxidative stress. All three laser wavelengths likely contribute to pain relief by inhibiting nerve conduction; however, the 1064nm has the deepest penetration. Through the use of this device on over 1000 patients with a variety of acute and chronic neuro-musculoskeletal disorders, the author observed that a majority of these individuals experienced rapid relief from their presenting conditions and most patients reported a tingling sensation upon irradiation. Patient testimonials and thermal images have been collected to document the results of the laser therapy. These studies demonstrate the ability of laser therapy to rapidly alleviate pain from both acute and chronic conditions.

  15. Laser Physics and Laser Spectroscopy.

    DTIC Science & Technology

    1986-03-01

    effect which limits the power throughout of a device; terbium qallium garnet (TGG), a Faraday isolator material; potassium niobate (KNbO 31 a nonlinear...extending the range of materials grown in fiber form. Two materials to be emphasized are terbium gallium garnet for optical isolators and potassium niobate...for doubling gallium arsenide diode lasers. References 1. R.H. Stolen, "Fiber Raman Lasers", Fiber and Integrated Optics, 3 (1980). 2. E. Ipoen and

  16. Latent tracks of swift heavy ions in Сr23C6 and Y-Ti-O nanoparticles in ODS alloys

    NASA Astrophysics Data System (ADS)

    Skuratov, V. A.; Sohatsky, A. S.; O'Connell, J. H.; Kornieieva, K.; Nikitina, A. A.; Uglov, V. V.; Neethling, J. H.; Ageev, V. S.

    2016-05-01

    The radiation stability of dielectric nanoparticles embedded into a metallic matrix is of considerable practical value due to the growing interest in oxide dispersion strengthened (ODS) steels as promising nuclear reactor materials. In this report the results of a TEM study of structural changes in Cr23C6 and Y-Ti-O nanoparticles in several ODS alloys irradiated with 1.2 MeV/amu Xe and 3.4 MeV/amu Bi ions is presented. It was found that swift heavy ion irradiation leads to the formation of amorphous latent tracks in both materials. The upper limit of the threshold electronic stopping power for track formation in carbides is estimated to be around 35 keV/nm. Multiple ion track overlapping leads to complete amorphization of carbide and Y-Ti oxide nanoparticles. Microstructural analysis have revealed a strong influence of the ferritic matrix on track morphology in Y2Ti2O7 nanoparticles in pre-thinned TEM targets after postradiation annealing and irradiation at elevated temperatures.

  17. "Candidatus Sonnebornia yantaiensis", a member of candidate division OD1, as intracellular bacteria of the ciliated protist Paramecium bursaria (Ciliophora, Oligohymenophorea).

    PubMed

    Gong, Jun; Qing, Yao; Guo, Xiaohong; Warren, Alan

    2014-02-01

    An intracellular bacterium was discovered in an isolate of Paramecium bursaria from a freshwater pond in Yantai, China. The bacteria were abundant and exclusively found in the cytoplasm of the host which, along with the green alga Chlorella, formed a three-partner consortium that could survive in pure water for at least one week. Cloning, sequencing and phylogenetic analysis of the bacterial 16S rRNA gene showed that the bacterium belonged to the uncultured candidate division OD1, which usually forms part of the rare biosphere. Transmission electron microscopy and fluorescence in situ hybridization (FISH) with specific probes showed that the bacteria were usually located close to the perialgal membranes of endosymbiotic Chlorella cells, and occasionally irregularly distributed throughout the host cytoplasm. The name "Candidatus Sonnebornia yantaiensis" gen. nov., sp. nov. is proposed for the new bacterium. A strongly supported monophyletic subclade, OD1-p, which included the new species, was recognized and this study highlights that protists can be important hosts for rare bacterial taxa.

  18. The Structure of High Pressure Ca(OD) 2II from Powder Neutron Diffraction: Relationship to the ZrO 2and EuI 2Structures

    NASA Astrophysics Data System (ADS)

    Leinenweber, Kurt; Partin, Dan E.; Schuelke, Udo; O'Keeffe, Michael; Von Dreele, Robert B.

    1997-09-01

    The "unquenchable" high pressure form of Ca(OD) 2[Ca(OH) 2II] has been synthesized at 9 GPa and 400°C and recovered to ambient pressure at cryogenic temperatures. The structure was determined from powder neutron diffraction data using the Rietveld technique. The symmetry is monoclinic P2 1/ cwith a=5.3979(4) Å, b=6.0931(4) Å, c=5.9852(4) Å, β=103.581(6)°, Z=4 at 1 atm and 11 K. Rwp=2.8%, Rp=1.9%, reduced χ2=6.6. for 117 variables. The calcium and oxygen substructure is intermediate between that in α-PbO 2and that in fluorite; it was previously described as isostructural with baddeleyite (ZrO 2), but it is more accurately described as isostructural with EuI 2. This structure is distinguished by the presence of a 3 6anion net parallel to (100). Only one of the two kinds of D atoms in the structure shows appreciable hydrogen bonding to O, with a second neighbor D … O distance of 1.91 Å, and an O-D … O angle of 153.2°; the other D atom has 3 second-neighbor oxygens near 2.6 Å away.

  19. HRTEM Study of Oxide Nanoparticles in 16Cr-4Al-2W-0.3Ti-0.3Y2O3 ODS Steel

    SciTech Connect

    Hsiung, L; Fluss, M; Wall, M; Kimura, A

    2009-11-18

    Crystal and interfacial structures of oxide nanoparticles in 16Cr-4Al-2W-0.3Ti-0.3Y{sub 2}O{sub 3} ODS ferritic steel have been examined using high-resolution transmission electron microscopy (HRTEM) techniques. Oxide nanoparticles with a complex-oxide core and an amorphous shell were frequently observed. The crystal structure of complex-oxide core is identified to be mainly monoclinic Y{sub 4}Al{sub 2}O{sub 9} (YAM) oxide compound. Orientation relationships between the oxide and matrix are found to be dependent on the particle size. Large particles (> 20 nm) tend to be incoherent and have a spherical shape, whereas small particles (< 10 nm) tend to be coherent or semi-coherent and have a faceted interface. The observations of partially amorphous nanoparticles lead us to propose three-stage mechanisms to rationalize the formation of oxide nanoparticles containing core/shell structures in as-fabricated ODS steels.

  20. Numerical determination of non-Langmuirian adsorption isotherms of ibuprofen enantiomers on Chiralcel OD column using ultraviolet-circular dichroism dual detector.

    PubMed

    Li, Hui; Jiang, Xiaoxiao; Xu, Wei; Chen, Yongtao; Yu, Weifang; Xu, Jin

    2016-02-26

    Competitive adsorption isotherm of ibuprofen enantiomers on Chiralcel OD stationary phase at 298K was determined by the application of inverse method. Transport dispersive (TD) chromatography model was used to describe mass balances of the enatiomers. Axial dispersion and mass transfer coefficients were estimated from a series of linear pulse experiments. It was found that the overloaded elution profile of total concentration of racemic ibuprofen cannot be satisfactorily fitted by substituting bi-Langmuir model, the most widely used isotherm model for enantiomers, into TD model and tuning the isotherm parameters. UV-CD dual detector setup was then applied to obtain the individual overloaded elution profiles of both enantiomers. The more informative experimental data revealed non-Langmuirian adsorption behavior of ibuprofen enantiomers on chiralcel OD stationary phase. Two analytical binary isotherm models, both accounting for adsorbate-adsorbate interactions and having the feature of inflection points, were then evaluated. A comparison between quadratic model and Moreau model showed that the former gives better fitting results. The six parameters involved in quadratic model were determined stepwisely. Three of them were first obtained by fitting overloaded elution profiles of S-ibuprofen. The other three were then acquired by fitting overloaded elution profiles of both enantiomers recorded by UV-CD dual detector for racemic ibuprofen. A further attempt was also made at reducing the number of quadratic model parameters.

  1. Laser therapy for cancer

    MedlinePlus

    ... this page: //medlineplus.gov/ency/patientinstructions/000905.htm Laser therapy for cancer To use the sharing features ... Lasers are also used on the skin. How Laser Therapy is Used Laser therapy can be used ...

  2. Laser beam monitoring system

    DOEpatents

    Weil, Bradley S.; Wetherington, Jr., Grady R.

    1985-01-01

    Laser beam monitoring systems include laser-transparent plates set at an angle to the laser beam passing therethrough and light sensor for detecting light reflected from an object on which the laser beam impinges.

  3. Laser Physics and Laser-Tissue Interaction

    PubMed Central

    Welch, A. J.; Torres, Jorge H.; Cheong, Wai-Fung

    1989-01-01

    Within the last few years, lasers have gained increasing use in the management of cardiovascular disease, and laser angioplasty has become a widely performed procedure. For this reason, a basic knowledge of lasers and their applications is essential to vascular surgeons, cardiologists, and interventional radiologists. To elucidate some fundamental concepts regarding laser physics, we describe how laser light is generated and review the properties that make lasers useful in medicine. We also discuss beam profile and spotsize, as well as dosimetric specifications for laser angioplasty. After considering laser-tissue interaction and light propagation in tissue, we explain how the aforementioned concepts apply to direct laser angioplasty and laser-balloon angioplasty. An understanding of these issues should prove useful not only in performing laser angioplasty but in comparing the reported results of various laser applications. (Texas Heart Institute Journal 1989;16:141-9) PMID:15227198

  4. Laser acceleration

    NASA Astrophysics Data System (ADS)

    Tajima, T.; Nakajima, K.; Mourou, G.

    2017-02-01

    The fundamental idea of Laser Wakefield Acceleration (LWFA) is reviewed. An ultrafast intense laser pulse drives coherent wakefield with a relativistic amplitude robustly supported by the plasma. While the large amplitude of wakefields involves collective resonant oscillations of the eigenmode of the entire plasma electrons, the wake phase velocity ˜ c and ultrafastness of the laser pulse introduce the wake stability and rigidity. A large number of worldwide experiments show a rapid progress of this concept realization toward both the high-energy accelerator prospect and broad applications. The strong interest in this has been spurring and stimulating novel laser technologies, including the Chirped Pulse Amplification, the Thin Film Compression, the Coherent Amplification Network, and the Relativistic Mirror Compression. These in turn have created a conglomerate of novel science and technology with LWFA to form a new genre of high field science with many parameters of merit in this field increasing exponentially lately. This science has triggered a number of worldwide research centers and initiatives. Associated physics of ion acceleration, X-ray generation, and astrophysical processes of ultrahigh energy cosmic rays are reviewed. Applications such as X-ray free electron laser, cancer therapy, and radioisotope production etc. are considered. A new avenue of LWFA using nanomaterials is also emerging.

  5. Laser construction

    SciTech Connect

    Martin, D.W.; Osterhage, R.J.; Summa, K.M.

    1989-02-14

    A laser device is described comprising an elongated laser medium of crystal material having a cylindrical shape modified to have a flat face formed on one side thereof, a highly heat conducting mounting member having a flat surface on a portion thereof, the medium being mounted on the mounting member with the flat face of the medium in face-to-face relation with the flat surface on the mounting member, a heat sink member having a surface for attaching the mounting member to, a pump source including an array of laser diodes each having opposite ends and positioned in side-by-side single file relation, a second highly heat conducting mounting member having a surface on which the array of laser diodes is positioned, the second mounting member being mounted on the heat sink member wherein the array of laser diodes are in substantial alignment with the axis of the medium along the side thereof opposite from the flat face of the medium.

  6. Tunable solid state lasers

    SciTech Connect

    Hammerling, R.; Budgor, A.B.; Pinto, A.

    1985-01-01

    This book presents the papers given at a conference on solid state lasers. Topics considered at the conference included transition-metal-doped lasers, line-narrowed alexandrite lasers, NASA specification, meteorological lidars, laser materials spectroscopy, laser pumped single pass gain, vibronic laser materials growth, crystal growth methods, vibronic laser theory, cross-fertilization through interdisciplinary fields, and laser action of color centers in diamonds.

  7. Laser cosmology

    NASA Astrophysics Data System (ADS)

    Chen, P.

    2014-05-01

    Recent years have witnessed tremendous progress in our understanding of the cosmos, which in turn points to even deeper questions to be further addressed. Concurrently the laser technology has undergone dramatic revolutions, providing exciting opportunity for science applications. History has shown that the symbiosis between direct observations and laboratory investigation is instrumental in the progress of astrophysics. We believe that this remains true in cosmology. Current frontier phenomena related to particle astrophysics and cosmology typically involve one or more of the following conditions: (1) extremely high energy events;(2) very high density, high temperature processes; (3) super strong field environments. Laboratory experiments using high intensity lasers can calibrate astrophysical observations, investigate underlying dynamics of astrophysical phenomena, and probe fundamental physics in extreme limits. In this article we give an overview of the exciting prospect of laser cosmology. In particular, we showcase its unique capability of investigating frontier cosmology issues such as cosmic accelerator and quantum gravity.

  8. Laser barometer

    DOEpatents

    Abercrombie, Kevin R.; Shiels, David; Rash, Tim

    2001-02-06

    A pressure measuring instrument that utilizes the change of the refractive index of a gas as a function of pressure and the coherent nature of a laser light to determine the barometric pressure within an environment. As the gas pressure in a closed environment varies, the index of refraction of the gas changes. The amount of change is a function of the gas pressure. By illuminating the gas with a laser light source, causing the wavelength of the light to change, pressure can be quantified by measuring the shift in fringes (alternating light and dark bands produced when coherent light is mixed) in an interferometer.

  9. Excimer lasers

    NASA Technical Reports Server (NTRS)

    Palmer, A. J.; Hess, L. D.; Stephens, R. R.

    1976-01-01

    A theoretical and experimental investigation into the possibility of achieving CW discharge pumped excimer laser oscillation is reported. Detailed theoretical modeling of capillary discharge pumping of the XeF and KXe and K2 excimer systems was carried out which predicted the required discharge parameters for reaching laser threshold on these systems. Capillary discharge pumping of the XeF excimer system was investigated experimentally. The experiments revealed a lower excimer level population density than predicted theoretically by about an order of magnitude. The experiments also revealed a fluorine consumption problem in the discharge in agreement with theory.

  10. Graviton laser

    NASA Astrophysics Data System (ADS)

    Landry, A.; Paranjape, M. B.

    2016-08-01

    We consider the possibility of creating a graviton laser. The lasing medium would be a system of contained, ultra cold neutrons. Ultra cold neutrons are a quantum mechanical system that interacts with gravitational fields and with the phonons of the container walls. It is possible to create a population inversion by pumping the system using the phonons. We compute the rate of spontaneous emission of gravitons and the rate of the subsequent stimulated emission of gravitons. The gain obtainable is directly proportional to the density of the lasing medium and the fraction of the population inversion. The applications of a graviton laser would be interesting.

  11. Laser Resonator

    NASA Technical Reports Server (NTRS)

    Harper, L. L. (Inventor)

    1983-01-01

    An optical resonator cavity configuration has a unitary mirror with oppositely directed convex and concave reflective surfaces disposed into one fold and concertedly reversing both ends of a beam propagating from a laser rod disposed between two total internal reflection prisms. The optical components are rigidly positioned with perpendicularly crossed virtual rooflines by a compact optical bed. The rooflines of the internal reflection prisms, are arranged perpendicularly to the axis of the laser beam and to the optical axes of the optical resonator components.

  12. Capabilities to improve corrosion resistance of fuel claddings by using powerful laser and plasma sources

    NASA Astrophysics Data System (ADS)

    Borisov, V. M.; Trofimov, V. N.; Sapozhkov, A. Yu.; Kuzmenko, V. A.; Mikhaylov, V. B.; Cherkovets, V. Ye.; Yakushkin, A. A.; Yakushin, V. L.; Dzhumayev, P. S.

    2016-12-01

    The treatment conditions of fuel claddings of the E110 alloy by using powerful UV or IR laser radiation, which lead to the increase in the corrosion resistance at the high-temperature ( T = 1100°C) oxidation simulating a loss-of-coolant accident, are determined. The possibility of the complete suppression of corrosion under these conditions by using pulsed laser deposition of a Cr layer is demonstrated. The behavior of protective coatings of Al, Al2O3, and Cr planted on steel EP823 by pulsed laser deposition, which is planned to be used in the BREST-OD-300, is studied. The methods of the almost complete suppression of corrosion in liquid lead to the temperature of 720°C are shown.

  13. An integrated fiber and stone basket device for use in Thulium fiber laser lithotripsy

    NASA Astrophysics Data System (ADS)

    Wilson, Christopher R.; Hutchens, Thomas C.; Hardy, Luke A.; Irby, Pierce B.; Fried, Nathaniel M.

    2014-03-01

    The Thulium fiber laser (TFL) is being explored as an alternative laser lithotripter to the Holmium:YAG laser. The TFL's superior near-single mode beam profile enables higher power transmission through smaller fibers with reduced proximal fiber tip damage. Recent studies have also reported that attaching hollow steel tubing to the distal fiber tip decreases fiber degradation and burn-back without compromising stone ablation rates. However, significant stone retropulsion was observed, which increased with pulse rate. In this study, the hollow steel tip fiber design was integrated with a stone basket to minimize stone retropulsion during ablation. A device was constructed consisting of a 100-μm-core, 140-μm-OD silica fiber outfitted with 5-mm-long stainless steel tubing at the distal tip, and integrated with a 1.3-Fr (0.433-mm-OD) disposable nitinol wire basket, to form an overall 1.9-Fr (0.633-mm- OD) integrated device. This compact design may provide several potential advantages including increased flexibility, higher saline irrigation rates through the ureteroscope working channel, and reduced fiber tip degradation compared to separate fiber and stone basket manipulation. TFL pulse energy of 31.5 mJ with 500 μs pulse duration and pulse rate of 500 Hz was delivered through the integrated fiber/basket device in contact with human uric acid stones, ex vivo. TFL stone ablation rates measured 1.5 +/- 0.2 mg/s, comparable to 1.7 +/- 0.3 mg/s (P > 0.05) using standard bare fiber tips separately with a stone basket. With further development, this device may be useful for minimizing stone retropulsion, thus enabling more efficient TFL lithotripsy at higher pulse rates.

  14. Development of Irradiation hardening of Unalloyed and ODS molybdenum during neurtron irradiation to low doses at 300C and 600C

    SciTech Connect

    B. V. Cockeran, R. W. Smith, L.L. Snead

    2007-11-21

    Unalloyed molybdenum and Oxide Dispersion Strengthened (ODS) molybdenum were irradiated at 300 C and 600 C in the high flux isotope reactor (HFIR) to neutron fluences of 0.2, 2.1, and 24.3 x 10{sup 24} n/m{sup 2} (E > 0.1 MeV), producing damage levels of 0.01, 0.1 and 1.3 Mo-dpa. Hardness measurements, electrical resistivity measurements, tensile testing, and Transmission Electron Microscopy (TEM) were used to assess the defect structure. Irradiation hardening was evident even at a damage level of 0.01 dpa resulting in a significant increase in yield stress, decrease in ductility, and elevation of the Ductile-to-Brittle Transition Temperature (DBTT). The observed size and number density of voids and loops as well as the measured irradiation hardening and electrical resistivity were found to increase sub-linearly with fluence over the range of exposure investigated. This supports the idea that the formation of the extended defects that produce irradiation hardening in molybdenum are the result of a nucleation and growth process rather than the formation of sessile defects directly from the displacement damage cascades. The formation of sessile defect clusters in the displacement cascade would be expected to result in a linear fluence dependence for the number density of defects followed by saturation at fluences less than 1-dpa. This conclusion is supported by Molecular Dynamics (MD) simulations of cascade damage which do not reveal large clusters forming directly as a result of the short-term collapse of the cascade. The finer grain size for the unalloyed Mo and ODS Mo compared to Low Carbon Arc Cast molybdenum results in slightly less irradiation hardening and slightly lower DBTT values. The unalloyed molybdenum used in this work had a low impurity interstitial content that correlates with a slightly lower void size and void number density, less irradiation hardening and lower change in electrical resistivity in this fluence range than is observed for ODS Mo

  15. Performance analysis of continuous tracking laser Doppler vibrometry applied to rotating structures in coast-down

    NASA Astrophysics Data System (ADS)

    Martarelli, M.; Castellini, P.

    2012-06-01

    In this paper a performance analysis of the so-called tracking continuous scanning laser Doppler vibrometry (TCSLDV) exploited in coast-down has been performed. This non-contact measurement system is able to scan continuously over a rotating surface during coast-down and to determine vibration operational deflection shapes (ODSs) and natural frequencies in short time, i.e. the temporal extent of the coast-down. The method is based on a laser Doppler vibrometer (LDV) whose laser beam is driven to scan continuously over the whole rotor surface synchronously with its rotation, so that the LDV output is modulated by the structure's ODSs. This technique has a full-field nature that enables it to measure simultaneously the time and spatial dependence of the vibration in a unique measurement. However, the TCSLDV presents some criticalities in practical applications, especially when applied to rotary transient and fast processes. In fact, if the vibration is transient and decays very fast, then the laser beam could not have had the time to scan the complete structure surface and the modulation of the ODS could be partial. An analytical model reproducing a representative experiment has been developed in order to evaluate the sensitivity of results to testing conditions. The laser beam trajectory in both the fixed and rotating reference systems has been synthesized showing its dependence on experimental parameters as the rotation speed variation during coast-down. It has been demonstrated the decrease in speed induces the deformation of the laser trajectory influencing the LDV output time history, spectrum and consequently the recovered ODS.

  16. Excimer lasers

    NASA Technical Reports Server (NTRS)

    Palmer, A. J.; Hess, L. D.; Stephens, R. R.; Pepper, D. M.

    1977-01-01

    The results of a two-year investigation into the possibility of developing continuous wave excimer lasers are reported. The program included the evaluation and selection of candidate molecular systems and discharge pumping techniques. The K Ar/K2 excimer dimer molecules and the xenon fluoride excimer molecule were selected for study; each used a transverse and capillary discharges pumping technique. Experimental and theoretical studies of each of the two discharge techniques applied to each of the two molecular systems are reported. Discharge stability and fluorine consumption were found to be the principle impediments to extending the XeF excimer laser into the continuous wave regime. Potassium vapor handling problems were the principal difficulty in achieving laser action on the K Ar/K2 system. Of the four molecular systems and pumping techniques explored, the capillary discharge pumped K Ar/K2 system appears to be the most likely candidate for demonstrating continuous wave excimer laser action primarily because of its predicted lower pumping threshold and a demonstrated discharge stability advantage.

  17. Laser Balancing

    NASA Astrophysics Data System (ADS)

    1981-01-01

    Mechanical Technology, Incorporated developed a fully automatic laser machining process that allows more precise balancing removes metal faster, eliminates excess metal removal and other operator induced inaccuracies, and provides significant reduction in balancing time. Manufacturing costs are reduced as a result.

  18. Selective fluorescence functionalization of dye-doped polymerized structures fabricated by direct laser writing (DLW) lithography

    NASA Astrophysics Data System (ADS)

    de Miguel, Gustavo; Vicidomini, Giuseppe; Duocastella, Martí; Diaspro, Alberto

    2015-11-01

    The continuous development of the vast arsenal of fabrication techniques is a pivotal factor in the breakthrough of nanotechnology. Although the broad interest is generally focused on the reduction of the dimensions of the fabricated structures, localized functionalization of the nanomaterials emerges as a key factor closely linked to their potential applications. In particular, fabrication of spatially selective fluorescence nanostructures is highly demanded in nanophotonics, as for example in three-dimensional (3D) optical data storage (ODS), where massive storage capacity and fast writing-reading processes are promised. We have developed an innovative method to control the location and intensity of the fluorescence signal in dye-doped photopolymerized structures fabricated with Direct Laser Writing (DLW) lithography. Well-defined fluorescent pixels (area = 0.24 μm2) were written inside a polymer matrix with the help of a femtosecond pulsed laser (multiphoton absorption) via a thermally-induced di-aggregation of a fluorescent dye. Moreover, we have accomplished a fine control of the fluorescence intensity which can increase the storage capacity of ODS systems fabricated with this approach.The continuous development of the vast arsenal of fabrication techniques is a pivotal factor in the breakthrough of nanotechnology. Although the broad interest is generally focused on the reduction of the dimensions of the fabricated structures, localized functionalization of the nanomaterials emerges as a key factor closely linked to their potential applications. In particular, fabrication of spatially selective fluorescence nanostructures is highly demanded in nanophotonics, as for example in three-dimensional (3D) optical data storage (ODS), where massive storage capacity and fast writing-reading processes are promised. We have developed an innovative method to control the location and intensity of the fluorescence signal in dye-doped photopolymerized structures fabricated

  19. An unusual case of OD-allotwinning: 9,9′-(2,5-dibromo-1,4-phenylene)bis[9H-carbazole

    PubMed Central

    Kautny, Paul; Schwartz, Thomas; Fröhlich, Johannes

    2017-01-01

    9,9′-(2,5-Dibromo-1,4-phenylene)bis[9H-carbazole] (1) crystallizes as a category I order–disorder (OD) structure composed of non-polar layers of one kind with B2/m(1)1 layer symmetry. The crystals are made up of the two polytypes with a maximum degree of order (MDO). The monoclinic MDO1 polytype (B21/d) possesses an orthorhombic B-centered lattice and appears in two orientations, which are related by reflection at (100). The orthorhombic MDO2 polytype (F2dd) has a doubled b-axis and appears in two orientations, which are related by inversion. The crystal structures of both polytypes were determined in a concurrent refinement. The MDO1:MDO2 ratio is 69:31.

