Science.gov

Sample records for efeitos od laser

  1. Stabilization of 48- and 57-μ m CH3OD lasers for plasma diagnostics

    NASA Astrophysics Data System (ADS)

    Nakayama, K.; Okajima, S.; Akiyama, T.; Tanaka, K.; Kawahata, K.

    2015-12-01

    Simultaneously oscillated 48-μ m and 57-μ m CH3OD lasers pumped by a 9R(8) CO2 laser have been developed as optical sources of interferometer and polarimeter for fusion plasma diagnostics. The objective of this paper is to present a method for stabilizing the two-color far-infrared (FIR) laser outputs. A stable FIR laser requires a stable pump CO2 laser and a prevention of a back reflection from the FIR laser cavity. The frequency of the pump CO2 laser has been stabilized by an external Stark-cell modulation. The back reflection has been reduced by an optical isolator using a quarter-wave plate and an absorbing thin-film reflector. The two-color FIR laser outputs have been stabilized by controlling the cavity length. As a result of these measures, we have achieved output stabilities of ± 1.2%/h at the 48-μ m laser and ± 1.3%/h at the 57-μ m laser.

  2. Multi-frequency, 3D ODS measurement by continuous scan laser Doppler vibrometry

    NASA Astrophysics Data System (ADS)

    Weekes, Ben; Ewins, David

    2015-06-01

    Continuous scan laser Doppler vibrometry (CSLDV) is a technique which has been described and explored in the literature for over two decades, but remains niche compared to SLDV inspection by a series of discrete-point measurements. This is in part because of the unavoidable phenomenon of laser speckle, which deteriorates signal quality when velocity data is captured from a moving spot measurement. Further, applicability of CSLDV has typically been limited to line scans and rectangular areas by the application of sine, step, or ramp functions to the scanning mirrors which control the location of the measurement laser spot. In this paper it is shown that arbitrary functions to scan any area can easily be derived from a basic calibration routine, equivalent to the calibration performed in conventional discrete-point laser vibrometry. This is extended by performing the same scan path upon a test surface from three independent locations of the laser head, and decomposing the three sets of one-dimensional deflection shapes into a single set of three-dimensional deflection shapes. The test was performed with multi-sine excitation, yielding 34 operating deflection shapes from each scan.

  3. High-resolution laser spectroscopy of BaOH and BaOD: Anomalous spin-orbit coupling in the AΠ state

    NASA Astrophysics Data System (ADS)

    Tandy, J. D.; Wang, J.-G.; Bernath, P. F.

    2009-05-01

    The AΠ(0 0 0)-XΣ+(0 0 0) transition of BaOD has been rotationally analyzed using laser excitation spectroscopy. BaOD molecules were synthesized through the reaction of Ba atoms with D 2O in a Broida-type oven. Rotational and fine structure parameters determined for the AΠ(0 0 0) state of BaOD yielded a spin-orbit coupling constant A significantly different from the corresponding value for BaOH (˜605.8 cm -1 versus 560.1 cm -1). Λ-doubling constants for the AΠ state were observed to be in poor agreement with the predictions of the pure precession model for the interaction between the AΠ and the BΣ+ states in BaOD. Explanations for the unusual spin-orbit splitting and apparent failure of the pure precession and unique perturber models in BaOH and BaOD are discussed, with particular reference to possible global and local perturbations arising from vibrationally excited bands of the AΔ state.

  4. Training and OD Today.

    ERIC Educational Resources Information Center

    Mendenhall, Mark; And Others

    1983-01-01

    Reviews current organizational development and training practices in two articles of a special section. The first compares OD philosophy with McGregor's integrative approach. The second article discusses contributions OD practice can make to theory, including modifying existing theories, addressing new problems, and exploring the internal logic of…

  5. ODS iron aluminides

    SciTech Connect

    Wright, I.G.; McKamey, C.G.; Pint, B.A.

    1995-07-01

    Since oxide dispersion-strengthened (ODS) FeCrAl-based alloys have sufficient creep strength and good oxidation resistance at the very high temperatures of interest for the primary heat exchanger in advanced, closed-cycle gas turbine systems, they constitute viable alternative candidates to ceramics. A major life-limiting factor of these alloys is the ability to continue to form a protective scale of aluminum oxide, a factor proportional to the total amount of aluminum contained in the alloy. Fe{sub 3}Al has oxidation resistance comparable to that of the FeCrAl-based alloys