  20. Vibrational Coupling Pathways in the CH Stretch Region of CH_3OH and CH_3OD as Revealed by IR and Ftmw-Ir Spectroscopies

    NASA Astrophysics Data System (ADS)

    Twagirayezu, Sylvestre; Wang, Xiaoliang; Perry, David S.; Neill, Justin L.; Muckle, Matt T.; Pate, Brooks H.; Xu, Li-Hong

    2011-06-01

    Infrared spectra of jet-cooled CH_3OD and CH_3OH in the CH stretch region are observed by coherence-converted population transfer Fourier transform microwave-infrared (CCPT-FTMW-IR) spectroscopy (E torsional species only) and by slit-jet single resonance spectroscopy (both A and E torsional species, CH_3OH only). Previously, we reported the analysis of ν_3 symmetric CH stretch region (2750-2900 Cm-1), and the present work extends the analysis to higher frequency (2900-3020 Cm-1). The overall observed spectra contain 17 interacting vibrational bands for CH_3OD and 28 for CH_3OH. The signs and magnitudes of the torsional tunneling splittings are deduced for three CH fundamentals (ν_3, ν_9, ν_2) of both molecules and are compared to a model calculation and to ab initio theory. The number and distribution of observed vibrational bands indicate that the CH stretch bright states couple first to doorway states that are binary combinations of bending modes. In the parts of the spectrum where doorway states are present, the observed density of coupled states is comparable to the total density of vibrational states in the molecule, but where there are no doorway states, only the CH stretch fundamentals are observed. A time-dependent interpretation of the present FTMW-IR spectra indicates a fast (˜ 200 fs) initial decay of the bright state followed by second, slower redistribution (˜ 1-3 ps). The qualitative agreement of the present data with the time-dependent experiments of Iwaki and Dlott provides further support for the similarity of the fastest vibrational relaxation processes in the liquid and gas phases. Twagirayezu, S.; Clasp, T. N.; Perry, D. S.; Neill, J. L.; Muckle, M. T.; Pate, B. H. J. Phys. Chem. A 2010, 114, 6818 Iwaki, L. K.; Dlott, D. D. J. Phys. Chem. A 2000, 104, 9101

  1. Mitigation of Stress Corrosion Cracking Susceptibility of Machined 304L Stainless Steel Through Laser Peening

    NASA Astrophysics Data System (ADS)

    Sundar, R.; Ganesh, P.; Kumar, B. Sunil; Gupta, R. K.; Nagpure, D. C.; Kaul, R.; Ranganathan, K.; Bindra, K. S.; Kain, V.; Oak, S. M.; Singh, Bijendra

    2016-09-01

    The paper describes an experimental study aimed at suppressing stress corrosion cracking susceptibility of machined 304L stainless steel specimens through laser shock peening. The study also evaluates a new approach of oblique laser shock peening to suppress stress corrosion cracking susceptibility of internal surface of type 304L stainless steel tube. The results of the study, performed with an indigenously developed 2.5 J/7 ns Nd:YAG laser, demonstrated that laser shock peening effectively suppresses chloride stress corrosion cracking susceptibility of machined surface of type 304L stainless steel. In the investigated range of incident laser power density (3.2-6.4 GW/cm2), machined specimens peened with power density of 4.5 and 6.4 GW/cm2 displayed lower stress corrosion cracking susceptibility considerably than those treated with 3.2 and 3.6 GW/cm2 in boiling magnesium chloride test. Oblique laser shock peening, performed on machined internal surface of a type 304L stainless steel tube (OD = 111 mm; ID = 101 mm), was successful in introducing residual compressive surface stresses which brought about significant suppression of its stress corrosion cracking susceptibility. The technique of oblique laser shock peening, in spite of its inherent limitations on the length of peened region being limited by tube internal diameter and the need for access from both the sides, presents a simplified approach for peening internal surface of small tubular components.

  2. Laser Photochemistry.

    DTIC Science & Technology

    1981-07-01

    reaction due to decreased adsorption of the species on the catalytic surface. For example, i. . . 41 in the catalytic decomposition of formic acid ...over platinum (Ulmstead and Lin, 1978), the preexcitation of the gaseous formic acid molecules (by a 10 W/cm2 CW CO2 laser) resulted in a 50% increase...attention is given to selective and thermal excitation and the role of multiphonon couplings, heterogeneous catalysis , and chemical vapor deposition and

  3. Making a Laser Level

    ERIC Educational Resources Information Center

    Hawkins, Harry

    2004-01-01

    This article describes how to construct a laser level. This laser level can be made using a typical 4' (or shorter) bubble level and a small laser point. The laser unit is detachable, so the bubble level can also be used in the conventional way. However, the laser level works better than a simple bubble level. Making this inexpensive device is an…

  4. Infrared Lasers in Chemistry.

    ERIC Educational Resources Information Center

    John, Phillip

    1982-01-01

    Selected infrared laser chemistry topics are discussed including carbon dioxide lasers, infrared quanta and molecules, laser-induced chemistry, structural isomerization (laser purification, sensitized reactions, and dielectric breakdown), and fundamental principles of laser isotope separation, focusing on uranium isotope separation. (JN)

  5. Project LASER

    NASA Technical Reports Server (NTRS)

    1990-01-01

    NASA formally launched Project LASER (Learning About Science, Engineering and Research) in March 1990, a program designed to help teachers improve science and mathematics education and to provide 'hands on' experiences. It featured the first LASER Mobile Teacher Resource Center (MTRC), is designed to reach educators all over the nation. NASA hopes to operate several MTRCs with funds provided by private industry. The mobile unit is a 22-ton tractor-trailer stocked with NASA educational publications and outfitted with six work stations. Each work station, which can accommodate two teachers at a time, has a computer providing access to NASA Spacelink. Each also has video recorders and photocopy/photographic equipment for the teacher's use. MTRC is only one of the five major elements within LASER. The others are: a Space Technology Course, to promote integration of space science studies with traditional courses; the Volunteer Databank, in which NASA employees are encouraged to volunteer as tutors, instructors, etc; Mobile Discovery Laboratories that will carry simple laboratory equipment and computers to provide hands-on activities for students and demonstrations of classroom activities for teachers; and the Public Library Science Program which will present library based science and math programs.

  6. Laser nitriding and laser carburizing of surfaces

    NASA Astrophysics Data System (ADS)

    Schaaf, Peter

    2003-11-01

    Laser irradiation of surfaces with short pulses in reactive atmospheres (nitrogen, methane) can lead to very effective nitrification and carburization via complicated laser-surface-gas-plasma-interactions. This laser nitriding and laser carburizing and their basic underlying phenomena will be presented and partly explained by results of example materials (iron, titanium, aluminum, silicon) where nitride and carbide coatings can be formed by fast and easily by Excimer Laser, Nd:YAG laser, Free Electron Laser and also by femtosecond Ti:sapphire laser. This implies laser pulse durations from the nanosecond to the femtosecond regime and wavelengths from ultra-violet to infrared. The resulting surfaces, thin films, coatings and their properties are investigated by combining Mossbauer Spectroscopy, x-ray diffraction, x-ray absorption spectroscopy, Nanoindentation, Resonant Nuclear Reaction Analysis, and Rutherford Backscattering Spectroscopy.

  7. Critical slowing of quantum atomic deuterium/hydrogen with features of multiferroicity in the geometrically frustrated system C o2(OD) 3Cl /C o2(OH) 3Cl

    NASA Astrophysics Data System (ADS)

    Xu, Xing-Liang; Meng, Dong-Dong; Zheng, Xu-Guang; Yamauchi, Ichihiro; Watanabe, Isao; Guo, Qi-Xin

    2017-01-01

    An extensive study of hydroxyl salts C o2(OD) 3Cl /C o2(OH) 3Cl utilizing muon-spin-relaxation (μSR), nuclear magnetic resonance (NMR), and Raman spectroscopy, supplemented by dielectric constant and magnetic susceptibility measurements, has revealed a unique multiferroic system with deuterium-order-type ferroelectricity and geometrically frustrated magnetism. Through the temperature-dependent dynamics of the nuclear fields probed by μSR, the deuterium atoms in C o2(OD) 3Cl were found to be rapidly fluctuating in the paraelectric phase. Upon cooling, they showed a critical slowing down toward the ferroelectric transition at Tc=Tɛ= 230 K , below which eight new Raman-active phonon bands appeared as a result of symmetry breaking due to deuterium ordering. Meanwhile, the hydrogen atoms in C o2(OH) 3Cl became quasistatic at a reduced temperature near 210 K, wherein only one new Raman band appeared with a broad dielectric anomaly, suggesting incomplete ordering. Furthermore, the μSR, NMR, Raman spectroscopy, and the magnetic susceptibility all suggested an increase in magnetic couplings below ˜250 K in both C o2(OD) 3Cl and C o2(OH) 3Cl , demonstrating a multiferroic feature for C o2(OD) 3Cl . This work presents a new and unique multiferroic system with an exceptional high Tc. It also demonstrates that conventional μSR can be an effective tool for studying ferroelectrics.

  8. Laser therapy (image)

    MedlinePlus

    A laser is used for many medical purposes. Because the laser beam is so small and precise, it enables ... without injuring surrounding tissue. Some uses of the laser are retinal surgery, excision of lesions, and cauterization ...

  9. Lasers in Medicine.

    ERIC Educational Resources Information Center

    Hill, P. D.

    1989-01-01

    Described are the characteristics of the laser and its effects on the body. Discussed are examples of laser treatments, including angioplasty, ophthalmology, and dermatology. A discussion of lasers of clinical interest and their applications is presented. (YP)

  10. Laser-Driven Fusion.

    ERIC Educational Resources Information Center

    Gibson, A. F.

    1980-01-01

    Discusses the present status and future prospects of laser-driven fusion. Current research (which is classified under three main headings: laser-matter interaction processes, compression, and laser development) is also presented. (HM)

  11. Diode Laser Arrays

    NASA Astrophysics Data System (ADS)

    Botez, Dan; Scifres, Don R.

    2005-11-01

    Contributors; 1. Monolithic phase-locked semiconductor laser arrays D. Botez; 2. High power coherent, semiconductor laser master oscillator power amplifiers and amplifier arrays D. F. Welch and D. G. Mehuys; 3. Microoptical components applied to incoherent and coherent laser arrays J. R. Leger; 4. Modeling of diode laser arrays G. R. Hadley; 5. Dynamics of coherent semiconductor laser arrays H. G. Winfuland and R. K. Defreez; 6. High average power semiconductor laser arrays and laser array packaging with an emphasis for pumping solid state lasers R. Solarz; 7. High power diode laser arrays and their reliability D. R. Scifres and H. H. Kung; 8. Strained layer quantum well heterostructure laser arrays J. J. Coleman; 9. Vertical cavity surface emitting laser arrays C. J. Chang-Hasnain; 10. Individually addressed arrays of diode lasers D. Carlin.

  12. Lasers in Cancer Treatment

    MedlinePlus

    ... to treat cancer: carbon dioxide (CO 2 ) lasers, argon lasers, and neodymium: yttrium -aluminum-garnet (Nd:YAG) ... can be used with endoscopes. CO 2 and argon lasers can cut the skin’s surface without going ...

  13. Electrically tunable laser based on heliconical cholesteric (Conference Presentation)

    NASA Astrophysics Data System (ADS)

    Xiang, Jie; Varanytsia, Andrii; Minkowski, Fred; Paterson, Daniel A.; Imrie, Corrie T.; Lavrentovich, Oleg D.; Palffy-Muhoray, Peter

    2016-09-01

    STUDENT CONTRIBUTION: Cholesteric liquid crystals (CLC) self-assemble into a periodic supramolecular helical structure with properties of a one-dimensional photonic crystal. The CLCs doped with a fluorescent dye and optical pump enable a distributed feedback cavity and lasing [1]. Although lasing was observed in range of wavelength from near UV to near IR, a practical method of tuning of emission wavelength from a dye-doped CLC without structural destruction of a helix is not demonstrated yet. In this work, we demonstrate an electrically tunable dye-doped CLC laser based on the so-called oblique helicoidal, or heliconical, CLC state [2,3]. In this state, the molecules twist around the helicoidal axis, making an angle smaller than 90 degrees with the axis. Molecular tilt makes the heliconical structure different from the regular CLC (in which the molecules are perpendicular to the axis) and enable electric tunability [2,3]. An electric field applied parallel to the heliconical axis changes the pitch but does not realign the axis. When the field increases, the pitch decreases. As a result, the selective reflection band and a lasing wavelength move towards shorter wavelength. Using heliconical CLC and two laser dyes DCM and LD688, we demonstrate effective tuning of the laser emission wavelength from 574 nm to 722 nm. With appropriate laser dyes, the spectrum can be extended from near UV to near IR. Efficient electric tuning in the broad spectral range and small size of the heliconical cholesteric lasers makes them potentially useful for optical and biomedical applications. [1] P. Palffy-Muhoay, W.Y. Cao, M. Moreira, B. Taheri, A. Munoz, Photonics and lasing in liquid crystal [2] J. Xiang, S.V. Shiyanovskii, C.T. Imrie, O.D. Lavrentovich, Electrooptic Response of Chiral Nematic Liquid Crystals with Oblique Helicoidal Director, Phys Rev Lett, 112 (2014) 217801. [3] J. Xiang, Y.N. Li, Q. Li, D.A. Paterson, J.M.D. Storey, C.T. Imrie, O.D. Lavrentovich, Electrically

  14. Laser Weapons for Naval Applications

    DTIC Science & Technology

    2012-03-27

    IPG fiber lasers , 10 kW/ fiber 7 • Output wavelength is tunable (can operate in atmospheric window) Free Electron Lasers ...Multiple kilowatts over multiple kilometers • Laser power converters can be highly efficient, > 60 % • Fiber lasers are highly compact and... lasers - Free electron lasers • Background • Laser candidates • Additional capabilities - Power beaming 3 Laser Lethality -

  15. Laser accidents: Being Prepared

    SciTech Connect

    Barat, K

    2003-01-24

    The goal of the Laser Safety Officer and any laser safety program is to prevent a laser accident from occurring, in particular an injury to a person's eyes. Most laser safety courses talk about laser accidents, causes, and types of injury. The purpose of this presentation is to present a plan for safety offices and users to follow in case of accident or injury from laser radiation.

  16. Handbook of molecular lasers

    NASA Astrophysics Data System (ADS)

    Cheo, Peter K.

    The technology and applications of molecular lasers (MLs) are examined in chapters contributed by leading experts. Topics addressed include ML emission spectra, CO2 TEA lasers, RF-discharge-excited CO2 lasers, high-energy short-pulse CO2 lasers, high-power electron-beam-controlled CO2 lasers, HF/DF chemical lasers, optically pumped FIR MLs, and transients and instabilities in FIR MLs. Extensive diagrams, drawings, graphs, photographs, and tables of numerical data are provided.

  17. New laser protective eyewear

    NASA Astrophysics Data System (ADS)

    McLear, Mark

    1996-04-01

    Laser technology has significantly impacted our everyday life. Lasers are now used to correct your vision, clear your arteries, and are used in the manufacturing of such diverse products as automobiles, cigarettes, and computers. Lasers are no longer a research tool looking for an application. They are now an integral part of manufacturing. In the case of Class IV lasers, this explosion in laser applications has exposed thousands of individuals to potential safety hazards including eye damage. Specific protective eyewear designed to attenuate the energy of the laser beam below the maximum permissible exposure is required for Class 3B and Class IV lasers according to laser safety standards.

  18. Laser satellite power systems

    SciTech Connect

    Walbridge, E.W.

    1980-01-01

    A laser satellite power system (SPS) converts solar power captured by earth-orbiting satellites into electrical power on the earth's surface, the satellite-to-ground transmission of power being effected by laser beam. The laser SPS may be an alternative to the microwave SPS. Microwaves easily penetrate clouds while laser radiation does not. Although there is this major disadvantage to a laser SPS, that system has four important advantages over the microwave alternative: (1) land requirements are much less, (2) radiation levels are low outside the laser ground stations, (3) laser beam sidelobes are not expected to interfere with electromagnetic systems, and (4) the laser system lends itself to small-scale demonstration. After describing lasers and how they work, the report discusses the five lasers that are candidates for application in a laser SPS: electric discharge lasers, direct and indirect solar pumped lasers, free electron lasers, and closed-cycle chemical lasers. The Lockheed laser SPS is examined in some detail. To determine whether a laser SPS will be worthy of future deployment, its capabilities need to be better understood and its attractiveness relative to other electric power options better assessed. First priority should be given to potential program stoppers, e.g., beam attenuation by clouds. If investigation shows these potential program stoppers to be resolvable, further research should investigate lasers that are particularly promising for SPS application.

  19. [Laser physics].

    PubMed

    Banús Gassol, J M

    2008-11-01

    The commission of this article plunged me into doubt. First I should confess that I don't find excuse to escape this part if somebody wants to minimally deepen in the knowledge of the biological effects of this energy source. Secondly, when we talk about results, we use terms made and defined by Physics. Often we have polemics about results, and what really happens is that we don't reach agreements because we refer to different terms to explain the same observation; in conclusion we cannot understand each other because we do not know the adequate terms; for example, hypoxemia as oxygen deficit, which is true in an anemic patient as well as in a low oxygen saturation rate. In consequence, a good review of these concepts seems necessary to me. The third reason is the confusion that exists in our environment, I think sometimes of interest, about properties and effects of different types of laser. Only a minimal knowledge of physics will help us to state the scientific basis for understanding. The problems, nevertheless, accumulate due to the fact that the universe to which this article is directed is formed by urologists. What Physics education should we suppose they have? Superficial? Medium? Is it a collective with a uniform knowledge, being it whatever it is? The implication is clear. The article depth will depend on the answers to these questions. Nevertheless, the aim of the authors is to give a base enough to know what the laser is and how it acts. For that, the answer I gave to my questions is that the reader should understand the article and have enough base for, at least, reading critically the articles about laser published in urological journals.

  20. Increase in tartrate-resistant acid phosphatase of bone at the early stage of ascorbic acid deficiency in the ascorbate-requiring Osteogenic Disorder Shionogi (ODS) rat.

    PubMed

    Goto, A; Tsukamoto, I

    2003-08-01

    The effect of ascorbic acid deficiency on bone metabolism was evaluated using the ascorbate-requiring Osteogenic Disorder Shionogi (ODS) rat model. Ascorbic acid (Asc)-deficient rats gained body weight in a manner similar to Asc-supplemented rats (control) during 3 weeks, but began to lose weight during the 4th week of Asc deficiency. The tartrate-resistant acid phosphatase (TRAP) activity in serum increased to about 2-fold the control value in the rats fed the Asc-free diet for 2, 3, and 4 weeks (AscD2, AscD3, and AscD4), while a decrease in the alkaline phosphatase (ALP) activity was observed only in AscD4 rats. The serum pyridinoline cross-linked carboxyterminal telopeptide of type I collagen (ICTP) level significantly increased to 1.3-, 1.4-, and 1.9-fold of that in the controls in AscD2, D3, and D4, respectively. The ALP activity in the distal femur was unchanged in AscD1, D2, and D3, but decreased to 50% of the control level in AscD4 rats. The TRAP activity in the distal femur increased to about 2-fold of that in the controls in the AscD2 and D3 and decreased to the control level in the AscD4 rats. The amount of hydroxyproline in the distal femur significantly decreased to about 80%, 70%, and 60% of the control in AscD2, D3, and D4 rats, respectively. These decreases were associated with a similar reduction in the calcium content of the distal femur. Histochemical analysis of the distal femur showed an increase in TRAP-positive cells in AscD2 and AscD3 rats and a decrease in the trabecular bone in AscD2, D3, and D4 rats. These results suggested that a deficiency of Asc stimulated bone resorption at an early stage, followed by a decrease in bone formation in mature ODS rats which already had a well-developed collagen matrix and fully differentiated osteoblasts.

  1. Load partitioning between ferrite/martensite and dispersed nanoparticles of a 9Cr ferritic/martensitic (F/M) ODS steel at high temperatures

    SciTech Connect

    Zhang, Guangming; Mo, Kun; Miao, Yinbin; Liu, Xiang; Almer, Jonathan; Zhou, Zhangjian; Stubbins, James F.

    2015-06-18

    In this study, a high-energy synchrotron radiation X-ray technique was used to investigate the tensile deformation processes of a 9Cr-ODS ferritic/martensitic (F/M) steel at different temperatures. Two minor phases within the 9Cr-ODS F/M steel matrix were identified as Y2Ti2O7 and TiN by the high-energy X-ray diffraction, and confirmed by the analysis using energy dispersive X-ray spectroscopy (EDS) of scanning transmission electron microscope (STEM). The lattice strains of the matrix and particles were measured through the entire tensile deformation process. During the tensile tests, the lattice strains of the ferrite/martensite and the particles (TiN and Y2Ti2O7) showed a strong temperature dependence, decreasing with increasing temperature. Analysis of the internal stress at three temperatures showed that the load partitioning between the ferrite/martensite and the particles (TiN and Y2Ti2O7) was initiated during sample yielding and reached to a peak during sample necking. At three studied temperatures, the internal stress of minor phases (Y2Ti2O7 and TiN) was about 2 times that of F/M matrix at yielding position, while the internal stress of Y2Ti2O7 and TiN reached about 4.5-6 times and 3-3.5 times that of the F/M matrix at necking position, respectively. It indicates that the strengthening of the matrix is due to minor phases (Y2Ti2O7 and TiN), especially Y2Ti2O7 particles. Although the internal stresses of all phases decreased with increasing temperature from RT to 600 degrees C, the ratio of internal stresses of each phase at necking position stayed in a stable range (internal stresses of Y2Ti2O7 and TiN were about 4.5-6 times and 3-3.5 times of that of F/M matrix, respectively). The difference between internal stress of the F/M matrix and the applied stress at 600 degrees C is slightly lower than those at RI and 300 degrees C, indicating that the nanoparticles still have good strengthening effect at 600 degrees C. (C) 2015 Elsevier B.V. All rights reserved.

  2. The Geoscience Laser Altimeter System Laser Transmitter

    NASA Technical Reports Server (NTRS)

    Afzal, R. S.; Dallas, J. L.; Yu, A. W.; Mamakos, W. A.; Lukemire, A.; Schroeder, B.; Malak, A.

    2000-01-01

    The Geoscience Laser Altimeter System (GLAS), scheduled to launch in 2001, is a laser altimeter and lidar for tile Earth Observing System's (EOS) ICESat mission. The laser transmitter requirements, design and qualification test results for this space- based remote sensing instrument are presented.

  3. Studies on lasers and laser devices

    NASA Technical Reports Server (NTRS)

    Harris, S. E.; Siegman, A. E.; Young, J. F.

    1983-01-01

    The goal of this grant was to study lasers, laser devices, and uses of lasers for investigating physical phenomena are studied. The active projects included the development of a tunable, narrowband XUV light source and its application to the spectroscopy of core excited atomic states, and the development of a technique for picosecond time resolution spectroscopy of fast photophysical processes.

  4. Maxillary overdentures supported by four splinted direct metal laser sintering implants: a 3-year prospective clinical study.

    PubMed

    Mangano, Francesco; Luongo, Fabrizia; Shibli, Jamil Awad; Anil, Sukumaran; Mangano, Carlo

    2014-01-01

    Purpose. Nowadays, the advancements in direct metal laser sintering (DMLS) technology allow the fabrication of titanium dental implants. The aim of this study was to evaluate implant survival, complications, and peri-implant marginal bone loss of DMLS implants used to support bar-retained maxillary overdentures. Materials and Methods. Over a 2-year period, 120 implants were placed in the maxilla of 30 patients (18 males, 12 females) to support bar-retained maxillary overdentures (ODs). Each OD was supported by 4 implants splinted by a rigid cobalt-chrome bar. At each annual follow-up session, clinical and radiographic parameters were assessed. The outcome measures were implant failure, biological and prosthetic complications, and peri-implant marginal bone loss (distance between the implant shoulder and the first visible bone-to-implant contact, DIB). Results. The 3-year implant survival rate was 97.4% (implant-based) and 92.9% (patient-based). Three implants failed. The incidence of biological complication was 3.5% (implant-based) and 7.1% (patient-based). The incidence of prosthetic complication was 17.8% (patient-based). No detrimental effects on marginal bone level were evidenced. Conclusions. The use of 4 DMLS titanium implants to support bar-retained maxillary ODs seems to represent a safe and successful procedure. Long-term clinical studies on a larger sample of patients are needed to confirm these results.

  5. Maxillary Overdentures Supported by Four Splinted Direct Metal Laser Sintering Implants: A 3-Year Prospective Clinical Study

    PubMed Central

    Mangano, Francesco; Shibli, Jamil Awad; Anil, Sukumaran

    2014-01-01

    Purpose. Nowadays, the advancements in direct metal laser sintering (DMLS) technology allow the fabrication of titanium dental implants. The aim of this study was to evaluate implant survival, complications, and peri-implant marginal bone loss of DMLS implants used to support bar-retained maxillary overdentures. Materials and Methods. Over a 2-year period, 120 implants were placed in the maxilla of 30 patients (18 males, 12 females) to support bar-retained maxillary overdentures (ODs). Each OD was supported by 4 implants splinted by a rigid cobalt-chrome bar. At each annual follow-up session, clinical and radiographic parameters were assessed. The outcome measures were implant failure, biological and prosthetic complications, and peri-implant marginal bone loss (distance between the implant shoulder and the first visible bone-to-implant contact, DIB). Results. The 3-year implant survival rate was 97.4% (implant-based) and 92.9% (patient-based). Three implants failed. The incidence of biological complication was 3.5% (implant-based) and 7.1% (patient-based). The incidence of prosthetic complication was 17.8% (patient-based). No detrimental effects on marginal bone level were evidenced. Conclusions. The use of 4 DMLS titanium implants to support bar-retained maxillary ODs seems to represent a safe and successful procedure. Long-term clinical studies on a larger sample of patients are needed to confirm these results. PMID:25580124

  6. Quantum wave packet propagation study of the photochemistry of phenol: isotope effects (Ph-OD) and the direct excitation to the 1πσ* state.

    PubMed

    An, Heesun; Baeck, Kyoung Koo

    2011-11-24

    An earlier time-dependent quantum wave packet propagation study of the photochemistry of Ph-OH [J. Chem. Phys. 2005, 122, 224315] is extended to investigate isotope effects (for Ph-OD) and the dynamics initiated by direct (vibronically induced) excitation to the (1)πσ* state. The isotope effect is significant only when the initially excited state is (1)ππ*, that is, there are noticeable changes not only in the time scale but also in the branching ratio (Ã/X̃) for the electronic states of the product Ph-O radical. In contrast, the isotope effect on the dynamics initiated by direct excitation to the (1)πσ* state is very small. Our most important observation for the dynamics initiated by direct excitation to the (1)πσ* state is that the initial excitation of the O-H stretch mode does not result in a noticeable enhancement of the product Ph-O radical in the à state, which corresponds to a dissociating H atom with low kinetic energy. The initial excitation of the CCOH torsion mode is the main reason for the enhancement of the product Ph-O radical in the à state that was observed in a vibrationally mediated two-photon experiment [J. Chem. Phys.2008, 128, 104307].

  7. Understanding and controlling morphology evolution via DIO plasticization in PffBT4T-2OD/PC71BM devices

    PubMed Central

    Zhang, Yiwei; Parnell, Andrew J.; Pontecchiani, Fabio; Cooper, Joshaniel F. K.; Thompson, Richard L.; Jones, Richard A. L.; King, Stephen M.; Lidzey, David G.; Bernardo, Gabriel

    2017-01-01

    We demonstrate that the inclusion of a small amount of the co-solvent 1,8-diiodooctane in the preparation of a bulk-heterojunction photovoltaic device increases its power conversion efficiency by 20%, through a mechanism of transient plasticisation. We follow the removal of 1,8-diiodooctane directly after spin-coating using ellipsometry and ion beam analysis, while using small angle neutron scattering to characterise the morphological nanostructure evolution of the film. In PffBT4T-2OD/PC71BM devices, the power conversion efficiency increases from 7.2% to above 8.7% as a result of the coarsening of the phase domains. This coarsening process is assisted by thermal annealing and the slow evaporation of 1,8-diiodooctane, which we suggest, acts as a plasticiser to promote molecular mobility. Our results show that 1,8-diiodooctane can be completely removed from the film by a thermal annealing process at temperatures ≤100 °C and that there is an interplay between the evaporation rate of 1,8-diiodooctane and the rate of domain coarsening in the plasticized film which helps elucidate the mechanism by which additives improve device efficiency. PMID:28287164

  8. Understanding and controlling morphology evolution via DIO plasticization in PffBT4T-2OD/PC71BM devices

    NASA Astrophysics Data System (ADS)

    Zhang, Yiwei; Parnell, Andrew J.; Pontecchiani, Fabio; Cooper, Joshaniel F. K.; Thompson, Richard L.; Jones, Richard A. L.; King, Stephen M.; Lidzey, David G.; Bernardo, Gabriel

    2017-03-01

    We demonstrate that the inclusion of a small amount of the co-solvent 1,8-diiodooctane in the preparation of a bulk-heterojunction photovoltaic device increases its power conversion efficiency by 20%, through a mechanism of transient plasticisation. We follow the removal of 1,8-diiodooctane directly after spin-coating using ellipsometry and ion beam analysis, while using small angle neutron scattering to characterise the morphological nanostructure evolution of the film. In PffBT4T-2OD/PC71BM devices, the power conversion efficiency increases from 7.2% to above 8.7% as a result of the coarsening of the phase domains. This coarsening process is assisted by thermal annealing and the slow evaporation of 1,8-diiodooctane, which we suggest, acts as a plasticiser to promote molecular mobility. Our results show that 1,8-diiodooctane can be completely removed from the film by a thermal annealing process at temperatures ≤100 °C and that there is an interplay between the evaporation rate of 1,8-diiodooctane and the rate of domain coarsening in the plasticized film which helps elucidate the mechanism by which additives improve device efficiency.

  9. Cut Size Determination of Centrifugal Classifier with Fluidized Bed / Wyznaczanie Ziarna Granicznego Klasyfikatora Odśrodkowego Z Warstwą Fluidalną

    NASA Astrophysics Data System (ADS)

    Otwinowski, Henryk

    2013-09-01

    The cut size determination on the basis of proposed matrix model of classification process in a centrifugal air flow classifier with a fluidized bed is presented using matrix model. The presented methodology of cut size determination is based on the precise measurement of the total mass of fed material and coarse product in experimental tests. Knowledge of the feed particle size distribution is also required. Considered classifier is a part of the fluidized bed jet mill. The presented cut size determination will allow to optimize mill work and prediction of particle size distribution of the classification products. W artykule przedstawiono metodykę wyznaczania rozmiaru ziarna granicznego procesu klasyfikacji w odśrodkowym klasyfikatorze przepływowym z warstwą fluidalną przy wykorzystaniu modelu macierzowego. Przedstawiona metodyka oparta jest na dokładnym wyznaczeniu masy nadawy i gruboziarnistego produktu klasyfikacji na podstawie badań eksperymentalnych. Wymagana jest także znajomość składu ziarnowego nadawy. Rozpatrywany klasyfikator stanowi część fluidalnego młyna strumieniowego. Wyznaczenie rozmiaru ziarna granicznego umożliwia przeprowadzenie optymalizacji pracy młyna i prognozowanie składu ziarnowego produktów klasyfikacji.

  10. The comparison of microstructure and nanocluster evolution in proton and neutron irradiated Fe-9%Cr ODS steel to 3 dpa at 500 °C

    NASA Astrophysics Data System (ADS)

    Swenson, M. J.; Wharry, J. P.

    2015-12-01

    A model Fe-9%Cr oxide dispersion strengthened (ODS) steel was irradiated with protons or neutrons to a dose of 3 displacements per atom (dpa) at a temperature of 500 °C, enabling a direct comparison of ion to neutron irradiation effects at otherwise fixed irradiation conditions. The irradiated microstructures were characterized using transmission electron microscopy and atom probe tomography including cluster analysis. Both proton and neutron irradiations produced a comparable void and dislocation loop microstructure. However, the irradiation response of the Ti-Y-O oxide nanoclusters varied. Oxides remained stable under proton irradiation, but exhibited dissolution and an increase in Y:Ti composition ratio under neutron irradiation. Both proton and neutron irradiation also induced varying extents of Si, Ni, and Mn clustering at existing oxide nanoclusters. Protons are able to reproduce the void and loop microstructure of neutron irradiation carried out to the same dose and temperature. However, since nanocluster evolution is controlled by both diffusion and ballistic impacts, protons are rendered unable to reproduce the nanocluster evolution of neutron irradiation at the same dose and temperature.

  11. Topolology-symmetry law of structure of natural titanosilicate micas and related heterophyllosilicates based on the extended OD theory: Structure prediction

    NASA Astrophysics Data System (ADS)

    Belokoneva, E. L.; Topnikova, A. P.; Aksenov, S. M.

    2015-01-01

    A topology-symmetry analysis of the structures in the family of titanosilicate micas and related heterophyllosilicates based on the extended OD theory reveals their kinship with the family of rhodezite, delhayelite, and other minerals that had been analyzed earlier by distinguishing sheets common for all the structures. Like in the family studied earlier, the structural variety of a more complex titanosilicate family is determined by different local symmetries of sheets. Sheets consist of central O layers of edge-sharing octahedra and H layers formed by tetrahedra connected into diortho groups and Ti(Nb,Fe) semioctahedra (octahedra). Three patterns of connection of O and H layers correspond to sheet symmetry P2/ m, P21/ m, and . Various symmetry modes of sheet connection in the structures are analyzed. Hypothetical structures, including structures with a higher degree of disorder, which can be found in nature or obtained by crystal synthesis, are deduced. Factors responsible for structural variety, including the existence of two main sheet varieties (with P2/ m and P21/ m symmetry) are considered a consequence of the difference in the chemism of the mineral formation medium.

  12. Understanding and controlling morphology evolution via DIO plasticization in PffBT4T-2OD/PC71BM devices.

    PubMed

    Zhang, Yiwei; Parnell, Andrew J; Pontecchiani, Fabio; Cooper, Joshaniel F K; Thompson, Richard L; Jones, Richard A L; King, Stephen M; Lidzey, David G; Bernardo, Gabriel

    2017-03-13

    We demonstrate that the inclusion of a small amount of the co-solvent 1,8-diiodooctane in the preparation of a bulk-heterojunction photovoltaic device increases its power conversion efficiency by 20%, through a mechanism of transient plasticisation. We follow the removal of 1,8-diiodooctane directly after spin-coating using ellipsometry and ion beam analysis, while using small angle neutron scattering to characterise the morphological nanostructure evolution of the film. In PffBT4T-2OD/PC71BM devices, the power conversion efficiency increases from 7.2% to above 8.7% as a result of the coarsening of the phase domains. This coarsening process is assisted by thermal annealing and the slow evaporation of 1,8-diiodooctane, which we suggest, acts as a plasticiser to promote molecular mobility. Our results show that 1,8-diiodooctane can be completely removed from the film by a thermal annealing process at temperatures ≤100 °C and that there is an interplay between the evaporation rate of 1,8-diiodooctane and the rate of domain coarsening in the plasticized film which helps elucidate the mechanism by which additives improve device efficiency.

  13. TEM characterization of 14YWT and 12YWT ODS ferritic alloys neutron irradiated at 500C using in-situ helium injection

    SciTech Connect

    Jung, Hee Joon; Edwards, Danny J.; Kurtz, Richard J.; Odette, G Robert; Wu, Yuan; Yamamoto, Takuya

    2015-03-31

    This report summaries TEM characterization of 14YWT and 12YWT, ODS ferritic alloys with 14 and 12 wt % of Cr respectively, to compare the effect of neutron irradiation with and without concurrent He injection using ISHI. The density and average size of <100>/{100} type dislocation loops are always larger than those of 1/2<111>/{111} type, but this difference is significantly affected by He implantation. The density of dislocation loops of both types ranges from ~1 to 4x1021 m-3 with average size ranging from 5~20 nm. 14YWT has lower density but larger size dislocation loops than 12YWT, while the line dislocation density of 14YWT is 3 times lower than that of 12YWT. Helium bubble densities of both 14YWT and 12YWT are 1.9x1023 m-3, the average He bubbles size of 14YWT and 12YWT are 1.4 and 1.2 nm, respectively. 14YWT exhibits α-α’ phase separation, Y-rich particles and uniformly distributed W. In addition to those features, 12YWT exhibits Y-Ti-O particles (not Y-O rich) and elongated Cr-rich phases.

  14. Effects of bioactive glass and beta-TCP containing three-dimensional laser sintered polyetheretherketone composites on osteoblasts in vitro.

    PubMed

    von Wilmowsky, Cornelius; Vairaktaris, Eleftherios; Pohle, Dirk; Rechtenwald, Thomas; Lutz, Rainer; Münstedt, Helmut; Koller, Garrit; Schmidt, M; Neukam, Friedrich Wilhelm; Schlegel, Karl Andreas; Nkenke, Emeka

    2008-12-15

    Because of their excellent physical properties nonresorbable thermoplastic polymers have become more important for the field of reconstructive surgery. Aim of the present study was to investigate the effects of laser sintered polyetheretherketone (PEEK) with incorporated osteoconductive and bioactive bone substitution materials on osteoblasts in vitro. Human osteoblasts (hFOB 1.19) were seeded onto laser sintered PEEK samples containing nano-sized carbon black, beta-tricalciumphosphate (beta-TCP), and bioactive glass 45S5. Osteoblasts were investigated for cell viability, cell proliferation and cell morphology. A constant proliferation of osteoblasts could be observed on all samples with the highest values for bioactive glass containing samples at day 7 (OD 1.76 +/- 0.22) and day 14 (OD 3.75 +/- 0.31) and lowest values for beta-TCP containing probes throughout the study compared with the PEEK pure control group. Highest cell viability was observed for Bioglass containing probes (95.5 +/- 3.32)% whereas osteoblasts seeded on beta-TCP containing probes showed reduced viability (84.4 +/- 4.32)%. Laser sintered PEEK implants seem to be attractive candidates for use as bone substitutes for reconstructive surgery because of their biocompatibility, individual shape, and the possibility of compounding bioinert polymer powder with osteoconductive and bioactive materials which might benefit bone formation in vivo.

  15. Laser Spectroscopy

    NASA Astrophysics Data System (ADS)

    Katori, H.; Yoneda, H.; Nakagawa, K.; Shimizu, F.

    2010-02-01

    .] -- Ultracold Ytterbium atoms in optical lattices / S. Sugawa ... [et al.] -- Ultracold polar molecules in the rovibrational ground state / J. Deiglmayr ... [et al.] -- Polar molecules near quantum degeneracy / J. Ye and D. S. Jin -- Production of a quantum gas of rovibronic ground-state molecules in an optical lattice / J. G. Danzl ... [et al.] -- Recent progress in x-ray nonlinear optics / K. Tamasaku, K. Sawada, and T. Ishikawa -- Gas in scattering media absorption spectroscopy - laser spectroscopy in unconventional environments / S. Svanberg -- Laser spectroscopy on relativistic ion beams / S. Reinhardt ... [et al.] -- Single frequency microcavity lasers and applications / L. Xu ... [et al.].

  16. Reverse laser drilling

    NASA Technical Reports Server (NTRS)

    Anthony, Thomas R. (Inventor)

    1984-01-01

    This invention provides a method for laser drilling small diameter, closely-spaced, and accurately located holes in a body of material which is transparent or substantially transparent to the laser radiation employed whereby the holes are drilled through the thickness of the body from the surface opposite to that on which the laser beam impinges to the surface of laser beam impingement.

  17. Laser photobiology and photomedicine

    SciTech Connect

    Martellucci, S.; Chester, A.N.

    1985-01-01

    This book presents information on the following topics: the physical and biological basis of photobiology and photomedicine; the biological effects and applications of laser technology; photochemotherapy; photobiology and dermatology; surgical and ophthalmological applications of lasers; laser safety; and diagnostics and technological aspects of recent laser developments.

  18. Narrow gap laser welding

    DOEpatents

    Milewski, J.O.; Sklar, E.

    1998-06-02

    A laser welding process including: (a) using optical ray tracing to make a model of a laser beam and the geometry of a joint to be welded; (b) adjusting variables in the model to choose variables for use in making a laser weld; and (c) laser welding the joint to be welded using the chosen variables. 34 figs.

  19. Narrow gap laser welding

    DOEpatents

    Milewski, John O.; Sklar, Edward

    1998-01-01

    A laser welding process including: (a) using optical ray tracing to make a model of a laser beam and the geometry of a joint to be welded; (b) adjusting variables in the model to choose variables for use in making a laser weld; and (c) laser welding the joint to be welded using the chosen variables.

  20. Obstacles to Laser Safety

    SciTech Connect

    Barat, K

    2005-04-25

    The growth of laser development & technology has been remarkable. Unfortunately, a number of traps or obstacles to laser safety have also developed with that growth. The goal of this article is to highlight those traps, in the hope that an aware laser user will avoid them. These traps have been the cause or contributing factor of many a preventable laser accident.

  1. Short wavelength laser

    DOEpatents

    Hagelstein, P.L.

    1984-06-25

    A short wavelength laser is provided that is driven by conventional-laser pulses. A multiplicity of panels, mounted on substrates, are supported in two separated and alternately staggered facing and parallel arrays disposed along an approximately linear path. When the panels are illuminated by the conventional-laser pulses, single pass EUV or soft x-ray laser pulses are produced.

  2. Longitudinal discharge laser baffles

    DOEpatents

    Warner, B.E.; Ault, E.R.

    1994-06-07

    The IR baffles placed between the window and the electrode of a longitudinal discharge laser improve laser performance by intercepting off-axis IR radiation from the laser and in doing so reduce window heating and subsequent optical distortion of the laser beam. 1 fig.

  3. Longitudinal discharge laser baffles

    DOEpatents

    Warner, Bruce E.; Ault, Earl R.

    1994-01-01

    The IR baffles placed between the window and the electrode of a longitudinal discharge laser improve laser performance by intercepting off-axis IR radiation from the laser and in doing so reduce window heating and subsequent optical distortion of the laser beam.

  4. Solar driven lasers for power satellite applications

    NASA Technical Reports Server (NTRS)

    Taussio, R.; Cassady, P.; Klosterman, E.

    1980-01-01

    The technological feasibility of using multimagawatt lasers for space power transmission is discussed. Candidate lasers include electric discharge lasers, direct optically pumped lasers, and free electron lasers.

  5. What is a Laser?

    NASA Astrophysics Data System (ADS)

    Julien, Lucile; Schwob, Catherine

    2015-10-01

    The first laser was built more than 50 years ago, inMay 1960: it was a pulsed ruby laser. It was a simple laboratory curiosity and nobody knew what its usefulness could be. Other devices were rapidly demonstrated, and the variety and number of lasers in the world increased at a huge rate. Currently, the annual laser world market is worth about 6 billion dollars. Thanks to the remarkable properties of laser light, laser applications increase steadily in the domains of industry, building, medicine, telecommunications, etc. One can find many lasers in research laboratories, and they are used more and more in our everyday life and almost everybody has already seen a laser beam. The goal of the first chapter of this book is to explain simply what a laser is, how it is built and how it operates. Firstly, let us point out the outstanding properties of the laser light.

  6. Tunable lasers- an overview

    SciTech Connect

    Guenther, B.D.; Buser, R.G.

    1982-08-01

    This overview of tunable lasers describes their applicability to spectroscopy in the ultraviolet and middle infrared ranges; to rapid on-line diagnostics by ultrashort cavity lasers; to exploration, by the free electron laser, for its wide tuning in the far infrared to submillimeter region; to remote detection, in areas such as portable pollution monitors, on-line chemical analyzers, auto exhaust analyzers, and production line controls; to photochemistry; and to other potential areas in diagnostics, communications, and medical and biological sciences. The following lasers are characterized by their tunability: solid state lasers, primarily alexandrite, with a tuning range of ca 1000 Angstroms; color center lasers; semiconductor lasers; dye lasers; gas lasers, where high-pressure CO/sub 2/ discharges are the best known example for a wide tunability range, and research is continuing in systems such as the alkali dimers; and, at wavelengths beyond 10 micrometers, the possibilities beyond Cerenkov and free electron lasers.

  7. Lasers in flow cytometry.

    PubMed

    Telford, William G

    2011-01-01

    Laser technology has advanced tremendously since the first gas lasers were incorporated into early flow cytometers. Gas lasers have been largely replaced by solid-state laser technology, making virtually any desirable visible light wavelength available for flow cytometry. Multiwavelength, white light, and wavelength tunable lasers are poised to enhance our analytical capabilities even further. In this chapter, I summarize the role that lasers play in cytometry, and the practical characteristics that make a laser appropriate for flow cytometry. I then review the latest single wavelength lasers available for flow cytometry, and how they can be used to excite the ever-expanding array of available fluorochromes. Finally, I review the contribution and potential of the latest tunable laser technology to flow cytometry, and show several examples of these novel sources integrated into production instruments. Technical details and critical parameters for successful application of these lasers for biomedical analysis are covered in depth.

  8. A Q-switched Ho:YAG laser assisted nanosecond time-resolved T-jump transient mid-IR absorbance spectroscopy with high sensitivity

    SciTech Connect

    Li, Deyong; Li, Yunliang; Li, Hao; Weng, Yuxiang; Wu, Xianyou; Yu, Qingxu

    2015-05-15

    Knowledge of dynamical structure of protein is an important clue to understand its biological function in vivo. Temperature-jump (T-jump) time-resolved transient mid-IR absorbance spectroscopy is a powerful tool in elucidating the protein dynamical structures and the folding/unfolding kinetics of proteins in solution. A home-built setup of T-jump time-resolved transient mid-IR absorbance spectroscopy with high sensitivity is developed, which is composed of a Q-switched Cr, Tm, Ho:YAG laser with an output wavelength at 2.09 μm as the T-jump heating source, and a continuous working CO laser tunable from 1580 to 1980 cm{sup −1} as the IR probe. The results demonstrate that this system has a sensitivity of 1 × 10{sup −4} ΔOD for a single wavelength detection, and 2 × 10{sup −4} ΔOD for spectral detection in amide I′ region, as well as a temporal resolution of 20 ns. Moreover, the data quality coming from the CO laser is comparable to the one using the commercial quantum cascade laser.

  9. Surgical lasers in dermatology

    NASA Astrophysics Data System (ADS)

    Szymanczyk, Jacek; Nowakowski, Wlodzimierz; Golebiowska, Aleksandra; Michalska, I.; Mindak, Marek K.

    1997-10-01

    Almost every laser for medical applications was first tried in dermatology. The efficiency of YAG, CO2, and Argon lasers on this area and their potential advantages over conventional methods were mostly evaluated by cosmetic effect of laser therapy. The indications for different laser treatment in such dermatological cases as: angiomas, telangiectasias, pigmented lesions, nevus flammeus congenitus, deep cavernous angiomas, skin neoplasms and condylomata acuminata are discussed in this paper and the results of the laser therapy are also presented.

  10. Laser Reliability Prediction

    DTIC Science & Technology

    1975-08-01

    Lasers, Quality Level 1 - Group 2 32 5.3-3 Kolmogorov-Smirnoff Test - Helium/Neon Lasers, Quality Level 1 33 5.3-4 Welbull Analysis...institutions through- out the United States and Canada. The collected laser data were grouped, analyzed, and statistically tested for homogeneity...sources were Initially contacted by letter questionnaires In which personnel were requested to describe any laser component life test or laser system

  11. Intracavity Raman lasers

    SciTech Connect

    Band, Y.B.; Ackerhalt, J.R.; Krasinski, J.S.; Heller, D.F.

    1989-02-01

    Experimental and theoretical studies of intracavity Raman lasers are presented. Advantages of intracavity Raman lasers, particularly for low-emission cross section and broadly tunable vibronic gain media, are described. Experimental studies of a hydrogen gas Raman laser pumped inside the cavity of an alexandrite laser are presented. A theoretical model of the dynamics of a unidirectional intracavity Raman ring laser is developed and solved analytically. This model is adapted to simulate experiments.

  12. Mercury Bromide Laser Research.

    DTIC Science & Technology

    1981-05-04

    Discharge", Optics Lett., 2(3), (March 1978). 7. R. Burnham, "Discharge Pumped Mercuric Halide Dissociation Lasers", Appl. Phys. Lett., 33: 15 (July 1978...laser and fluorescence signals. Neutral density filters served to prevent saturation of the detector during the laser measurements. F. Laser Output as a...REFERENCES . E. J. Schimitschek and J. E. Celto, " Mercuric Bromide Dissociation Laser in an Electric Discharge," Optics Lett. 2(3), March 1978. This

  13. OD Strategy for Today's Training

    ERIC Educational Resources Information Center

    Carter, Robert N.

    1975-01-01

    The organizational development strategy of the W. T. Grant Company, an overlapping group teamwork approach, is directed toward accountability, planned change, individual recognition, experience-based behavior, group morale, smooth information and communication flow, and decision making. (EA)

  14. Development of the Zebra load region for increased capability plasma diagnostics and improved Leopard laser access

    NASA Astrophysics Data System (ADS)

    Astanovitskiy, Alexey; Presura, R.; Ivanov, V. V.; Haboub, A.; Plachaty, C.; Kindel, J. M.

    2008-11-01

    A new geometry for the load area in the Zebra (1MA pulse generator) is developed. It will form the basis for future experiments requiring Leopard (1057nm, 50TW laser) to Zebra coupling and give extended capability to z-pinch diagnostics. This required the development of a new current return, which allows laser access and installation of the OD 4'' parabolic mirror for the x-ray radiography, isochoric heating and magnetized plasma experiments, and accommodates wire-array z-pinch loads, to which the laser may then be coupled. In addition, this configuration allows diagnostics access close to the plasma, leading to a significant increase of the spatial resolution for imaging of z-pinches, as well as the photon flux in imaging and spectroscopy of laser produced plasmas. These diagnostics will allow coupling of the Leopard beam for x-ray laser probing of the pinch plasma and we will test point-projection x-ray backlighting of the pinch plasma.

  15. Fabrication and characterization of He-charged ODS-FeCrNi films deposited by a radio-frequency plasma magnetron sputtering technique

    NASA Astrophysics Data System (ADS)

    Liang, SONG; Xianping, WANG; Le, WANG; Ying, ZHANG; Wang, LIU; Weibing, JIANG; Tao, ZHANG; Qianfeng, FANG; Changsong, LIU

    2017-04-01

    He-charged oxide dispersion strengthened (ODS) FeCrNi films were prepared by a radio-frequency (RF) plasma magnetron sputtering method in a He and Ar mixed atmosphere at 150 °C. As a comparison, He-charged FeCrNi films were also fabricated at the same conditions through direct current (DC) plasma magnetron sputtering. The doping of He atoms and Y2O3 in the FeCrNi films was realized by the high backscattered rate of He ions and Y2O3/FeCrNi composite target sputtering method, respectively. Inductive coupled plasma (ICP) and x-ray photoelectron spectroscopy (XPS) analysis confirmed the existence of Y2O3 in FeCrNi films, and Y2O3 content hardly changed with sputtering He/Ar ratio. Cross-sectional scanning electron microscopy (SEM) shows that the FeCrNi films were composed of dense columnar nanocrystallines and the thickness of the films was obviously dependent on He/Ar ratio. Nanoindentation measurements revealed that the FeCrNi films fabricated through DC/RF plasma magnetron sputtering methods exhibited similar hardness values at each He/Ar ratio, while the dispersion of Y2O3 apparently increased the hardness of the films. Elastic recoil detection (ERD) showed that DC/RF magnetron sputtered FeCrNi films contained similar He amounts (∼17 at.%). Compared with the minimal change of He level with depth in DC-sputtered films, the He amount decreases gradually in depth in the RF-sputtered films. The Y2O3-doped FeCrNi films were shown to exhibit much smaller amounts of He owing to the lower backscattering possibility of Y2O3 and the inhibition effect of nano-sized Y2O3 particles on the He element.

  16. Vitamin E prevents increase in oxidative damage to lipids and DNA in liver of ODS rats given total body X-ray irradiation.

    PubMed

    Yoshimura, Mika; Kashiba, Misato; Oka, Jun; Sugisawa, Ayako; Umegaki, Keizo

    2002-01-01

    We examined the effects of dietary vitamin E (VE) on oxidative damage to DNA and lipids in the liver a few days after total body irradiation (TBI). ODS rats, which lack vitamin C synthesis, were fed either a low VE diet (4.3 mg VE/kg) or a basal VE diet (75.6 mg VE/kg) for 5 weeks while vitamin C was supplied in the drinking water. The VE level in the liver of the low VE group was lower and the levels of lipid peroxides were higher compared to those of the basal VE group: the relative levels in the two groups were 1:30 for VE, 18:1 for 4-hydroxynonenal (HNE), and 10:1 for hexanal (HA). The level of 8-hydroxydeoxyguanosine (8OHdG), a marker of oxidative DNA damage, did not differ between the low VE and the basal VE groups. When the rats received TBI at the dose of 3 Gy and were killed on day 6, the levels of HNE, HA and 8OHdG increased by 2.2-, 2-, and 1.5-times, respectively, in the low VE group, but TBI did not cause such increases in the basal VE group. Changes in antioxidative enzymes (glutathione peroxidase, catalase, and Cu/Zn-SOD) in the liver could not explain the different responses of the two diet groups to TBI-induced oxidative damage. The concentrations of vitamin C and glutathione in the liver did not differ between the two groups. These results suggest that dietary VE can prevent the oxidative damage to DNA and lipids in the liver which appear a few days after TBI at dose of 3 Gy.

  17. Microstructural evaluation during mechanical milling and consolidation of ODS L1{sub 2}-(Al,Cr){sub 3}Ti[Oxide Dispersion Strengthened

    SciTech Connect

    Saage, H.; Heilmaier, M.; Eckert, J.; Schultz, L.

    1999-07-01

    The effect of different oxide particles on the microstructure and the high temperature creep behavior of ODS ternary L1{sub 2}-(Al,Cr){sub 3}Ti intermetallic compounds, which were prepared by high energy ball milling, was analyzed. Particular attention was paid to the development of the dispersoid size and distribution after the milling process, the consolidation and the heat treatment. X-ray diffraction (XRD) and transmission electron microscopy (TEM) of the as-milled powders indicate that the ordered matrix can nearly be amorphized during milling. Moreover, independent of the type of oxide the dispersoids with a mean diameter {le}20 nm are homogeneously distributed in the metallic matrix. Using hot pressing under protective atmosphere the powders were compacted to nearly full density, followed by heat treatment. This results in grain sizes varying between 200 nanometers and several micrometers. However, due to the nature of the dispersoids used different particle diameters were found after consolidation and annealing. Although known to be the thermodynamically most stable oxide the initial Y{sub 2}O{sub 3} powder has formed a mixed yttrium-aluminum oxide during manufacturing and, hence, significant particle growth has been observed. While CeO{sub 2} shows a similar behavior, the line compound Al{sub 2}O{sub 3} remains stable, but the average particle size of this oxide also increases during the heat treatment. First preliminary mechanical tests supported by TEM observations show the significant influence of the grain size on the creep resistance at high temperatures.

  18. Sorption and degradation of selected organic UV filters (BM-DBM, 4-MBC, and OD-PABA) in laboratory water-sediment systems.

    PubMed

    Li, Sheng; Lu, Guanghua; Xie, Zhengxin; Ding, Jiannan; Liu, Jianchao; Li, Yi

    2016-05-01

    Organic UV filters that have been widely used in sunscreens and other personal care products have drawn much public concern because of their widespread contamination in the environment and their potential ecological risks to ecosystems. We selected three UV filters with high frequency of detection in the environment, namely butyl methoxy dibenzoylmethane (BM-DBM), ethylhexyl dimethyl p-aminobenzoate (OD-PABA), and 4-methylbenzylidene camphor (4-MBC), to investigate the sorption and degradation behaviors of these compounds in lab-scale water-sediment systems set up with natural water and sediment samples collected from different rivers and lakes (i.e., Yangtze River, Qinhuai River, Xuanwu Lake, and Mochou Lake) in Nanjing, East China. The sorption isotherms of these UV filters were well described by the Freundlich equation (C s   = K f  × C w (n) ). The sorption of three UV filters in four sediments was all linear or close to it, with n values between 0.92 and 1.13. A moderate to strong sorption affinity was observed for these compounds, and the sorption appears to be irreversible. For the combined sorption and degradation studies, sorption was found to be a primary mechanism for the disappearance of these UV filters from the water phase, and biotransformation appears to be the predominant factor for the degradation of the target compounds in the water-sediment systems. All three UV filters were found to be slightly resistant to the microbes in these systems, with DT50total and DT90total values-the disappearance time (DT) describes the time in which the initial total mass of the UV filters in the whole system is reduced by 50 and 90 %-ranging between 18 and 31 days and 68 and 101 days, respectively.

  19. Photoionization of hydroxymethyl (CD[sub 2]OH and CD[sub 2]OD) and methoxy (CD[sub 3]O) radicals. Photoion efficiency spectra, ionization energies, and thermochemistry

    SciTech Connect

    Kuo, S.C.; Zhang, Z.; Klemm, R.B. ); Liebman, J.F. ); Stief, L.J. ); Nesbitt, F.L. Coppin State College, Baltimore, MD )

    1994-04-14

    Photoion efficiency (PIE) spectra were obtained for CD[sub 2]OH, CD[sub 2]OD, and CD[sub 3]O radicals using the discharge flow-photoionization mass spectrometry technique. The radicals were generated in a flow tube via reaction of F atoms with the appropriate methanol isotopomers (CD[sub 3]OH [yields] CD[sub 2]OH, CD[sub 3]OD [yields] CD[sub 2]OD, and CD[sub 3]OH [yields] CD[sub 3]O), which were in large excess. Deuterated methoxy radicals, CD[sub 3]O, were also generated via the reaction of CD[sub 3] with NO[sub 2]. Photoionization of the radicals was achieved using high intensity, dispersed synchrotron radiation, and ionization energies (IE) of these radicals were derived from the thresholds of the PIE spectra: IE(CD[sub 2]OH) = 7.54 [+-] 0.02 eV, IE(CD[sub 2]OD) = 7.53 [+-] 0.02 eV, and IE(CD[sub 3]O) = 10.74 [+-] 0.02 eV. The PIE spectra for CD[sub 2]OH and CD[sub 3]O are compared to those of a previous photoionization study, and differences are discussed. Integration of previously published photoelectron spectroscopy data for CD[sub 2]OH yields a curve quite similar to our PIE spectrum. Empirical estimates of IE(CH[sub 2]OH) and IE(CH[sub 3]O) are given to corroborate our assignments. The measured ionization energies and the derived thermodynamic quantities are compared with previously reported results. 67 refs., 7 figs., 2 tabs.

  20. Nanocrystal waveguide (NOW) laser

    DOEpatents

    Simpson, John T.; Simpson, Marcus L.; Withrow, Stephen P.; White, Clark W.; Jaiswal, Supriya L.

    2005-02-08

    A solid state laser includes an optical waveguide and a laser cavity including at least one subwavelength mirror disposed in or on the optical waveguide. A plurality of photoluminescent nanocrystals are disposed in the laser cavity. The reflective subwavelength mirror can be a pair of subwavelength resonant gratings (SWG), a pair of photonic crystal structures (PC), or a distributed feedback structure. In the case of a pair of mirrors, a PC which is substantially transmissive at an operating wavelength of the laser can be disposed in the laser cavity between the subwavelength mirrors to improve the mode structure, coherence and overall efficiency of the laser. A method for forming a solid state laser includes the steps of providing an optical waveguide, creating a laser cavity in the optical waveguide by disposing at least one subwavelength mirror on or in the waveguide, and positioning a plurality of photoluminescent nanocrystals in the laser cavity.

  1. Infrared laser system

    DOEpatents

    Cantrell, Cyrus D.; Carbone, Robert J.; Cooper, Ralph

    1982-01-01

    An infrared laser system and method for isotope separation may comprise a molecular gas laser oscillator to produce a laser beam at a first wavelength, Raman spin flip means for shifting the laser to a second wavelength, a molecular gas laser amplifier to amplify said second wavelength laser beam to high power, and optical means for directing the second wavelength, high power laser beam against a desired isotope for selective excitation thereof in a mixture with other isotopes. The optical means may include a medium which shifts the second wavelength high power laser beam to a third wavelength, high power laser beam at a wavelength coincidental with a corresponding vibrational state of said isotope and which is different from vibrational states of other isotopes in the gas mixture.

  2. Infrared laser system

    DOEpatents

    Cantrell, Cyrus D.; Carbone, Robert J.; Cooper, Ralph S.

    1977-01-01

    An infrared laser system and method for isotope separation may comprise a molecular gas laser oscillator to produce a laser beam at a first wavelength, Raman spin flip means for shifting the laser to a second wavelength, a molecular gas laser amplifier to amplify said second wavelength laser beam to high power, and optical means for directing the second wavelength, high power laser beam against a desired isotope for selective excitation thereof in a mixture with other isotopes. The optical means may include a medium which shifts the second wavelength high power laser beam to a third wavelength, high power laser beam at a wavelength coincidental with a corresponding vibrational state of said isotope and which is different from vibrational states of other isotopes in the gas mixture.

  3. Laser Surveying

    NASA Technical Reports Server (NTRS)

    1978-01-01

    NASA technology has produced a laser-aided system for surveying land boundaries in difficult terrain. It does the job more accurately than conventional methods, takes only one-third the time normally required, and is considerably less expensive. In surveying to mark property boundaries, the objective is to establish an accurate heading between two "corner" points. This is conventionally accomplished by erecting a "range pole" at one point and sighting it from the other point through an instrument called a theodolite. But how do you take a heading between two points which are not visible to each other, for instance, when tall trees, hills or other obstacles obstruct the line of sight? That was the problem confronting the U.S. Department of Agriculture's Forest Service. The Forest Service manages 187 million acres of land in 44 states and Puerto Rico. Unfortunately, National Forest System lands are not contiguous but intermingled in complex patterns with privately-owned land. In recent years much of the private land has been undergoing development for purposes ranging from timber harvesting to vacation resorts. There is a need for precise boundary definition so that both private owners and the Forest Service can manage their properties with confidence that they are not trespassing on the other's land.

  4. Ascorbic acid deficiency decreases hepatic cytochrome P-450, especially CYP2B1/2B2, and simultaneously induces heme oxygenase-1 gene expression in scurvy-prone ODS rats.

    PubMed

    Kobayashi, Misato; Hoshinaga, Yukiko; Miura, Natsuko; Tokuda, Yuki; Shigeoka, Shigeru; Murai, Atsushi; Horio, Fumihiko

    2014-01-01

    The mechanisms underlying the decrease in hepatic cytochrome P-450 (CYP) content in ascorbic acid deficiency was investigated in scurvy-prone ODS rats. First, male ODS rats were fed a diet containing sufficient ascorbic acid (control) or a diet without ascorbic acid (deficient) for 18 days, with or without the intraperitoneal injection of phenobarbital. Ascorbic acid deficiency decreased hepatic microsomal total CYP content, CYP2B1/2B2 protein, and mitochondrial cytochrome oxidase (COX) complex IV subunit I protein, and simultaneously increased heme oxygenase-1 protein in microsomes and mitochondria. Next, heme oxygenase-1 inducers, that is lipopolysaccharide and hemin, were administered to phenobaribital-treated ODS rats fed sufficient ascorbic acid. The administration of these inducers decreased hepatic microsomal total CYP content, CYP2B1/2B2 protein, and mitochondrial COX complex IV subunit I protein. These results suggested that the stimulation of hepatic heme oxygenase-1 expression by ascorbic acid deficiency caused the decrease in CYP content in liver.

  5. Alexandrite laser pumped by semiconductor lasers

    SciTech Connect

    Scheps, R.; Gately, B.M.; Myers, J.F. ); Krasinski, J.S. ); Heller, D.F. )

    1990-06-04

    We report the first operation of a direct diode-pumped tunable chromium-doped solid-state laser. A small alexandrite (Cr:BeAl{sub 2}O{sub 4}) crystal was longitudinally pumped by two visible laser diodes. The threshold pump power was 12 mW using the {ital R}{sub 1} line at 680.4 nm for the pump transition, and the slope efficiency was 25%. The measured laser output bandwidth was 2.1 nm.

  6. Alexandrite laser pumped by semiconductor lasers

    NASA Astrophysics Data System (ADS)

    Scheps, Richard; Gately, Bernard M.; Myers, Joseph F.; Krasinski, Jerzy S.; Heller, Donald F.

    1990-06-01

    We report the first operation of a direct diode-pumped tunable chromium-doped solid-state laser. A small alexandrite (Cr:BeAl2O4) crystal was longitudinally pumped by two visible laser diodes. The threshold pump power was 12 mW using the R1 line at 680.4 nm for the pump transition, and the slope efficiency was 25%. The measured laser output bandwidth was 2.1 nm.

  7. Tri-length laser therapy associated to tecar therapy in the treatment of low-back pain in adults: a preliminary report of a prospective case series.

    PubMed

    Osti, Raffaella; Pari, Carlotta; Salvatori, Giada; Massari, Leo

    2015-01-01

    Low-back pain is very frequent, especially in active adult population. There are several different orthopaedic condition that can cause low-back pain, and the pain worsen the quality of life significantly. The treatments vary from drugs, physical therapies, kinesiology, local infiltrations, and so on. Laser therapy has an important role in the treatment of the inflammatory causes of pain, with several studies that demonstrate the efficacy of low and high energy laser therapy in the treatment of low-back pain. Sixty-six consecutive patients with low-back pain with or without leg pain were treated using a combination of Tri-length laser I-Triax® (Mectronic Medicale, Bergamo, Italy) and Pharon® tecar therapy (Mectronic Medicale, Bergamo, Italy). The patients were treated three times a week, every other day, for a total of 10 sessions. Clinical results were evaluated using visual analogic scale for individual pain (0 to 10) and the Oswestry disability scale (ODS). Tests started before the beginning of therapies and 8 weeks after the end of the therapies. Visual analogic scale (VAS) score significantly improved from an average value of 8.1 ± 1.58 pre-treatment to an average value 8-weeks post-treatment of 2.63 ± 2.74 (P < .01). ODS values start from a pre-treatment average value of 53.0 ± 13.0 to a post-treatment average value of 23.5 ± 19.8 (P < .01). A higher improvement both in VAS and in ODS was denoted in the group of patient with low-back pain and leg pain (respectively, VAS from 8.66 ± 1.58 to 2.86 ± 2.94 and ODS from 57.8 ± 15.5 to 23.7 ± 19.5). Low-back pain, associated or not with leg pain, is a very common clinical situation. The treatments of this condition are different, and an important role can be given to the laser therapy. The conclusion of this study is that the association between laser therapy iLux-Triax® and tecar therapy Pharon® in the treatment of low-back pain, with or without leg pain, can

  8. Lasers in aviation

    NASA Astrophysics Data System (ADS)

    Goncharov, I. N.; Dezhin, V. N.; Kutakhov, V. P.; Petukhov, A. V.; Sidorin, V. M.; Sukhar, I. M.

    The way in which lasers are being incorporated into the military aircraft of the United States and the countries of Western Europe is discussed. Descriptions are given of laser weapons-guiding systems (including ranger finders and systems for target illumination), laser systems for navigation and flight-safety assurance (gyroscopes, velocity gauges, altimeters, systems providing meteorological data, proximity warning systems), and laser systems for air reconnaissance, communications, and control. Attention is also given to the Glissada laser guide path system, developed in the USSR. The physics of the systems is emphasized in the description and the principles underlying the operation of a laser are discussed in the introduction.

  9. Lasers in periodontics.

    PubMed

    Elavarasu, Sugumari; Naveen, Devisree; Thangavelu, Arthiie

    2012-08-01

    Laser is one of the most captivating technologies in dental practice since Theodore Maiman in 1960 invented the ruby laser. Lasers in dentistry have revolutionized several areas of treatment in the last three and a half decades of the 20(th) century. Introduced as an alternative to mechanical cutting device, laser has now become an instrument of choice in many dental applications. Evidence suggests its use in initial periodontal therapy, surgery, and more recently, its utility in salvaging implant opens up a wide range of applications. More research with better designs are a necessity before lasers can become a part of dental armamentarium. This paper gives an insight to laser in periodontics.

  10. Tunable chromium lasers

    SciTech Connect

    Chase, L.L.; Payne, S.A.

    1989-01-01

    During the decade that has passed since the discovery of the alexandrite laser, many other tunable vibronic sideband lasers based on Cr/sup 3 +/ have been developed. These lasers span the wavelength range from 700 nm to at least 1235 nm. Experimental and theoretical research has provided an understanding of the important factors that influence the performance of these Cr/sup 3 +/ lasers and other solid state vibronic lasers. The intrinsic performance levels of some of the most promising Cr/sup 3 +/ lasers are evaluated from extrapolated slope efficiency measurements. 7 refs., 4 figs., 2 tabs.

  11. Maser and laser engineering

    SciTech Connect

    Ishii, T.K.

    1980-01-01

    This book is intended to be a textbook for an upper division one-semester electrical engineering course. Students are expected to have had some undegraduate course work in modern physics and in electromagnetic field theory. General aspects regarding devices based on quantum electronics are considered along with gas masers, solid masers, gas lasers, solid lasers, semiconductor lasers, liquid lasers, modulation techniques for lasers, and opto-electrical demodulators and energy convertors. Attention is given to quantum electric harmonic generators, Raman lasers, optical parametric interactions, holograms, optical terms, crystallographic terms, band theory, Schroedinger formulation and Dirac formation, and the quantum number of electrons in a hydrogen atom.

  12. Laser peening of metals- enabling laser technology

    SciTech Connect

    Dane, C.B.; Hackel, L.A.; Daly, J.; Harrisson, J.

    1997-11-13

    Laser peening, a surface treatment for metals, employs laser induced shocks to create deep and intense residual stresses in critical components. In many applications this technology is proving to be superior to conventional treatments such as shot peening. The laser peening process has generated sufficiently impressive results to move it from a laboratory demonstration phase into a significant industrial process. However until now this evolution has been slowed because a laser system meeting the average power requirements for a high throughput process has been lacking.

  13. Laser Spectroscopy

    NASA Astrophysics Data System (ADS)

    Hollberg, Leo; Bergquist, James Charles; Kasevich, Mark A.

    2008-04-01

    Degenerate gases. Probing vortex pair sizes in the Berezinskii-Kosterlitz-Thouless regime on a two-dimensional lattice of Bose-Einstein condensates / V. Schweikhard ... [et al.]. Interacting Bose-Einstein condensates in random potentials / P. Bouyer ... [et al.]. Towards quantum magnetism with ultracold atoms in optical lattices / I. Bloch -- Precision measurement and fundamental physics. T-violation and the search for a permanent electric dipole moment of the mercury atom / E. N. Fortson -- Quantum information and control I. Quantum information processing and ramsey spectroscopy with trapped ions / C. F. Roos ... [et al.]. Quantum non-demolition counting of photons in a cavity / S. Haroche ... [et al.] -- Ultra-fast control and spectroscopy. Frequency-Comb- assisted mid-infrared spectroscopy / P. de Natale ... [et al.] -- Precision measurement and applications. Precision gravity tests by atom interferometry / G. M. Tino ... [et al.] -- Novel spectroscopic applications. On a variation of the proton-electron mass ratio / W. Ubachs ... [et al.] -- Quantum information and control II. Quantum interface between light and atomic ensembles / H. Krauter ... [et al.] -- Degenerate Fermi gases. An atomic Fermi gas near a P-wave Feshbach resonance / D. S. Jin, J. P. Gaebler and J. T. Stewart. Bragg scattering of correlated atoms from a degenerate Fermi gas / R. J. Ballagh, K. J. Challis and C. W. Gardiner -- Spectroscopy and control of atoms and molecules. Stark and Zeeman deceleration of neutral atoms and molecules / S. D. Hogan ... [et al.]. Generation of coherent, broadband and tunable soft x-ray continuum at the leading edge of the driver laser pulse / A. Jullien ... [et al.]. Controlling neural atoms and photons with optical conveyor belts and ultrathin optical fibers / D. Meschede. W. Alt and A. Rauschenbeutel -- Spectroscopy on the small scale. Wide-field cars-microscopy / C. Heinrich ... [et al.]. Atom nano-optics and nano-lithography / V. I. Balykin ... [et al

  14. Laser amplifier and method

    DOEpatents

    Backus, Sterling; Kapteyn, Henry C.; Murnane, Margaret M.

    1997-01-01

    Laser amplifiers and methods for amplifying a laser beam are disclosed. A representative embodiment of the amplifier comprises first and second curved mirrors, a gain medium, a third mirror, and a mask. The gain medium is situated between the first and second curved mirrors at the focal point of each curved mirror. The first curved mirror directs and focuses a laser beam to pass through the gain medium to the second curved mirror which reflects and recollimates the laser beam. The gain medium amplifies and shapes the laser beam as the laser beam passes therethough. The third mirror reflects the laser beam, reflected from the second curved mirror, so that the laser beam bypasses the gain medium and return to the first curved mirror, thereby completing a cycle of a ring traversed by the laser beam. The mask defines at least one beam-clipping aperture through which the laser beam passes during a cycle. The gain medium is pumped, preferably using a suitable pumping laser. The laser amplifier can be used to increase the energy of continuous-wave or, especially, pulsed laser beams including pulses of femtosecond duration and relatively high pulse rate.

  15. Laser amplifier and method

    DOEpatents

    Backus, S.; Kapteyn, H.C.; Murnane, M.M.

    1997-07-01

    Laser amplifiers and methods for amplifying a laser beam are disclosed. A representative embodiment of the amplifier comprises first and second curved mirrors, a gain medium, a third mirror, and a mask. The gain medium is situated between the first and second curved mirrors at the focal point of each curved mirror. The first curved mirror directs and focuses a laser beam to pass through the gain medium to the second curved mirror which reflects and recollimates the laser beam. The gain medium amplifies and shapes the laser beam as the laser beam passes therethrough. The third mirror reflects the laser beam, reflected from the second curved mirror, so that the laser beam bypasses the gain medium and return to the first curved mirror, thereby completing a cycle of a ring traversed by the laser beam. The mask defines at least one beam-clipping aperture through which the laser beam passes during a cycle. The gain medium is pumped, preferably using a suitable pumping laser. The laser amplifier can be used to increase the energy of continuous-wave or, especially, pulsed laser beams including pulses of femtosecond duration and relatively high pulse rate. 7 figs.

  16. Phased laser array for generating a powerful laser beam

    DOEpatents

    Holzrichter, John F.; Ruggiero, Anthony J.

    2004-02-17

    A first injection laser signal and a first part of a reference laser beam are injected into a first laser element. At least one additional injection laser signal and at least one additional part of a reference laser beam are injected into at least one additional laser element. The first part of a reference laser beam and the at least one additional part of a reference laser beam are amplified and phase conjugated producing a first amplified output laser beam emanating from the first laser element and an additional amplified output laser beam emanating from the at least one additional laser element. The first amplified output laser beam and the additional amplified output laser beam are combined into a powerful laser beam.

  17. Diffusing, side-firing, and radial delivery laser balloon catheters for creating subsurface thermal lesions in tissue

    NASA Astrophysics Data System (ADS)

    Chang, Chun-Hung; Fried, Nathaniel M.

    2016-02-01

    Infrared lasers have been used in combination with applied cooling methods to preserve superficial skin layers during cosmetic surgery. Similarly, combined laser irradiation and tissue cooling may also allow development of minimally invasive laser therapies beyond dermatology. This study compares diffusing, side-firing, and radial delivery laser balloon catheter designs for creation of subsurface lesions in tissue, ex vivo, using a near-IR laser and applied contact cooling. An Ytterbium fiber laser with 1075 nm wavelength delivered energy through custom built 18 Fr (6-mm-OD) balloon catheters incorporating either 10-mm-long diffusing fiber tip, 90 degree side-firing fiber, or radial delivery cone mirror, through a central lumen. A chilled solution was flowed through a separate lumen into 9-mm-diameter balloon to keep probe cooled at 7°C. Porcine liver tissue samples were used as preliminary tissue model for immediate observation of thermal lesion creation. The diffusing fiber produced subsurface thermal lesions measuring 49.3 +/- 10.0 mm2 and preserved 0.8 +/- 0.1 mm of surface tissue. The side-firing fiber produced subsurface thermal lesions of 2.4 +/- 0.9 mm2 diameter and preserved 0.5 +/- 0.1 mm of surface tissue. The radial delivery probe assembly failed to produce subsurface thermal lesions, presumably due to the small effective spot diameter at the tissue surface, which limited optical penetration depth. Optimal laser power and irradiation time measured 15 W and 100 s for diffusing fiber and 1.4 W and 20 s, for side-firing fiber, respectively. Diffusing and side-firing laser balloon catheter designs provided subsurface thermal lesions in tissue. However, the divergent laser beam in both designs limited the ability to preserve a thicker layer of tissue surface. Further optimization of laser and cooling parameters may be necessary to preserve thicker surface tissue layers.

  18. Laser particle sorter

    DOEpatents

    Martin, J.C.; Buican, T.N.

    1987-11-30

    Method and apparatus are provided for sorting particles, such as biological particles. A first laser is used to define an optical path having an intensity gradient which is effective to propel the particles along the path but which is sufficiently weak that the particles are not trapped in an axial direction. A probe laser beam is provided for interrogating the particles to identify predetermined phenotypical characteristics of the particles. A second laser beam is provided to intersect the driving first laser beam, wherein the second laser beam is activated by an output signal indicative of a predetermined characteristic. The second laser beam is switchable between a first intensity and a second intensity, where the first intensity is effective to displace selected particles from the driving laser beam and the second intensity is effective to propel selected particles along the deflection laser beam. The selected particles may then be propelled by the deflection beam to a location effective for further analysis. 2 figs.

  19. Laser particle sorter

    DOEpatents

    Martin, John C.; Buican, Tudor N.

    1989-01-01

    Method and apparatus for sorting particles, such as biological particles. A first laser defines an optical path having an intensity gradient which is effective to propel the particles along the path but which is sufficiently weak that the particles are not trapped in an axial direction. A probe laser beam interrogates the particles to identify predetermined phenotypical characteristics of the particles. A second laser beam intersects the driving first laser beam, wherein the second laser beam is activated by an output signal indicative of a predetermined characteristic. The second laser beam is switchable between a first intensity and a second intensity, where the first intensity is effective to displace selected particles from the driving laser beam and the second intensity is effective to propel selected particles along the deflection laser beam. The selected particles may then be propelled by the deflection beam to a location effective for further analysis.

  20. Slender tip laser scalpel

    DOEpatents

    Veligdan, James T.

    2004-01-06

    A laser scalpel includes a ribbon optical waveguide extending therethrough and terminating at a slender optical cutting tip. A laser beam is emitted along the height of the cutting tip for cutting tissue therealong.

  1. Laser device and method

    SciTech Connect

    Myers, J. D.

    1985-06-25

    A simplified, relatively inexpensive laser device, wherein the laser elements are fixed in a body exoskeleton of electrical insulating material having a low coefficient of thermal expansion. The preferred embodiment includes a shotgun type laser filter having parallel bores which receive the laser flashlamp and laser rod in fixed relation in a body chamber. The reflector surrounds the laser filter and retains the filter within the body chamber. In the preferred method of this invention, several controlled lasing pulses are generated with each illumination pulse of the flashlamp, substantially increasing the efficiency of the laser device. The number of pulses is generally controlled by increasing the voltage to the flashlamp. The rapid multiple lasing pulses generate an elongated plasma in a fluid medium, such as the vitreous fluid body of an eye which makes the laser device extemely efficient for treating glaucoma and other medical treatments.

  2. Laser hair removal.

    PubMed

    Wanner, Molly

    2005-01-01

    Since 1996, there have been numerous advances in hair laser removal that utilize melanin as a chromophore. All of the devices on the market may be used in patients with light skin (phototypes I-III) and yield hair reduction near 75%. The ruby (694 nm) laser, alexandrite (755 nm) laser, and diode (810 nm) laser, as well as intense pulsed light are commonly used devices for hair laser removal. The long-pulsed Nd:YAG (1064 nm) laser represents the safest device for hair removal in dark-skinned patients because of its long wavelength, although the diode laser, alexandrite laser, and intense pulse light may be used. For treatment of light hair, combination radiofrequency and optical devices as well as photodynamic therapy are under investigation.

  3. Laser Radar Animation

    NASA Video Gallery

    Laser and radar instruments aboard NASA aircraft provide measurements of the snow and ice surface and down to the bedrock under the ice. Lasers, with a shorter wavelength, measure the surface eleva...

  4. Direct nuclear pumped laser

    DOEpatents

    Miley, George H.; Wells, William E.; DeYoung, Russell J.

    1978-01-01

    There is provided a direct nuclear pumped gas laser in which the lasing mechanism is collisional radiated recombination of ions. The gas laser active medium is a mixture of the gases, with one example being neon and nitrogen.

  5. Laser surgery - skin

    MedlinePlus

    Surgery using a laser ... used is directly related to the type of surgery being performed and the color of the tissue ... Laser surgery can be used to: Close small blood vessels to reduce blood loss Remove warts , moles , sunspots, and ...

  6. Laser programs highlights 1993

    SciTech Connect

    1995-06-01

    Over the last two decades, the scope of our laser research has grown immensely. The small, low-power laser systems of our early days have given way to laser systems of record-breaking size and power. Now we are focusing our activities within the target physics and laser science programs to support the ignition and gain goals of the proposed glass-laser National Ignition Facility. In our laser isotope separation work, we completed the most important set of experiments in the history of the AVLIS Program in 1993, which culminated in a spectacularly successful run that met or exceeded all our objectives. We are also developing lasers and laser-related technologies for a variety of energy, commercial, and defense uses. On the horizon are transfers of important technologies for waste treatment, x-ray lithography, communications and security, optical imaging, and remote sensing, among others.

  7. MESSENGER Laser Altimeter

    NASA Video Gallery

    MESSENGER's Mercury Laser Altimeter sends out laser pulses that hit the ground and return to the instrument. The amount of light that returns for each pulse gives the reflectance at that point on t...

  8. Carbon dioxide slab laser

    SciTech Connect

    Tulip, J.

    1988-01-12

    A gas slab laser is described comprising: first and second elongated electrodes each including a planar light reflecting surface disposed so as to form a light guide only in a plane perpendicular to the planar surface and to define a gas discharge gap therebetween; a laser gas disposed in the gap; and means for applying a radio frequency current between the first and second electrodes to establish a laser-exciting discharge in the laser gas.

  9. CO2 laser modeling

    NASA Technical Reports Server (NTRS)

    Johnson, Barry

    1992-01-01

    The topics covered include the following: (1) CO2 laser kinetics modeling; (2) gas lifetimes in pulsed CO2 lasers; (3) frequency chirp and laser pulse spectral analysis; (4) LAWS A' Design Study; and (5) discharge circuit components for LAWS. The appendices include LAWS Memos, computer modeling of pulsed CO2 lasers for lidar applications, discharge circuit considerations for pulsed CO2 lidars, and presentation made at the Code RC Review.

  10. Alkali-vapor lasers

    NASA Astrophysics Data System (ADS)

    Zweiback, J.; Komashko, A.; Krupke, W. F.

    2010-02-01

    We report on the results from several of our alkali laser systems. We show highly efficient performance from an alexandrite-pumped rubidium laser. Using a laser diode stack as a pump source, we demonstrate up to 145 W of average power from a CW system. We present a design for a transversely pumped demonstration system that will show all of the required laser physics for a high power system.

  11. Laser shaping of cartilage

    NASA Astrophysics Data System (ADS)

    Sobol, Emil N.; Bagratashvili, Victor N.; Omelchenko, Alexander I.; Sviridov, Alexander P.; Helidonis, Emmanuel S.; Kavvalos, George; Christodoulou, P. N.; Naoumidi, I.; Velegrakis, G.; Ovchinnikov, Yuriy M.; Shechter, A.

    1994-09-01

    The carbon dioxide laser has been used for the first time to change the cartilage's shape. After the laser irradiation the cartilage has the tendency to retain its new form. Different types of laser modified cartilage structures were studied. The inferred physical mechanism for cartilage shaping using the stresses relaxation process is presented. The clinical significance of the results for corrective laser surgery is discussed.

  12. Tunable semiconductor lasers

    NASA Technical Reports Server (NTRS)

    Taghavi-Larigani, Shervin (Inventor); Vanzyl, Jakob J. (Inventor); Yariv, Amnon (Inventor)

    2006-01-01

    Tunable semiconductor lasers are disclosed requiring minimized coupling regions. Multiple laser embodiments employ ring resonators or ring resonator pairs using only a single coupling region with the gain medium are detailed. Tuning can be performed by changing the phase of the coupling coefficient between the gain medium and a ring resonator of the laser. Another embodiment provides a tunable laser including two Mach-Zehnder interferometers in series and a reflector coupled to a gain medium.

  13. Short wavelength laser

    DOEpatents

    Hagelstein, Peter L.

    1986-01-01

    A short wavelength laser (28) is provided that is driven by conventional-laser pulses (30, 31). A multiplicity of panels (32), mounted on substrates (34), are supported in two separated and alternately staggered facing and parallel arrays disposed along an approximately linear path (42). When the panels (32) are illuminated by the conventional-laser pulses (30, 31), single pass EUV or soft x-ray laser pulses (44, 46) are produced.

  14. Laser cutting system

    SciTech Connect

    Dougherty, Thomas J

    2015-03-03

    A workpiece cutting apparatus includes a laser source, a first suction system, and a first finger configured to guide a workpiece as it moves past the laser source. The first finger includes a first end provided adjacent a point where a laser from the laser source cuts the workpiece, and the first end of the first finger includes an aperture in fluid communication with the first suction system.

  15. Laser Assisted Microsurgical Anastomosis.

    DTIC Science & Technology

    1983-09-22

    Miami School of Medicine This Paper describes new experimental microsurgical procedures that * utilize laser infrared energy emitted at 10.6 um to...dioxide laser microsurgical technique takes advantage of the very high absorption of laser energy (at 10.6 um) by water in soft tissue to effect successful...describes a new surgical technique that utilizes laser heat energy to repair transected rat sciatic nerves, and nerve grafts. The energy emitted at

  16. Laser Detection of Pollution.

    ERIC Educational Resources Information Center

    Patel, C. K. N.

    1978-01-01

    Discusses the use of laser spectroscopy in determining the presence of specific gaseous constituents. Three of currently used modes for laser detection of pollution are reviewed; (1) long-path measurements; (2) laser raman (differential absorption) measurements; and (3) optoacoustic detection. (HM)

  17. Laser bottom hole assembly

    SciTech Connect

    Underwood, Lance D; Norton, Ryan J; McKay, Ryan P; Mesnard, David R; Fraze, Jason D; Zediker, Mark S; Faircloth, Brian O

    2014-01-14

    There is provided for laser bottom hole assembly for providing a high power laser beam having greater than 5 kW of power for a laser mechanical drilling process to advance a borehole. This assembly utilizes a reverse Moineau motor type power section and provides a self-regulating system that addresses fluid flows relating to motive force, cooling and removal of cuttings.

  18. Velocimetry with diode lasers

    NASA Astrophysics Data System (ADS)

    de Mul, F. F. M.; Jentink, H. W.; Koelink, M.; Greve, J.; Aarnoudse, J. G.

    The history of the application of diode lasers in velocimetry is reviewed. Some problems arising when using those lasers, e.g., mode hopping and wavelength shifts caused by temperature effects, are discussed, together with coherence effects encountered with diode lasers. The application in dual-beam velocimetry, in direct-contact velocimetry and in velocimetry using self-mixing will be discussed.

  19. Argon laser for otosclerosis

    NASA Astrophysics Data System (ADS)

    Michalski, Wojciech; Pospiech, Lucyna; Jankowska-Kuc, Malgorzata

    1995-03-01

    Up to now, among different kinds of lasers an argon laser is mostly used for otosclerosis. Exposure conditions at use of the laser beam are still not well defined. In order to achieve the optimum conditions a series of experiments has been made. Obtained results are presented in this paper.

  20. Laser power transmission

    NASA Technical Reports Server (NTRS)

    Conway, Edmund J.

    1992-01-01

    An overview of previous studies related to laser power transmission is presented. Particular attention is given to the use of solar pumped lasers for space power applications. Three general laser mechanisms are addressed: photodissociation lasing driven by sunlight, photoexcitation lasing driven directly by sunlight, and photoexcitation lasing driven by thermal radiation.

  1. LaserFest Celebration

    SciTech Connect

    Dr. Alan Chodos; Elizabeth A. Rogan

    2011-08-25

    LaserFest was the yearlong celebration, during 2010, of the 50th anniversary of the demonstration of the first working laser. The goals of LaserFest were: to highlight the impact of the laser in its manifold commercial, industrial and medical applications, and as a tool for ongoing scientific research; to use the laser as one example that illustrates, more generally, the route from scientific innovation to technological application; to use the laser as a vehicle for outreach, to stimulate interest among students and the public in aspects of physical science; to recognize and honor the pioneers who developed the laser and its many applications; to increase awareness among policymakers of the importance of R&D funding as evidenced by such technology as lasers. One way in which LaserFest sought to meet its goals was to encourage relevant activities at a local level all across the country -- and also abroad -- that would be identified with the larger purposes of the celebration and would carry the LaserFest name. Organizers were encouraged to record and advertise these events through a continually updated web-based calendar. Four projects were explicitly detailed in the proposals: 1) LaserFest on the Road; 2) Videos; 3) Educational material; and 4) Laser Days.

  2. Laser Fundamentals and Experiments.

    ERIC Educational Resources Information Center

    Van Pelt, W. F.; And Others

    As a result of work performed at the Southwestern Radiological Health Laboratory with respect to lasers, this manual was prepared in response to the increasing use of lasers in high schools and colleges. It is directed primarily toward the high school instructor who may use the text for a short course in laser fundamentals. The definition of the…

  3. Infrared diode laser spectroscopy

    NASA Astrophysics Data System (ADS)

    Civiš, S.; Cihelka, J.; Matulková, I.

    2010-12-01

    Three types of lasers (double-heterostructure 66 K InAsSb/InAsSbP laser diode, room temperature, multi quantum wells with distributed feedback (MQW with DFB) (GaInAsSb/AlGaAsSb based) diode laser and vertical cavity surface emitting lasers (VCSELs) (GaSb based) have been characterized using Fourier transform emission spectroscopy and compared. The photoacoustic technique was employed to determine the detection limit of formaldehyde (less than 1 ppmV) for the strongest absorption line of the v3 + v5 band in the emission region of the GaInAsSb/AlGaAsSb diode laser. The detection limit (less than 10 ppbV) of formaldehyde was achieved in the 2820 cm-1 spectral range in case of InAsSb/InAsSbP laser (fundamental bands of v1, v5). Laser sensitive detection (laser absorption together with high resolution Fourier transform infrared technique including direct laser linewidth measurement, infrared photoacoustic detection of neutral molecules (methane, form-aldehyde) is discussed. Additionally, very sensitive laser absorption techniques of such velocity modulation are discussed for case of laser application in laboratory research of molecular ions. Such sensitive techniques (originally developed for lasers) contributed very much in identifying laboratory microwave spectra of a series of anions (C6H-, C4H-, C2H-, CN-) and their discovery in the interstellar space (C6H-, C4H-).

  4. Laser Programs Highlights 1998

    SciTech Connect

    Lowdermilk, H.; Cassady, C.

    1999-12-01

    This report covers the following topics: Commentary; Laser Programs; Inertial Confinement Fusion/National Ignition Facility (ICF/NIF); Atomic Vapor Laser Isotope Separation (AVLIS); Laser Science and Technology (LS&T); Information Science and Technology Program (IS&T); Strategic Materials Applications Program (SMAP); Medical Technology Program (MTP) and Awards.

  5. Lasers for nonlinear microscopy.

    PubMed

    Wise, Frank

    2013-03-01

    Various versions of nonlinear microscopy are revolutionizing the life sciences, almost all of which are made possible because of the development of ultrafast lasers. In this article, the main properties and technical features of short-pulse lasers used in nonlinear microscopy are summarized. Recent research results on fiber lasers that will impact future instruments are also discussed.

  6. Polarization feedback laser stabilization

    DOEpatents

    Esherick, Peter; Owyoung, Adelbert

    1988-01-01

    A system for locking two Nd:YAG laser oscillators includes an optical path for feeding the output of one laser into the other with different polarizations. Elliptical polarization is incorporated into the optical path so that the change in polarization that occurs when the frequencies coincide may be detected to provide a feedback signal to control one laser relative to the other.

  7. Zeeman laser gyroscopes

    SciTech Connect

    Azarova, V V; Golyaev, Yu D; Saveliev, I I

    2015-02-28

    The history of invention and development of Zeeman laser gyroscopes, specific features of their optical scheme and operation principle are described. The construction and element base of modern laser angular velocity sensors with Zeeman-based frequency biasing are considered. The problems and prospects of their development are discussed. (laser gyroscopes)

  8. Excimer Lasers In Medicine

    NASA Astrophysics Data System (ADS)

    Tittel, Frank K.; Saidi, Iyad S.; Pettit, George H.; Wisoff, P. J.; Sauerbrey, Roland A.

    1989-06-01

    Excimer lasers emit light energy, short optical pulses at ultraviolet wavelengths, that results in a unique laser tissue interaction. This has led to an increasing number of studies into medical applications of these lasers in fields such as ophthalmology, urology, cardiology and neurology.

  9. Solar pumped laser

    NASA Technical Reports Server (NTRS)

    Lee, J. H.; Hohl, F.; Weaver, W. R. (Inventor)

    1984-01-01

    A solar pumped laser is described in which the lasant is a gas that will photodissociate and lase when subjected to sunrays. Sunrays are collected and directed onto the gas lasant to cause it to lase. Applications to laser propulsion and laser power transmission are discussed.

  10. Laser material processing system

    DOEpatents

    Dantus, Marcos

    2015-04-28

    A laser material processing system and method are provided. A further aspect of the present invention employs a laser for micromachining. In another aspect of the present invention, the system uses a hollow waveguide. In another aspect of the present invention, a laser beam pulse is given broad bandwidth for workpiece modification.

  11. Diode laser and endoscopic laser surgery.

    PubMed

    Sullins, Kenneth E

    2002-05-01

    Two functionally important differences exist between the diode laser and the carbon dioxide (CO2) laser (used more commonly in small animal surgery). Diode laser energy is delivered through a quartz fiber instead of being reflected through an articulated arm or waveguide. Quartz fibers are generally more flexible and resilient than waveguides and can be inserted through an endoscope for minimally invasive procedures. Laser-tissue interaction is the other significant difference. The CO2 laser is completely absorbed by water, which limits the effect to visible tissue. The diode wavelength is minimally absorbed by water and may affect tissue as deep as 10 mm below the surface in the free-beam mode. With proper respect for the tissue effect, these differences can be used to the advantage of the patient.

  12. Chalcogenide glass microsphere laser.

    PubMed

    Elliott, Gregor R; Murugan, G Senthil; Wilkinson, James S; Zervas, Michalis N; Hewak, Daniel W

    2010-12-06

    Laser action has been demonstrated in chalcogenide glass microsphere. A sub millimeter neodymium-doped gallium lanthanum sulphide glass sphere was pumped at 808 nm with a laser diode and single and multimode laser action demonstrated at wavelengths between 1075 and 1086 nm. The gallium lanthanum sulphide family of glass offer higher thermal stability compared to other chalcogenide glasses, and this, along with an optimized Q-factor for the microcavity allowed laser action to be achieved. When varying the pump power, changes in the output spectrum suggest nonlinear and/or thermal effects have a strong effect on laser action.

  13. Dual Wavelength Lasers

    NASA Technical Reports Server (NTRS)

    Walsh, Brian M.

    2010-01-01

    Dual wavelength lasers are discussed, covering fundamental aspects on the spectroscopy and laser dynamics of these systems. Results on Tm:Ho:Er:YAG dual wavelength laser action (Ho at 2.1 m and Er at 2.9 m) as well as Nd:YAG (1.06 and 1.3 m) are presented as examples of such dual wavelength systems. Dual wavelength lasers are not common, but there are criteria that govern their behavior. Based on experimental studies demonstrating simultaneous dual wavelength lasing, some general conclusions regarding the successful operation of multi-wavelength lasers can be made.

  14. Laser Diode Ignition (LDI)

    NASA Technical Reports Server (NTRS)

    Kass, William J.; Andrews, Larry A.; Boney, Craig M.; Chow, Weng W.; Clements, James W.; Merson, John A.; Salas, F. Jim; Williams, Randy J.; Hinkle, Lane R.

    1994-01-01

    This paper reviews the status of the Laser Diode Ignition (LDI) program at Sandia National Labs. One watt laser diodes have been characterized for use with a single explosive actuator. Extensive measurements of the effect of electrostatic discharge (ESD) pulses on the laser diode optical output have been made. Characterization of optical fiber and connectors over temperature has been done. Multiple laser diodes have been packaged to ignite multiple explosive devices and an eight element laser diode array has been recently tested by igniting eight explosive devices at predetermined 100 ms intervals.

  15. X-ray laser

    DOEpatents

    Nilsen, Joseph

    1991-01-01

    An X-ray laser (10) that lases between the K edges of carbon and oxygen, i.e. between 44 and 23 Angstroms, is provided. The laser comprises a silicon (12) and dysprosium (14) foil combination (16) that is driven by two beams (18, 20) of intense line focused (22, 24) optical laser radiation. Ground state nickel-like dysprosium ions (34) are resonantly photo-pumped to their upper X-ray laser state by line emission from hydrogen-like silicon ions (32). The novel X-ray laser should prove especially useful for the microscopy of biological specimens.

  16. Laser assisted deposition

    NASA Technical Reports Server (NTRS)

    Dutta, S.

    1983-01-01

    Applications of laser-based processing techniques to solar cell metallization are discussed. Laser-assisted thermal or photolytic maskless deposition from organometallic vapors or solutions may provide a viable alternative to photovoltaic metallization systems currently in use. High power, defocused excimer lasers may be used in conjunction with masks as an alternative to direct laser writing to provide higher throughput. Repeated pulsing with excimer lasers may eliminate the need for secondary plating techniques for metal film buildup. A comparison between the thermal and photochemical deposition processes is made.

  17. Stabilized Zeeman split laser

    NASA Technical Reports Server (NTRS)

    1981-01-01

    The development of a stablized Zeeman split laser for use in a polarization profilometer is discussed. A Hewlett-Packard laser was modified to stabilize the Zeeman split beat frequency thereby increasing the phase measurement accuracy from the Hewlett-Packard 3 degrees to an accuracy of .01 degrees. The addition of a two layered inductive winding converts the laser to a current controlled oscillator whose frequency is linearly related to coil current. This linear relationship between coil current and laser frequency permits phase locking the laser frequency to a stable crystal controlled reference frequency. The stability of the system is examined and the equipment operation procedures are outlined.

  18. A high speed three-dimensional spectral domain optical coherence tomography with <2 μm axial resolution using wide bandwidth femtosecond mode-locked laser

    NASA Astrophysics Data System (ADS)

    Kuroda, Hiroto; Baba, Motoyoshi; Suzuki, Masayuki; Yoneya, Shin

    2013-06-01

    We have developed an ultra-high-resolution optical coherence tomography (OCT) equipment, using a 200 nm bandwidth spectrometer and a mode-locked femtosecond laser. We have characterized this OCT, obtaining high spatial resolution in the axial direction of less than 2 μm in air via single scanning, within only 20 ms. This corresponds to an ultra-high resolution of less than 1.3 μm for measurements at the fundus retina. High resolution and high speed imaging enables us to selectively obtain a clear three dimensional (3D) lamina cribrosa itself from a 3D optic disc (OD) image in vivo.

  19. Lasers in otorhinolaryngology

    NASA Astrophysics Data System (ADS)

    Pais Clemente, Manuel P.

    1992-03-01

    Lasers are now commonly accepted and widely used surgical instruments in otorhinolaryngology. There have been a great number of technological advances with lasers that have contributed to the expansion of this new surgical modality with an increased number of medical applications. Surgical strategies have also changed and are more favorable toward conservative surgery in which less tissues is removed than with more radical resections. This combination of improving technology and medical attitudes has changed the field of otorhinolaryngology, and resulted in an expanding use of laser surgery. Since 1973 we have been using the carbon dioxide laser in the treatment of diseases of the upper aero digestive systems, learning this new surgical technique from the pioneer work of Strong, Jako, and Vaughan. It is our conviction that a laser surgeon must have a thorough knowledge of laser biophysics, instrumentation, safety protocols, and surgical indications, and have the technical skills to perform laser surgery. Laser technology continues to improve at an increased speed, and it is imperative to update knowledge of current and potential applications of lasers in our specialty. It is the purpose of this article to present our clinical experience of 18 years with the use of lasers in surgery of ORL, emphasizing the carbon dioxide laser.

  20. Laser Measurements of the H Atom + Ozone Rate Constant at Atmospheric Temperatures

    NASA Astrophysics Data System (ADS)

    Liu, Y.; Smith, G. P.; Peng, J.; Reppert, K. J.; Callahan, S. L.

    2015-12-01

    The exothermic H + O3 reaction produces OH(v) Meinel band emissions, used to derive mesospheric H concentrations and chemical heating rates. We have remeasured its rate constant to reduce resulting uncertainties and the measurement extend to lower mesospheric temperatures using modern laser techniques. H atoms are produced by pulsed ultraviolet laser trace photolysis of O3, followed by reaction of O(D) with added H2. A second, delayed, frequency-mixed dye laser measures the reaction decay rate with the remaining ozone by laser induced fluorescence. We monitor either the H atom decay by 2 photon excitation at 205 nm and detection of red fluorescence, or the OH(v=9) product time evolution with excitation of the B-X (0,9) band at 237 nm and emission in blue B-A bands. By cooling the enclosed low pressure flow cell we obtained measurements from 146-305 K. Small kinetic modeling corrections are made for secondary regeneration of H atoms. The results fully confirm the current NASA JPL recommendation for this rate constant, and establish its extrapolation down to the lower temperatures of the mesosphere. This work was supported by the NSF Aeronomy Program and an NSF Physics summer REU student grant.

  1. Laser surgery: using the carbon dioxide laser.

    PubMed Central

    Wright, V. C.

    1982-01-01

    In 1917 Einstein theorized tha through an atomic process a unique kind of electromagnetic radiation could be produced by stimulated emission. When such radiation is in the optical or infrared spectrum it is termed laser (light amplification by stimulated emission of radiation) light. A laser, a high-intensity light source, emits a nearly parallel electromagnetic beam of energy at a given wavelength that can be captured by a lens and concentrated in the focal spot. The wavelength determines how the laser will be used. The carbon dioxide laser is now successfully employed for some surgical procedures in gynecology, otorhinolaryngology, neurosurgery, and plastic and general surgery. The CO2 laser beam is directed through the viewing system of an operating microscope or through a hand-held laser component. Its basic action in tissue is thermal vaporization; it causes minimal damage to adjacent tissues. Surgeons require special training in the basic methods and techniques of laser surgery, as well as in the safety standards that must be observed. Images FIG. 5 PMID:7074503

  2. Laser Synchrotron Source (LSS)

    NASA Astrophysics Data System (ADS)

    Sprangle, Philip; Ting, Antonio; Esarey, Eric; Fisher, Amon; Mourou, Gerald

    1993-02-01

    The Laser Synchrotron Source (LSS) utilizes a high peak power or high average power laser to generate within a vacuum chamber a laser beam travelling in one direction to interact with an electron beam traveling in an opposite direction in order to generate high-power x-rays. A ring resonator formed by a plurality of mirrors directs the laser beam in a closed loop to impact with the electron beam to produce x-rays. Concave mirrors in the ring resonator focus the laser beam upon the point where the laser beam interacts with the electron beam to intensify the laser energy at that point. When a Radio Frequency Linear Accelerator (RF linac) is used to produce the electron beam, x-rays having a short pulse length are generated. When a betatron is used as an electron source, x-rays having a long pulse length are generated.

  3. Laser safety in dentistry

    NASA Astrophysics Data System (ADS)

    Wigdor, Harvey A.

    1997-05-01

    One of the major causes of anxiety in the dental clinic is the dental handpiece. Because dentists wish to provide a method which can replace the drill there has often been a premature use of the laser in dentistry. Various lasers have been introduced into the clinic before research has shown the laser used is of clinical benefit. Any new treatment method must not compromise the health of the patient being treated. Thus a method of evaluating the clinical abilities of dentists and their understanding the limitations of the laser used must be developed. Dentist must be trained in the basic interaction of the laser on oral tissues. The training has to concentrate on the variation of the laser wavelength absorption in the different tissues of the oral cavity. Because of the differences in the optical properties of these tissues great care must be exercised by practitioners using lasers on patients.

  4. Laser Applications in Orthodontics

    PubMed Central

    Heidari, Somayeh; Torkan, Sepideh

    2013-01-01

    A laser is a collimated single wavelength of light which delivers a concentrated source of energy. Soon after different types of lasers were invented, investigators began to examine the effects of different wavelengths of laser energy on oral tissues, routine dental procedures and experimental applications. Orthodontists, along with other specialist in different fields of dentistry, can now benefit from several different advantages that lasers provide during the treatment process, from the beginning of the treatment, when separators are placed, to the time of resin residues removal from the tooth surface at the end of orthodontic treatment. This article outlines some of the most common usages of laser beam in orthodontics and also provides a comparison between laser and other conventional method that were the standard of care prior to the advent of laser in this field. PMID:25606324

  5. Lasers in orthodontics

    PubMed Central

    Nalcaci, Ruhi; Cokakoglu, Serpil

    2013-01-01

    Many types of dental lasers are currently available that can be efficiently used for soft and hard tissue applications in the field of orthodontics. For achieving the desired effects in the target tissue, knowledge of laser characteristics such as power, wavelength and timing, is necessary. Laser therapy is advantageous because it often avoids bleeding, can be pain free, is non-invasive and is relatively quick. The high cost is its primary disadvantage. It is very important to take the necessary precautions to prevent possible tissue damage when using laser dental systems. Here, we reviewed the main types and characteristics of laser systems used in dental practice and discuss the applications of lasers in orthodontics, harmful effects and laser system safety. PMID:24966719

  6. Raman fiber lasers

    NASA Astrophysics Data System (ADS)

    Supradeepa, V. R.; Feng, Yan; Nicholson, Jeffrey W.

    2017-02-01

    High-power fiber lasers have seen tremendous development in the last decade, with output powers exceeding multiple kilowatts from a single fiber. Ytterbium has been at the forefront as the primary rare-earth-doped gain medium owing to its inherent material advantages. However, for this reason, the lasers are largely confined to the narrow emission wavelength region of ytterbium. Power scaling at other wavelength regions has lagged significantly, and a large number of applications rely upon the diversity of emission wavelengths. Currently, Raman fiber lasers are the only known wavelength agile, scalable, high-power fiber laser technology that can span the wavelength spectrum. In this review, we address the technology of Raman fiber lasers, specifically focused on the most recent developments. We will also discuss several applications of Raman fiber lasers in laser pumping, frequency conversion, optical communications and biology.

  7. Lasers in periodontology.

    PubMed

    Mavrogiannis, M; Thomason, J M; Seymour, R A

    2004-11-01

    Since the development of the ruby laser by Maiman in 1960, lasers have been widely employed in medicine for a number of years. The purpose of this paper is to summarize potential applications for lasers in dentistry, with special regard to periodontology. This article briefly describes clinical applications of lasers and laser safety. Particularly, the use of a diode laser seems to be promising, especially in already compromised transplant patients, who need to be treated with a technique where the operative and post-operative blood loss, post-operative discomfort and the recurrence of drug-induced gingival overgrowth need to be kept to a minimum or eliminated. Therefore, the use of lasers in periodontology may lead to an alteration in present clinical practice and help to establish the best management strategy because, by maintaining periodontal health, the life quality of patients can be improved.

  8. Lasers in dentistry

    NASA Astrophysics Data System (ADS)

    Keller, Ulrich

    1991-11-01

    The infrared-laser systems like the Er:YAG, the cw CO2, the Nd:YAG, and the UV- excimer lasers are being investigated for preparing tooth-hard substances. The infrared lasers cause thermal damage to the enamel, the dentin, and the pulp with the exception of the Er:YAG laser. No thermal damage occurs using the Er:YAG laser under practical conditions because of the special thermomechanical ablation process. The ablation rates of the UV- excimer lasers are to low for practical use. Enhancing the ablation efficiency by high- repetition rates causes thermal side effects to occur. Therefore, only the Er:YAG laser has the potential to partially replace the mechanical drill.

  9. Semiconductor nanowire lasers

    NASA Astrophysics Data System (ADS)

    Eaton, Samuel W.; Fu, Anthony; Wong, Andrew B.; Ning, Cun-Zheng; Yang, Peidong

    2016-06-01

    The discovery and continued development of the laser has revolutionized both science and industry. The advent of miniaturized, semiconductor lasers has made this technology an integral part of everyday life. Exciting research continues with a new focus on nanowire lasers because of their great potential in the field of optoelectronics. In this Review, we explore the latest advancements in the development of nanowire lasers and offer our perspective on future improvements and trends. We discuss fundamental material considerations and the latest, most effective materials for nanowire lasers. A discussion of novel cavity designs and amplification methods is followed by some of the latest work on surface plasmon polariton nanowire lasers. Finally, exciting new reports of electrically pumped nanowire lasers with the potential for integrated optoelectronic applications are described.

  10. Nanofabrication with pulsed lasers.

    PubMed

    Kabashin, Av; Delaporte, Ph; Pereira, A; Grojo, D; Torres, R; Sarnet, Th; Sentis, M

    2010-02-24

    An overview of pulsed laser-assisted methods for nanofabrication, which are currently developed in our Institute (LP3), is presented. The methods compass a variety of possibilities for material nanostructuring offered by laser-matter interactions and imply either the nanostructuring of the laser-illuminated surface itself, as in cases of direct laser ablation or laser plasma-assisted treatment of semiconductors to form light-absorbing and light-emitting nano-architectures, as well as periodic nanoarrays, or laser-assisted production of nanoclusters and their controlled growth in gaseous or liquid medium to form nanostructured films or colloidal nanoparticles. Nanomaterials synthesized by laser-assisted methods have a variety of unique properties, not reproducible by any other route, and are of importance for photovoltaics, optoelectronics, biological sensing, imaging and therapeutics.

  11. Space qualified laser sources

    NASA Astrophysics Data System (ADS)

    Heine, Frank; Schwander, Thomas; Lange, Robert; Smutny, Berry

    2006-04-01

    Tesat-Spacecom has developed a series of fiber coupled single frequency lasers for space applications ranging from onboard metrology for space borne FTIR spectrometers to step tunable seed lasers for LIDAR applications. The cw-seed laser developed for the ESA AEOLUS Mission shows a 3* 10 -11 Allen variance from 1 sec time intervals up to 1000 sec. Q-switched lasers with stable beam pointing under space environments are another field of development. One important aspect of a space borne laser system is a reliable fiber coupled laser diode pump source around 808nm. A dedicated development concerning chip design and packaging yielded in a 5*10 6h MTTF (mean time to failure) for the broad area emitters. Qualification and performance test results for the different laser assemblies will be presented and their application in the different space programs.

  12. Lasers in oral surgery

    NASA Astrophysics Data System (ADS)

    Keller, Ulrich; Hibst, Raimund

    1994-12-01

    The indications of lasers in oral surgery are defined by the laser-tissue interaction types. These are mainly thermal effects depending especially on the absorption of laser light in varying biological tissues. In histological sections different laser effects are demonstrated on oral mucosa, bone and cartilage, which have a great influence on wound healing and subsequently on clinical indications of the different wavelengths. On the one hand the good coagulation effect of the Nd:YAG laser is wanted for hemostasis in soft tissue surgery. On the other hand, for the treatment of precancerous dysplasias or neoplasias an effective cutting with a coagulation effect like using the CO2 laser is necessary. However, the excision of benign mucosal lesions as well as performing osteotomies or shaping of cartilage should be undertaken with the Er:YAG laser without greater coagulation and consequently without any delay of wound healing.

  13. Micromachining with copper lasers

    NASA Astrophysics Data System (ADS)

    Knowles, Martyn R. H.; Bell, Andy; Foster-Turner, Gideon; Rutterford, Graham; Chudzicki, J.; Kearsley, Andrew J.

    1997-04-01

    In recent years the copper laser has undergone extensive development and has emerged as a leading and unique laser for micromachining. The copper laser is a high average power (10 - 250 W), high pulse repetition rate (2 - 32 kHz), visible laser (511 nm and 578 nm) that produces high peak power (typically 200 kW), short pulses (30 ns) and very good beam quality (diffraction limited). This unique set of laser parameters results in exceptional micro-machining in a wide variety of materials. Typical examples of the capabilities of the copper laser include the drilling of small holes (10 - 200 micrometer diameter) in materials as diverse as steel, ceramic, diamond and polyimide with micron precision and low taper (less than 1 degree) cutting and profiling of diamond. Application of the copper laser covers the electronic, aerospace, automotive, nuclear, medical and precision engineering industries.

  14. ORION laser target diagnostics.

    PubMed

    Bentley, C D; Edwards, R D; Andrew, J E; James, S F; Gardner, M D; Comley, A J; Vaughan, K; Horsfield, C J; Rubery, M S; Rothman, S D; Daykin, S; Masoero, S J; Palmer, J B; Meadowcroft, A L; Williams, B M; Gumbrell, E T; Fyrth, J D; Brown, C R D; Hill, M P; Oades, K; Wright, M J; Hood, B A; Kemshall, P

    2012-10-01

    The ORION laser facility is one of the UK's premier laser facilities which became operational at AWE in 2010. Its primary mission is one of stockpile stewardship, ORION will extend the UK's experimental plasma physics capability to the high temperature, high density regime relevant to Atomic Weapons Establishment's (AWE) program. The ORION laser combines ten laser beams operating in the ns regime with two sub ps short pulse chirped pulse amplification beams. This gives the UK a unique combined long pulse/short pulse laser capability which is not only available to AWE personnel but also gives access to our international partners and visiting UK academia. The ORION laser facility is equipped with a comprehensive suite of some 45 diagnostics covering optical, particle, and x-ray diagnostics all able to image the laser target interaction point. This paper focuses on a small selection of these diagnostics.

  15. Lasers in space

    NASA Astrophysics Data System (ADS)

    Michaelis, M. M.; Forbes, A.; Bingham, R.; Kellett, B. J.; Mathye, A.

    2008-05-01

    A variety of laser applications in space, past, present, future and far future are reviewed together with the contributions of some of the scientists and engineers involved, especially those that happen to have South African connections. Historically, two of the earliest laser applications in space, were atmospheric LIDAR and lunar ranging. These applications involved atmospheric physicists, several astronauts and many of the staff recruited into the Soviet and North American lunar exploration programmes. There is a strong interest in South Africa in both LIDAR and lunar ranging. Shortly after the birth of the laser (and even just prior) theoretical work on photonic propulsion and space propulsion by laser ablation was initiated by Georgii Marx, Arthur Kantrowitz and Eugen Saenger. Present or near future experimental programs are developing in the following fields: laser ablation propulsion, possibly coupled with rail gun or gas gun propulsion; interplanetary laser transmission; laser altimetry; gravity wave detection by space based Michelson interferometry; the de-orbiting of space debris by high power lasers; atom laser interferometry in space. Far future applications of laser-photonic space-propulsion were also pioneered by Carl Sagan and Robert Forward. They envisaged means of putting Saenger's ideas into practice. Forward also invented a laser based method for manufacturing solid antimatter or SANTIM, well before the ongoing experiments at CERN with anti-hydrogen production and laser-trapping. SANTIM would be an ideal propellant for interstellar missions if it could be manufactured in sufficient quantities. It would be equally useful as a power source for the transmission of information over light year distances. We briefly mention military lasers. Last but not least, we address naturally occurring lasers in space and pose the question: "did the Big Bang lase?"

  16. Laser system using ultra-short laser pulses

    DOEpatents

    Dantus, Marcos; Lozovoy, Vadim V.; Comstock, Matthew

    2009-10-27

    A laser system using ultrashort laser pulses is provided. In another aspect of the present invention, the system includes a laser, pulse shaper and detection device. A further aspect of the present invention employs a femtosecond laser and binary pulse shaping (BPS). Still another aspect of the present invention uses a laser beam pulse, a pulse shaper and a SHG crystal.

  17. Frequency comb swept lasers

    PubMed Central

    Tsai, Tsung-Han; Zhou, Chao; Adler, Desmond C.; Fujimoto, James G.

    2010-01-01

    We demonstrate a frequency comb (FC) swept laser and a frequency comb Fourier domain mode locked (FC-FDML) laser for applications in optical coherence tomography (OCT). The fiber-based FC swept lasers operate at a sweep rate of 1kHz and 120kHz, respectively over a 135nm tuning range centered at 1310nm with average output powers of 50mW. A 25GHz free spectral range frequency comb filter in the swept lasers causes the lasers to generate a series of well defined frequency steps. The narrow bandwidth (0.015nm) of the frequency comb filter enables a ~−1.2dB sensitivity roll off over ~3mm range, compared to conventional swept source and FDML lasers which have −10dB and −5dB roll offs, respectively. Measurements at very long ranges are possible with minimal sensitivity loss, however reflections from outside the principal measurement range of 0–3mm appear aliased back into the principal range. In addition, the frequency comb output from the lasers are equally spaced in frequency (linear in k-space). The filtered laser output can be used to self-clock the OCT interference signal sampling, enabling direct fast Fourier transformation of the fringe signals, without the need for fringe recalibration procedures. The design and operation principles of FC swept lasers are discussed and designs for short cavity lasers for OCT and interferometric measurement applications are proposed. PMID:19997365

  18. Laser treatment in gynecology

    NASA Astrophysics Data System (ADS)

    de Riese, Cornelia

    2004-07-01

    This presentation is designed as a brief overview of laser use in gynecology, for non-medical researchers involved in development of new laser techniques. The literature of the past decade is reviewed. Differences in penetration, absorption, and suitable delivery media for the beams dictate clinical application. The use of CO2 laser in the treatment of uterine cervical intraepithelial lesions is well established and indications as well as techniques have not changed over 30 years. The Cochrane Systematic Review from 2000 suggests no obviously superior technique. CO2 laser ablation of the vagina is also established as a safe treatment modality for VAIN. CO2 laser permits treatment of lesions with excellent cosmetic and functional results. The treatment of heavy menstrual bleeding by destruction of the endometrial lining using various techniques has been the subject of a 2002 Cochran Database Review. Among the compared treatment modalities are newer and modified laser techniques. Conclusion by reviewers is that outcomes and complication profiles of newer techniques compare favorably with the gold standard of endometrial resection. The ELITT diode laser system is one of the new successful additions. CO2 laser is also the dominant laser type used with laparoscopy for ablation of endometriotic implants. Myoma coagulation or myolysis with Nd:Yag laser through the laparoscope or hysteroscope is a conservative treatment option. Even MRI guided percutaneous approaches have been described. No long-term data are available.

  19. Photobiomodulation in laser surgery

    NASA Astrophysics Data System (ADS)

    Liu, Timon Cheng-Yi; Rong, Dong-Liang; Huang, Jin; Deng, Xiao-Yuan; Liu, Song-Hao

    2006-01-01

    Laser surgery provides good exposure with clear operating fields and satisfactory preliminary functional results. In contrast to conventional excision, it was found that matrix metalloproteinases and the tissue inhibitors of metalloproteinases -1 mRNA expression is higher, myofibroblasts appeared and disappeared slower in laser excision wounds. It has been suggested that the better anatomical and functional results achieved following laser cordectomy may be explained by the fact that such procedures result in better, more rapid healing processes to recover vocal cord for early glottic tumors and better. In this paper, the role of photobiomodulation in laser surgery will be discussed by the cultured monolayer normal human skin fibroblast model of the photobiomodulation of marginal irradiation of high intensity laser beam, the photobiomodulation related to the irradiated tissue, the biological information model of photobiomodulation and the animal models of laser surgery. Although high intensity laser beam is so intense that it destroys the irradiated cells or tissue, its marginal irradiation intensity is so low that there is photobiomodulation on non-damage cells to modulate the regeneration of partly damaged tissue so that the surgery of laser of different parameters results in different post-surgical recovery. It was concluded that photobiomodulation might play an important role in the long-term effects of laser surgery, which might be used to design laser surgery.

  20. Frequency comb swept lasers.

    PubMed

    Tsai, Tsung-Han; Zhou, Chao; Adler, Desmond C; Fujimoto, James G

    2009-11-09

    We demonstrate a frequency comb (FC) swept laser and a frequency comb Fourier domain mode locked (FC-FDML) laser for applications in optical coherence tomography (OCT). The fiber-based FC swept lasers operate at a sweep rate of 1kHz and 120kHz, respectively over a 135nm tuning range centered at 1310nm with average output powers of 50mW. A 25GHz free spectral range frequency comb filter in the swept lasers causes the lasers to generate a series of well defined frequency steps. The narrow bandwidth (0.015nm) of the frequency comb filter enables a approximately -1.2dB sensitivity roll off over approximately 3mm range, compared to conventional swept source and FDML lasers which have -10dB and -5dB roll offs, respectively. Measurements at very long ranges are possible with minimal sensitivity loss, however reflections from outside the principal measurement range of 0-3mm appear aliased back into the principal range. In addition, the frequency comb output from the lasers are equally spaced in frequency (linear in k-space). The filtered laser output can be used to self-clock the OCT interference signal sampling, enabling direct fast Fourier transformation of the fringe signals, without the need for fringe recalibration procedures. The design and operation principles of FC swept lasers are discussed and designs for short cavity lasers for OCT and interferometric measurement applications are proposed.

  1. Lasers in medicine

    NASA Astrophysics Data System (ADS)

    Peng, Qian; Juzeniene, Asta; Chen, Jiyao; Svaasand, Lars O.; Warloe, Trond; Giercksky, Karl-Erik; Moan, Johan

    2008-05-01

    It is hard to imagine that a narrow, one-way, coherent, moving, amplified beam of light fired by excited atoms is powerful enough to slice through steel. In 1917, Albert Einstein speculated that under certain conditions atoms could absorb light and be stimulated to shed their borrowed energy. Charles Townes coined the term laser (light amplification by stimulated emission of radiation) in 1951. Theodore Maiman investigated the glare of a flash lamp in a rod of synthetic ruby, creating the first human-made laser in 1960. The laser involves exciting atoms and passing them through a medium such as crystal, gas or liquid. As the cascade of photon energy sweeps through the medium, bouncing off mirrors, it is reflected back and forth, and gains energy to produce a high wattage beam of light. Although lasers are today used by a large variety of professions, one of the most meaningful applications of laser technology has been through its use in medicine. Being faster and less invasive with a high precision, lasers have penetrated into most medical disciplines during the last half century including dermatology, ophthalmology, dentistry, otolaryngology, gastroenterology, urology, gynaecology, cardiology, neurosurgery and orthopaedics. In many ways the laser has revolutionized the diagnosis and treatment of a disease. As a surgical tool the laser is capable of three basic functions. When focused on a point it can cauterize deeply as it cuts, reducing the surgical trauma caused by a knife. It can vaporize the surface of a tissue. Or, through optical fibres, it can permit a doctor to see inside the body. Lasers have also become an indispensable tool in biological applications from high-resolution microscopy to subcellular nanosurgery. Indeed, medical lasers are a prime example of how the movement of an idea can truly change the medical world. This review will survey various applications of lasers in medicine including four major categories: types of lasers, laser

  2. Laser Safety Inspection Criteria

    SciTech Connect

    Barat, K

    2005-02-11

    A responsibility of the Laser Safety Officer (LSO) is to perform laser safety audits. The American National Standard Z136.1 Safe use of Lasers references this requirement in several sections: (1) Section 1.3.2 LSO Specific Responsibilities states under Hazard Evaluation, ''The LSO shall be responsible for hazards evaluation of laser work areas''; (2) Section 1.3.2.8, Safety Features Audits, ''The LSO shall ensure that the safety features of the laser installation facilities and laser equipment are audited periodically to assure proper operation''; and (3) Appendix D, under Survey and Inspections, it states, ''the LSO will survey by inspection, as considered necessary, all areas where laser equipment is used''. Therefore, for facilities using Class 3B and or Class 4 lasers, audits for laser safety compliance are expected to be conducted. The composition, frequency and rigueur of that inspection/audit rests in the hands of the LSO. A common practice for institutions is to develop laser audit checklists or survey forms. In many institutions, a sole Laser Safety Officer (LSO) or a number of Deputy LSO's perform these audits. For that matter, there are institutions that request users to perform a self-assessment audit. Many items on the common audit list and the associated findings are subjective because they are based on the experience and interest of the LSO or auditor in particular items on the checklist. Beam block usage is an example; to one set of eyes a particular arrangement might be completely adequate, while to another the installation may be inadequate. In order to provide more consistency, the National Ignition Facility Directorate at Lawrence Livermore National Laboratory (NIF-LLNL) has established criteria for a number of items found on the typical laser safety audit form. These criteria are distributed to laser users, and they serve two broad purposes: first, it gives the user an expectation of what will be reviewed by an auditor, and second, it is an

  3. Laser materials production

    NASA Astrophysics Data System (ADS)

    Gianinoni, I.; Musci, M.

    1985-09-01

    The characteristics and the perspectives of the new photochemical laser techniques for materials production will be briefly analysed and some recent experimental results both on large area deposition of thin films and on synthesis of powders will be reported. As an example of an IR laser process, the cw CO 2 laser-induced deposition of hydrogenated amorphous silicon will be described in some detail. The results of some UV experiments for semiconductor, metal and insulating film depositions will also be discussed. The features of the process for laser-driven synthesis of powders and the characteristics of the produced particles will be evidenced, and some of their technological applications will be outlined. The requirements of the laser sources suitable for this kind of applications are in general the same as in gas-phase laser chemistry, however it will be pointed out how some parameters are more significant for this specific use.

  4. Pulsed excimer laser processing

    NASA Technical Reports Server (NTRS)

    Wong, D.

    1985-01-01

    The status of pulsed excimer laser processing of PV cells is presented. The cost effective feasibility of fabricating high efficiency solar cells on Czochralski wafers using a pulsed excimer laser for junction formation, surface passivation, and front metallization. Laser annealing results were promising with the best AR coated cell having an efficiency of 16.1%. Better results would be expected with larger laser spot size because there was some degradation in open circuit voltage caused by laser spot overlap and edge effects. Surface heating and photolytic decomposition by the laser was used to deposit tungsten from the reaction of tungsten hexafluoride and hydrogen. The line widths were 5 to 10 mils, and the depositions passed the tape adhesion test. Thinner lines are practical using an optimized optical system.

  5. Pulsed excimer laser processing

    NASA Astrophysics Data System (ADS)

    Wong, D.

    1985-06-01

    The status of pulsed excimer laser processing of PV cells is presented. The cost effective feasibility of fabricating high efficiency solar cells on Czochralski wafers using a pulsed excimer laser for junction formation, surface passivation, and front metallization. Laser annealing results were promising with the best AR coated cell having an efficiency of 16.1%. Better results would be expected with larger laser spot size because there was some degradation in open circuit voltage caused by laser spot overlap and edge effects. Surface heating and photolytic decomposition by the laser was used to deposit tungsten from the reaction of tungsten hexafluoride and hydrogen. The line widths were 5 to 10 mils, and the depositions passed the tape adhesion test. Thinner lines are practical using an optimized optical system.

  6. Laser/tissue interaction.

    PubMed

    Dederich, D N

    1991-01-01

    When laser light impinges on tissue, it can reflect, scatter, be absorbed, or transmit to the surrounding tissue. Absorption controls to a great degree the extent to which reflection, scattering and transmission occur, and wavelength is the primary determinant of absorption. The CO2 laser is consistently absorbed by most materials and tissues and the Nd-YAG laser wavelength is preferentially absorbed in pigmented tissues. The factors which determine the initial tissue effect include the laser wavelength, laser power, laser waveform, tissue optical properties, and tissue thermal properties. There are almost an infinite number of combinations of these factors possible, many of which would result in unacceptable damage to the tissues. This underscores the need to thoroughly test any particular combination of these factors on the conceptual, in-vitro, and in-vivo level before a treatment is offered.

  7. Photonic Crystal Microchip Laser.

    PubMed

    Gailevicius, Darius; Koliadenko, Volodymyr; Purlys, Vytautas; Peckus, Martynas; Taranenko, Victor; Staliunas, Kestutis

    2016-09-29

    The microchip lasers, being very compact and efficient sources of coherent light, suffer from one serious drawback: low spatial quality of the beam strongly reducing the brightness of emitted radiation. Attempts to improve the beam quality, such as pump-beam guiding, external feedback, either strongly reduce the emission power, or drastically increase the size and complexity of the lasers. Here it is proposed that specially designed photonic crystal in the cavity of a microchip laser, can significantly improve the beam quality. Experiments show that a microchip laser, due to spatial filtering functionality of intracavity photonic crystal, improves the beam quality factor M(2) reducing it by a factor of 2, and increase the brightness of radiation by a factor of 3. This comprises a new kind of laser, the "photonic crystal microchip laser", a very compact and efficient light source emitting high spatial quality high brightness radiation.

  8. Synthetic laser medium

    DOEpatents

    Stokowski, S.E.

    1987-10-20

    A laser medium is particularly useful in high average power solid state lasers. The laser medium includes a chromium dopant and preferably neodymium ions as codopant, and is primarily a gadolinium scandium gallium garnet, or an analog thereof. Divalent cations inhibit spiral morphology as large boules from which the laser medium is derived are grown, and a source of ions convertible between a trivalent state and a tetravalent state at a low ionization energy are in the laser medium to reduce an absorption coefficient at about one micron wavelength otherwise caused by the divalent cations. These divalent cations and convertible ions are dispersed in the laser medium. Preferred convertible ions are provided from titanium or cerium sources.

  9. Synthetic laser medium

    DOEpatents

    Stokowski, Stanley E.

    1989-01-01

    A laser medium is particularly useful in high average power solid state lasers. The laser medium includes a chormium dopant and preferably neodymium ions as codopant, and is primarily a gadolinium scandium gallium garnet, or an analog thereof. Divalent cations inhibit spiral morphology as large boules from which the laser medium is derived are grown, and a source of ions convertible between a trivalent state and a tetravalent state at a low ionization energy are in the laser medium to reduce an absorption coefficient at about one micron wavelength otherwise caused by the divalent cations. These divalent cations and convertible ions are dispersed in the laser medium. Preferred convertible ions are provided from titanium or cerium sources.

  10. Nanofabrication with Pulsed Lasers

    PubMed Central

    2010-01-01

    An overview of pulsed laser-assisted methods for nanofabrication, which are currently developed in our Institute (LP3), is presented. The methods compass a variety of possibilities for material nanostructuring offered by laser–matter interactions and imply either the nanostructuring of the laser-illuminated surface itself, as in cases of direct laser ablation or laser plasma-assisted treatment of semiconductors to form light-absorbing and light-emitting nano-architectures, as well as periodic nanoarrays, or laser-assisted production of nanoclusters and their controlled growth in gaseous or liquid medium to form nanostructured films or colloidal nanoparticles. Nanomaterials synthesized by laser-assisted methods have a variety of unique properties, not reproducible by any other route, and are of importance for photovoltaics, optoelectronics, biological sensing, imaging and therapeutics. PMID:20672069

  11. Laser rocket system analysis

    NASA Technical Reports Server (NTRS)

    Jones, W. S.; Forsyth, J. B.; Skratt, J. P.

    1979-01-01

    The laser rocket systems investigated in this study were for orbital transportation using space-based, ground-based and airborne laser transmitters. The propulsion unit of these systems utilizes a continuous wave (CW) laser beam focused into a thrust chamber which initiates a plasma in the hydrogen propellant, thus heating the propellant and providing thrust through a suitably designed nozzle and expansion skirt. The specific impulse is limited only by the ability to adequately cool the thruster and the amount of laser energy entering the engine. The results of the study showed that, with advanced technology, laser rocket systems with either a space- or ground-based laser transmitter could reduce the national budget allocated to space transportation by 10 to 345 billion dollars over a 10-year life cycle when compared to advanced chemical propulsion systems (LO2-LH2) of equal capability. The variation in savings depends upon the projected mission model.

  12. Micro-laser

    DOEpatents

    Hutchinson, Donald P.; Richards, Roger K.

    2003-07-22

    A micro-laser is disclosed which includes a waveguide, a first and a second subwavelength resonant grating in the waveguide, and at least one photonic band gap resonant structure (PBG) in the waveguide and at least one amplifying medium in the waveguide. PBG features are positioned between the first and second subwavelength resonant gratings and allow introduction of amplifying mediums into the highly resonant guided micro-laser microcavity. The micro-laser may be positioned on a die of a bulk substrate material with one or more electronic and optical devices and may be communicably connected to the same. A method for fabricating a micro-laser is disclosed. A method for tuning the micro-laser is also disclosed. The micro-laser may be used as an optical regenerator, or a light source for data transfer or for optical computing.

  13. Lasers in periodontics

    PubMed Central

    Elavarasu, Sugumari; Naveen, Devisree; Thangavelu, Arthiie

    2012-01-01

    Laser is one of the most captivating technologies in dental practice since Theodore Maiman in 1960 invented the ruby laser. Lasers in dentistry have revolutionized several areas of treatment in the last three and a half decades of the 20th century. Introduced as an alternative to mechanical cutting device, laser has now become an instrument of choice in many dental applications. Evidence suggests its use in initial periodontal therapy, surgery, and more recently, its utility in salvaging implant opens up a wide range of applications. More research with better designs are a necessity before lasers can become a part of dental armamentarium. This paper gives an insight to laser in periodontics. PMID:23066266

  14. Portable laser laboratory

    NASA Astrophysics Data System (ADS)

    Weir, J. T.

    1994-07-01

    A Portable Laser Laboratory (PLL) is being designed and built for the CALIOPE Program tests which will begin in October of 1994. The PLL is designed to give maximum flexibility for evolving laser experiments and can be readily moved by loading it onto a standard truck trailer. The internal configuration for the October experiments will support a two line DIAL system running in the mid-IR. Brief descriptions of the laser and detection systems are included.

  15. Thallium Mercury Laser Development

    DTIC Science & Technology

    1981-01-01

    THALLIUM MERCURY LASER DEVELOPMENT C. S. Liu and D. W. Feldman FINAL REPORT (PHASE III) (Period between Feb. 1, 1980 and Jan. 31, 1981) 0 Contract No...Pittsburgh, Pennsylvania 15235 Approved for public release;IDistribution Unlimited 1/i;THALLIUM MERCURY LASER DEVELOPMENT * , , IS C. S./Liu tRD. W /eldman...9 ’ t4 THALLIUM MERCURY LASER DEVELOPMENT C. S. Liu and D. W. Feldman Westinghouse R&D Center Pittsburgh, Pennsylvania 15235 1

  16. Excimer laser chemical problems

    SciTech Connect

    Tennant, R.; Peterson, N.

    1982-01-01

    Techniques need to be developed to maintain XeF and XeCl laser performance over long periods of time without degradation resulting from chemical processes occurring within the laser. The dominant chemical issues include optical damage, corrosions of laser materials, gas contamination, and control of halogen concentration. Each of these issues are discussed and summarized. The methods of minimizing or controlling the chemical processes involved are presented.

  17. Diode Pumped Fiber Laser

    DTIC Science & Technology

    1983-07-01

    acousto - optic beam deflector for greater absolute accuracy. The detection system was also upgraded to a response time of • 1 usec. The... 2 C. SUMMARY OF RESULTS.., 3 D . GENERAL PLAN 5 II. Nd:YAG FIBER PREPARATION 7 A. FIBER GROWTH 7 B. PHYSICAL PROPERTIES OF Nd:YAG...A. INTRODUCTION 25 B. GENERAL FORMALISM 26 C. FREE-SPACE LASERS 35 D . FIBER LASERS 43 1. Fiber Laser Configuration 43 2 . F

  18. Laser In Veterinary Medicine

    NASA Astrophysics Data System (ADS)

    Newman, Carlton; Jaggar, David H.

    1982-12-01

    Lasers have been used for some time now on animals for experimental purposes prior to their use in human medical and surgical fields. However the use of lasers in veterinary medicine and surgery per se is a recent development. We describe the application of high and low intensity laser technology in a general overview of the current uses, some limitations to its use and future needs for future inquiry and development.

  19. Polarization feedback laser stabilization

    DOEpatents

    Esherick, P.; Owyoung, A.

    1987-09-28

    A system for locking two Nd:YAG laser oscillators includes an optical path for feeding the output of one laser into the other with different polarizations. Elliptical polarization is incorporated into the optical path so that the change in polarization that occurs when the frequencies coincide may be detected to provide a feedback signal to control one laser relative to the other. 4 figs.

  20. Precision laser aiming system

    DOEpatents

    Ahrens, Brandon R.; Todd, Steven N.

    2009-04-28

    A precision laser aiming system comprises a disrupter tool, a reflector, and a laser fixture. The disrupter tool, the reflector and the laser fixture are configurable for iterative alignment and aiming toward an explosive device threat. The invention enables a disrupter to be quickly and accurately set up, aligned, and aimed in order to render safe or to disrupt a target from a standoff position.

  1. Etalon laser diode

    SciTech Connect

    Allen, L.B.; Koenig, H.G.; Rice, R.R.

    1981-08-18

    A laser diode is disclosed that is suitable for integrated and fiber optic applications requiring single transverse and single longitudinal mode operation. The single transverse mode is provided by making a gallium arsenide double heterostructural laser diode with a narrow stripe width and a relatively long length. The single longitudinal mode operation is provided by cracking the diode transverse to the stripe at one or more locations to form internal etalons in the laser cavity.

  2. Laser cutting plastic materials

    SciTech Connect

    Van Cleave, R.A.

    1980-08-01

    A 1000-watt CO/sub 2/ laser has been demonstrated as a reliable production machine tool for cutting of plastics, high strength reinforced composites, and other nonmetals. More than 40 different plastics have been laser cut, and the results are tabulated. Applications for laser cutting described include fiberglass-reinforced laminates, Kevlar/epoxy composites, fiberglass-reinforced phenolics, nylon/epoxy laminates, ceramics, and disposable tooling made from acrylic.

  3. Gigashot Optical Laser Demonstrator

    SciTech Connect

    Deri, R. J.

    2015-10-13

    The Gigashot Optical Laser Demonstrator (GOLD) project has demonstrated a novel optical amplifier for high energy pulsed lasers operating at high repetition rates. The amplifier stores enough pump energy to support >10 J of laser output, and employs conduction cooling for thermal management to avoid the need for expensive and bulky high-pressure helium subsystems. A prototype amplifier was fabricated, pumped with diode light at 885 nm, and characterized. Experimental results show that the amplifier provides sufficient small-signal gain and sufficiently low wavefront and birefringence impairments to prove useful in laser systems, at repetition rates up to 60 Hz.

  4. Laser Gyro Theory Extension.

    DTIC Science & Technology

    1980-12-01

    7 AA096 14S ARI ZONA UNIV TUCSON OPTICA SCIENCES CENTER F/6 20/5 LASER GYRO THE.ORY ESTENS ION(U)7 C So M 0 SCULLY IF33615-79-C-17N4 UNCLASSIIED...GYRO We have been working with scientists at Litton Industries in the development of a Zeeman laser gyro (ZLAG). We have developed a vector laser...Hutchings and V. Sanders are with Litton Industries , Woodland rate measurements with laser gyros (Section II). The remain- Hills, CA 91364. ing

  5. Shuttle Laser Altimeter

    NASA Technical Reports Server (NTRS)

    Bufton, Jack L.; Harding, David J.; Garvin, James B.

    1999-01-01

    The Shuttle Laser Altimeter (SLA) is a Hitchhiker experiment that has flown twice; first on STS-72 in January 1996 and then on STS-85 in August 1997. Both missions produced successful laser altimetry and surface lidar data products from approximately 80 hours per mission of SLA data operations. A total of four Shuttle missions are planned for the SLA series. This paper documents SLA mission results and explains SLA pathfinder accomplishments at the mid-point in this series of Hitchhiker missions. The overall objective of the SLA mission series is the transition of the Goddard Space Flight Center airborne laser altimeter and lidar technology to low Earth orbit as a pathfinder for NASA operational space-based laser remote sensing devices. Future laser altimeter sensors will utilize systems and approaches being tested with SLA, including the Multi-Beam Laser Altimeter (MBLA) and the Geoscience Laser Altimeter System (GLAS). MBLA is the land and vegetation laser sensor for the NASA Earth System Sciences Pathfinder Vegetation Canopy Lidar (VCL) Mission, and GLAS is the Earth Observing System facility instrument on the Ice, Cloud, and Land Elevation Satellite (ICESat). The Mars Orbiting Laser Altimeter, now well into a multi-year mapping mission at the red planet, is also directly benefiting from SLA data analysis methods, just as SLA benefited from MOLA spare parts and instrument technology experience [5] during SLA construction in the early 1990s.

  6. SYMMETRICAL LASER CRYSTALS.

    DTIC Science & Technology

    CRYSTAL GROWTH , SYMMETRY(CRYSTALLOGRAPHY), LASERS, SYNTHESIS, FERROELECTRIC CRYSTALS , FLUORESCENCE, IMPURITIES, BARIUM COMPOUNDS, ZIRCONATES...STRONTIUM COMPOUNDS, TITANATES, STANNATES, SAMARIUM, MANGANESE, REFRACTORY MATERIALS, OXIDES, SINGLE CRYSTALS .

  7. A quantum laser pointer.

    PubMed

    Treps, Nicolas; Grosse, Nicolai; Bowen, Warwick P; Fabre, Claude; Bachor, Hans-A; Lam, Ping Koy

    2003-08-15

    The measurement sensitivity of the pointing direction of a laser beam is ultimately limited by the quantum nature of light. To reduce this limit, we have experimentally produced a quantum laser pointer, a beam of light whose direction is measured with a precision greater than that possible for a usual laser beam. The laser pointer is generated by combining three different beams in three orthogonal transverse modes, two of them in a squeezed-vacuum state and one in an intense coherent field. The result provides a demonstration of multichannel spatial squeezing, along with its application to the improvement of beam positioning sensitivity and, more generally, to imaging.

  8. Laser Surface Treatment

    NASA Astrophysics Data System (ADS)

    Gnanamuthu, D. S.

    1980-10-01

    Experimental procedures and current state-of-the-art are presented for laser surface treating methods such as alloying, cladding, grain refining, and transformation hardening using a cw CO2 laser. Microstructural and x-ray analyses of the treated surfaces indicate that a laser beam can locally enhance surface properties. Laser alloying offers the possibility to selectively modify a low cost workpiece surface so that it has the desired high quality surface properties characteristic of high performance alloys. Laser cladding offers feasibility to apply high melting cladding alloys on low melting workpieces, to reduce the amount of dilution of cladding alloy with the workpieces, and the potential to apply dense ceramic claddings to metallic workpieces. Laser grain refining offers potential to either minimize or eliminate surface defects such as inclusions, intermetallic compounds, and pores, and to provide a refined grain structure. Laser transformation hardening provides the treated workpieces with a hard martensitic surface that has compressive stresses for enhanced fatigue life; in addition, reduction in wear rate of treated surfaces is achieved. This experimental study indicates that the use of lasers for surface treatment has several limitations. Further studies will provide better understanding for maximum utilization of laser surface treating processes.

  9. Dental lasers and science.

    PubMed

    Zakariasen, K L; Dederich, D N

    1991-07-01

    We have attempted to accomplish two purposes in this article. First, we have presented the case that extensive scientific investigation must form the base of our profession, that it must be an ongoing, continuous process and that laser dentistry must be developed through extensive scientific inquiry--as all of our treatment modalities should be. Second, we have presented many examples of the science involved in the development of laser dentistry. Lasers do have far-reaching potential for application to dentistry. We, as a profession, must insist that such laser development is done properly, not foisted upon us based on anecdotal reports and incomplete research.

  10. Deep space laser communications

    NASA Astrophysics Data System (ADS)

    Biswas, Abhijit; Kovalik, Joseph M.; Srinivasan, Meera; Shaw, Matthew; Piazzolla, Sabino; Wright, Malcolm W.; Farr, William H.

    2016-03-01

    A number of laser communication link demonstrations from near Earth distances extending out to lunar ranges have been remarkably successful, demonstrating the augmented channel capacity that is accessible with the use of lasers for communications. The next hurdle on the path to extending laser communication and its benefits throughout the solar system and beyond is to demonstrate deep-space laser communication links. In this paper, concepts and technology development being advanced at the Jet Propulsion Laboratory (JPL) in order to enable deep-space link demonstrations to ranges of approximately 3 AU in the next decade, will be discussed.

  11. Optofluidic random laser

    NASA Astrophysics Data System (ADS)

    Shivakiran Bhaktha, B. N.; Bachelard, Nicolas; Noblin, Xavier; Sebbah, Patrick

    2012-10-01

    Random lasing is reported in a dye-circulated structured polymeric microfluidic channel. The role of disorder, which results from limited accuracy of photolithographic process, is demonstrated by the variation of the emission spectrum with local-pump position and by the extreme sensitivity to a local perturbation of the structure. Thresholds comparable to those of conventional microfluidic lasers are achieved, without the hurdle of state-of-the-art cavity fabrication. Potential applications of optofluidic random lasers for on-chip sensors are discussed. Introduction of random lasers in the field of optofluidics is a promising alternative to on-chip laser integration with light and fluidic functionalities.

  12. Spaceborne laser radar.

    NASA Technical Reports Server (NTRS)

    Flom, T.

    1972-01-01

    Development of laser systems to acquire and track targets in applications such as the rendezvous and docking of two spacecraft. A scan technique is described whereby a narrow laser beam is simultaneously scanned with an equally narrow receiver field-of-view without the aid of mechanical gimbals. Equations are developed in order to examine the maximum acquisition and tracking rates, and the maximum target range for a scanning laser radar system. A recently built prototype of a small, lightweight, low-power-consuming scanning laser radar is described.

  13. Laser eye protection

    NASA Astrophysics Data System (ADS)

    Allen, Ralph G.; Labo, Jack A.; Mayo, Michael W.

    1990-07-01

    Laser applications have proliferated in recent years and as to be expected their presence is no longer confined to the laboratory or places where access to their radiation can be easily controlled. One obvious application where this is so is in military operations where various devices such as laser range finders target designators and secure communications equipment elevate the risk of exposure specifically eye exposure to unacceptable levels. Although the need for eye protection in the laboratory and other controlled areas has been appreciated since the invention of the laser the use of lasers in circumstances where safety or the risk of temporary loss of vision which can not always be ensured by administrative procedures has made adequate eye protection essential. It is the critical nature of many military operations that has driven the search for eye protection against both nuclear and laser radiation. At the same time the requirement to maintain useful vision during irradiation as well as advances in laser technology have complicated the problem enormously. Pertinent aspects of the problem such as laser characteristics- -pulse width repetition rate laser wavelength tunability or agility as well as laser power or energy have been placed in perspective. In addition possible effects on vision for various exposures have been estimated as have the characteristics required of eye protective devices. Various classes of devices are discussed and advantages and disadvantages noted. 1.

  14. Trends in laser micromachining

    NASA Astrophysics Data System (ADS)

    Gaebler, Frank; van Nunen, Joris; Held, Andrew

    2016-03-01

    Laser Micromachining is well established in industry. Depending on the application lasers with pulse length from μseconds to femtoseconds and wavelengths from 1064nm and its harmonics up to 5μm or 10.6μm are used. Ultrafast laser machining using pulses with pico or femtosecond duration pulses is gaining traction, as it offers very precise processing of materials with low thermal impact. Large-scale industrial ultrafast laser applications show that the market can be divided into various sub segments. One set of applications demand low power around 10W, compact footprint and are extremely sensitive to the laser price whilst still demanding 10ps or shorter laser pulses. A second set of applications are very power hungry and only become economically feasible for large scale deployments at power levels in the 100+W class. There is also a growing demand for applications requiring fs-laser pulses. In our presentation we would like to describe these sub segments by using selected applications from the automotive and electronics industry e.g. drilling of gas/diesel injection nozzles, dicing of LED substrates. We close the presentation with an outlook to micromachining applications e.g. glass cutting and foil processing with unique new CO lasers emitting 5μm laser wavelength.

  15. Fusion reactor pumped laser

    DOEpatents

    Jassby, Daniel L.

    1988-01-01

    A nuclear pumped laser capable of producing long pulses of very high power laser radiation is provided. A toroidal fusion reactor provides energetic neutrons which are slowed down by a moderator. The moderated neutrons are converted to energetic particles capable of pumping a lasing medium. The lasing medium is housed in an annular cell surrounding the reactor. The cell includes an annular reflecting mirror at the bottom and an annular output window at the top. A neutron reflector is disposed around the cell to reflect escaping neutrons back into the cell. The laser radiation from the annular window is focused onto a beam compactor which generates a single coherent output laser beam.

  16. Lasers and avionic integration

    NASA Astrophysics Data System (ADS)

    Willams, J. S.

    1983-07-01

    Interrogative applications of laser technology are considered, taking into account the extent to which a centralized source of information can be used to service a number of functions which need to be performed in an airframe, and, in addition, also the potential of the laser as probing device. Aspects of laser technology and air vehicle communications are discussed along with laser based techniques for processing and storage of information. Attention is given to data transmission within the aircraft, communications external to the air vehicle, Fourier optics, holographic methods, real-time processing, Bragg cells and spectrum analysis, optical bistable devices, and optical data storage.

  17. Laser applications in phlebology

    NASA Astrophysics Data System (ADS)

    Longo, Leonardo; Mancini, S.; Postiglione, Marco; Postiglione, M. G.

    2001-06-01

    PURPOSE: review of laser used in phlebology METHOD: critical analysis of scientific data taken from the literature and based on 25 years personal experience. RESULTS: we have three groups of laser applications in phlebology: for the diagnosis, as physical therapy and as surgical therapy. DISCUSSION AND CONCLUSION: the laser-doppler studies the microcirculations, the no-surgical therapy shown positive results in the treatment of venous ulcers and for the wound healing. It could be indicate also as antiphlogistic and anti-edema therapy, in superficial thrombophlebitis. The surgical laser is useful for the surgical cleaning of ulcers, for haemorroids, angiomas and telangiectases.

  18. Laser adaptive holographic hydrophone

    SciTech Connect

    Romashko, R V; Kulchin, Yu N; Bezruk, M N; Ermolaev, S A

    2016-03-31

    A new type of a laser hydrophone based on dynamic holograms, formed in a photorefractive crystal, is proposed and studied. It is shown that the use of dynamic holograms makes it unnecessary to use complex optical schemes and systems for electronic stabilisation of the interferometer operating point. This essentially simplifies the scheme of the laser hydrophone preserving its high sensitivity, which offers the possibility to use it under a strong variation of the environment parameters. The laser adaptive holographic hydrophone implemented at present possesses the sensitivity at a level of 3.3 mV Pa{sup -1} in the frequency range from 1 to 30 kHz. (laser hydrophones)

  19. Lighting with laser diodes

    NASA Astrophysics Data System (ADS)

    Basu, Chandrajit; Meinhardt-Wollweber, Merve; Roth, Bernhard

    2013-08-01

    Contemporary white light-emitting diodes (LEDs) are much more efficient than compact fluorescent lamps and hence are rapidly capturing the market for general illumination. LEDs are also replacing halogen lamps or even newer xenon based lamps in automotive headlamps. Because laser diodes are inherently much brighter and often more efficient than corresponding LEDs, there is great research interest in developing laser diode based illumination systems. Operating at higher current densities and with smaller form factors, laser diodes may outperform LEDs in the future. This article reviews the possibilities and challenges in the integration of visible laser diodes in future illumination systems.

  20. Laser processing with specially designed laser beam

    NASA Astrophysics Data System (ADS)

    Asratyan, A. A.; Bulychev, N. A.; Feofanov, I. N.; Kazaryan, M. A.; Krasovskii, V. I.; Lyabin, N. A.; Pogosyan, L. A.; Sachkov, V. I.; Zakharyan, R. A.

    2016-04-01

    The possibility of using laser systems to form beams with special spatial configurations has been studied. The laser systems applied had a self-conjugate cavity based on the elements of copper vapor lasers (LT-5Cu, LT-10Cu, LT-30Cu) with an average power of 5, 10, or 30 W. The active elements were pumped by current pulses of duration 80-100 ns. The duration of laser generation pulses was up to 25 ns. The generator unit included an unstable cavity, where one reflector was a special mirror with a reflecting coating. Various original optical schemes used were capable of exploring spatial configurations and energy characteristics of output laser beams in their interaction with micro- and nanoparticles fabricated from various materials. In these experiments, the beam dimensions of the obtained zones varied from 0.3 to 5 µm, which is comparable with the minimum permissible dimensions determined by the optical elements applied. This method is useful in transforming a large amount of information at the laser pulse repetition rate of 10-30 kHz. It was possible to realize the high-precision micromachining and microfabrication of microscale details by direct writing, cutting and drilling (with the cutting width and through-hole diameters ranging from 3 to 100 µm) and produce microscale, deep, intricate and narrow grooves on substrate surfaces of metals and nonmetal materials. This system is used for producing high-quality microscale details without moving the object under treatment. It can also be used for microcutting and microdrilling in a variety of metals such as molybdenum, copper and stainless steel, with a thickness of up to 300 µm, and in nonmetals such as silicon, sapphire and diamond with a thickness ranging from 10 µm to 1 mm with different thermal parameters and specially designed laser beam.

  1. Laser Program annual report 1987

    SciTech Connect

    O'Neal, E.M.; Murphy, P.W.; Canada, J.A.; Kirvel, R.D.; Peck, T.; Price, M.E.; Prono, J.K.; Reid, S.G.; Wallerstein, L.; Wright, T.W.

    1989-07-01

    This report discusses the following topics: target design and experiments; target materials development; laboratory x-ray lasers; laser science and technology; high-average-power solid state lasers; and ICF applications studies.

  2. The evolution of internal stress and dislocation during tensile deformation in a 9Cr ferritic/martensitic (F/M) ODS steel investigated by high-energy X-rays

    SciTech Connect

    Zhang, Guangming; Zhou, Zhangjian; Mo, Kun; Miao, Yinbin; Liu, Xiang; Almer, Jonathan; Stubbins, James F.

    2015-12-01

    An application of high-energy wide angle synchrotron X-ray diffraction to investigate the tensile deformation of 9Cr ferritic/martensitic (F/M) ODS steel is presented. With tensile loading and in-situ Xray exposure, the lattice strain development of matrix was determined. The lattice strain was found to decrease with increasing temperature, and the difference in Young's modulus of six different reflections at different temperatures reveals the temperature dependence of elastic anisotropy. The mean internal stress was calculated and compared with the applied stress, showing that the strengthening factor increased with increasing temperature, indicating that the oxide nanoparticles have a good strengthening impact at high temperature. The dislocation density and character were also measured during tensile deformation. The dislocation density decreased with increasing of temperature due to the greater mobility of dislocation at high temperature. The dislocation character was determined by best-fit methods for different dislocation average contrasts with various levels of uncertainty. The results shows edge type dislocations dominate the plastic strain at room temperature (RT) and 300 C, while the screw type dislocations dominate at 600 C. The dominance of edge character in 9Cr F/M ODS steels at RT and 300 C is likely due to the pinning effect of nanoparticles for higher mobile edge dislocations when compared with screw dislocations, while the stronger screw type of dislocation structure at 600 C may be explained by the activated cross slip of screw segments.

  3. Laser peening with fiber optic delivery

    DOEpatents

    Friedman, Herbert W.; Ault, Earl R.; Scheibner, Karl F.

    2004-11-16

    A system for processing a workpiece using a laser. The laser produces at least one laser pulse. A laser processing unit is used to process the workpiece using the at least one laser pulse. A fiber optic cable is used for transmitting the at least one laser pulse from the laser to the laser processing unit.

  4. Robotic Laser Coating Removal System

    DTIC Science & Technology

    2008-08-01

    completion of this evaluation a 6 kW CO2 laser from Rofin -Sinar was selected for use in the RLCRS. This laser provided the highest quality laser ...DATA AND ASSUMPTIONS................................................................B-1 iii LIST OF FIGURES Page Figure 1. Six kW CO2 laser ...for proposal (RFP) that was distributed throughout the laser industry. In response to this RFP, 15 laser systems (nine CO2 , three Nd:YAG, and three

  5. Laser surgery of the skin.

    PubMed

    Goldberg, D J

    1989-11-01

    The carbon dioxide laser, the argon laser and the pulse-dye laser are used to remove a variety of skin lesions. Advantages of laser surgery include a relatively bloodless operating field and minimal postoperative discomfort and swelling. Warts, tattoos, actinic cheilitis, skin cancer, xanthelasma, ingrown toenails, keloids and port-wine stains are among the lesions that can be removed with laser surgery. The tunable pulse-dye laser is particularly useful in the treatment of vascular lesions.

  6. High power solid state lasers

    SciTech Connect

    Weber, H.

    1988-01-01

    These proceedings discuss the following subjects: trends in materials processing with laser radiation; slabs and high power systems; glasses and new crystals; solid state lasers at HOYA Corp.; lamps, resonators and transmission; glasses as active materials for high average power solid state lasers; flashlamp pumped GGG-crystals; alexandrite lasers; designing telescope resonators; mode operation of neodymium: YAG lasers; intracavity frequency doubling with KTP crystal and thermal effects in cylinder lasers.

  7. Compact Ho:YLF Laser

    NASA Technical Reports Server (NTRS)

    Hemmati, H.

    1988-01-01

    Longitudinal pumping by laser diodes increases efficiency. Improved holmium:yttrium lithium fluoride laser radiates as much as 56 mW of power at wavelength of 2.1 micrometer. New Ho:YLF laser more compact and efficient than older, more powerful devices of this type. Compact, efficient Ho:YLF laser based on recent successes in use of diode lasers to pump other types of solid-state lasers.

  8. High-power pulsed lasers

    SciTech Connect

    Holzrichter, J.F.

    1980-04-02

    The ideas that led to the successful construction and operation of large multibeam fusion lasers at the Lawrence Livermore Laboratory are reviewed. These lasers are based on the use of Nd:glass laser materials. However, most of the concepts are applicable to any laser being designed for fusion experimentation. This report is a summary of lectures given by the author at the 20th Scottish University Summer School in Physics, on Laser Plasma Interaction. This report includes basic concepts of the laser plasma system, a discussion of lasers that are useful for short-pulse, high-power operation, laser design constraints, optical diagnostics, and system organization.

  9. Lasers '83. Proceedings of the international conference

    SciTech Connect

    Powell, R.C.

    1985-01-01

    Among the topics discussed are the development history of the semiconductor diode laser, laser material processing, nonlinear spectroscopy, recent advancements in diode lasers, laser-driven particle accelerators, laser applications in the atmospheric sciences, laser-assisted collisions, novel (garnet and alexandrite) solid state laser materials, IR molecular lasers, devices and components for fiber-optic communications, free-electron lasers and masers, and picosecond optical phenomena. Also covered are laser-stimulated materials surface processes, color center laser developments, blue-green and metal vapor lasers, laser chemistry, nonlinear effects, high energy lasers, excimer lasers, laser trapping of ions, optical cavities and propagation, laser isotope separation, laser trapping of atoms, laser applications in biochemistry, tunable coherent short wavelength radiation, laser spectroscopy, picosecond studies of condensed phase molecular systems, and combustion and plasma diagnostics.

  10. Tunable dysprosium laser.

    PubMed

    Majewski, Matthew R; Jackson, Stuart D

    2016-10-01

    We report the demonstration of a tunable dysprosium laser. The experiment employed in-band pumping of a Dy3+-doped fluoride fiber and a simple resonator design involving a ruled diffraction grating. The laser produced tuning between 2.95 and 3.35 μm, limited by the availability of optics.

  11. Dye laser amplifier

    DOEpatents

    Moses, E.I.

    1992-12-01

    An improved dye laser amplifier is disclosed. The efficiency of the dye laser amplifier is increased significantly by increasing the power of a dye beam as it passes from an input window to an output window within the dye chamber, while maintaining the intensity of the dye beam constant. 3 figs.

  12. Laser Ranging Simulation Program

    NASA Technical Reports Server (NTRS)

    Piazolla, Sabino; Hemmati, Hamid; Tratt, David

    2003-01-01

    Laser Ranging Simulation Program (LRSP) is a computer program that predicts selected aspects of the performances of a laser altimeter or other laser ranging or remote-sensing systems and is especially applicable to a laser-based system used to map terrain from a distance of several kilometers. Designed to run in a more recent version (5 or higher) of the MATLAB programming language, LRSP exploits the numerical and graphical capabilities of MATLAB. LRSP generates a graphical user interface that includes a pop-up menu that prompts the user for the input of data that determine the performance of a laser ranging system. Examples of input data include duration and energy of the laser pulse, the laser wavelength, the width of the laser beam, and several parameters that characterize the transmitting and receiving optics, the receiving electronic circuitry, and the optical properties of the atmosphere and the terrain. When the input data have been entered, LRSP computes the signal-to-noise ratio as a function of range, signal and noise currents, and ranging and pointing errors.

  13. Athermal laser design.

    PubMed

    Bovington, Jock; Srinivasan, Sudharsanan; Bowers, John E

    2014-08-11

    This paper discusses circuit based and waveguide based athermalization schemes and provides some design examples of athermalized lasers utilizing fully integrated athermal components as an alternative to power hungry thermo-electric controllers (TECs), off-chip wavelength lockers or monitors with lookup tables for tunable lasers. This class of solutions is important for uncooled transmitters on silicon.

  14. Surface treatments by laser

    NASA Astrophysics Data System (ADS)

    Thomann, A. L.; Benzerga, R.; Basillais, Armelle; Georges, Cecile; Fariaut, Francois; Semmar, Nadjib; Boulmer-Leborgne, Chantal

    2003-07-01

    Laser treatments of various metals are studying depending on the laser wavelength, pulse time duration and shape, and fluence (laser/metal interaction regime). Low fluence excimer UV laser melting process of gold layer is shown to improve the corrosion resistance of multilayer (Au/Ni/Cu alloy) electrical contacts. For this application the homogenity of the laser beam as well as the initial Cu substrate roughness are found to be limiting parameters of the process. Carburization of Al alloy, performed in C3H6 atmosphere with a KrF laser induces the incorporation of carbon atoms over about 4 μm depth. The crystalline Al4C3 synthesized at the surface leads to a strengthening of the light Al alloy, which is of great interest for application in car industry. The study shows that diffusion of C atom in the target is possible because of a plasma presence on the surface which supports the molten bath life time and induces dissociation of the ambient gas. In the last example of laser metal surface treatment presented in that paper, a commonly used steel is treated in air with different lasers at a fluence above the plasma formation threshold. It is seen that the machining oils covering the surface before the treatment can be efficiently removed and that new compounds (nitride, carbide and oxides) are formed at the surface.

  15. CO2 laser resurfacing.

    PubMed

    Fitzpatrick, R E

    2001-07-01

    The CO2 Laser offers a variety of unique features in resurfacing facial photodamage and acne scarring. These include hemostasis, efficient removal of the epidermis in a single pass, thermally induced tissue tightening, and safe, predictable tissue interaction. Knowledge of these mechanisms will result in the capability of using the CO2 laser effectively and safely whether the goal is superficial or deep treatment.

  16. Learning about Lasers

    ERIC Educational Resources Information Center

    Roberts, Larry

    2011-01-01

    The word laser is an acronym. It stands for Light Amplification by Stimulated Emission of Radiation. Lasers, invented in 1958, are used to cut and fuse materials, accurately survey long distances, communicate across fiber-optic phone lines, produce 3D pictures, make special effects, help navigation, and read bar codes for cash registers. A laser…

  17. Free-Electron Lasers.

    ERIC Educational Resources Information Center

    Brau, Charles A.

    1988-01-01

    Describes the use of free-electron lasers as a source of coherent radiation over a broad range of wavelengths from the far-infrared to the far-ultraviolet regions of the spectrum. Discusses some applications of these lasers, including medicine and strategic defense. (TW)

  18. Dielectric laser accelerators

    NASA Astrophysics Data System (ADS)

    England, R. Joel; Noble, Robert J.; Bane, Karl; Dowell, David H.; Ng, Cho-Kuen; Spencer, James E.; Tantawi, Sami; Wu, Ziran; Byer, Robert L.; Peralta, Edgar; Soong, Ken; Chang, Chia-Ming; Montazeri, Behnam; Wolf, Stephen J.; Cowan, Benjamin; Dawson, Jay; Gai, Wei; Hommelhoff, Peter; Huang, Yen-Chieh; Jing, Chunguang; McGuinness, Christopher; Palmer, Robert B.; Naranjo, Brian; Rosenzweig, James; Travish, Gil; Mizrahi, Amit; Schachter, Levi; Sears, Christopher; Werner, Gregory R.; Yoder, Rodney B.

    2014-10-01

    The use of infrared lasers to power optical-scale lithographically fabricated particle accelerators is a developing area of research that has garnered increasing interest in recent years. The physics and technology of this approach is reviewed, which is referred to as dielectric laser acceleration (DLA). In the DLA scheme operating at typical laser pulse lengths of 0.1 to 1 ps, the laser damage fluences for robust dielectric materials correspond to peak surface electric fields in the GV /m regime. The corresponding accelerating field enhancement represents a potential reduction in active length of the accelerator between 1 and 2 orders of magnitude. Power sources for DLA-based accelerators (lasers) are less costly than microwave sources (klystrons) for equivalent average power levels due to wider availability and private sector investment. Because of the high laser-to-particle coupling efficiency, required pulse energies are consistent with tabletop microJoule class lasers. Combined with the very high (MHz) repetition rates these lasers can provide, the DLA approach appears promising for a variety of applications, including future high-energy physics colliders, compact light sources, and portable medical scanners and radiative therapy machines.

  19. Lasers, A Bibliography.

    DTIC Science & Technology

    1979-09-02

    TA1675 Muncheryan , Hrand 14. Laser Fundamentals and Applications, 1486 Indianapolis , IN: H.W. Sams , c1975 . 2...Francisco , CA: the cmd , 1970. • TK787 1.3 Van Pelt , W.F . , et al . Laser Fundamentals and Experiments . US Washington , DC: U.S. Bur of Radiological

  20. Infrared laser bone ablation

    SciTech Connect

    Nuss, R.C.; Fabian, R.L.; Sarkar, R.; Puliafito, C.A.

    1988-01-01

    The bone ablation characteristics of five infrared lasers, including three pulsed lasers (Nd:YAG, lambda = 1064 micron; Hol:YSGG, lambda = 2.10 micron; and Erb:YAG, lambda = 2.94 micron) and two continuous-wave lasers (Nd:YAG, lambda = 1.064 micron; and CO/sub 2/, lambda = 10.6 micron), were studied. All laser ablations were performed in vitro, using moist, freshly dissected calvarium of guinea pig skulls. Quantitative etch rates of the three pulsed lasers were calculated. Light microscopy of histologic sections of ablated bone revealed a zone of tissue damage of 10 to 15 micron adjacent to the lesion edge in the case of the pulsed Nd:YAG and the Erb:YAG lasers, from 20 to 90 micron zone of tissue damage for bone ablated by the Hol:YSGG laser, and 60 to 135 micron zone of tissue damage in the case of the two continuous-wave lasers. Possible mechanisms of bone ablation and tissue damage are discussed.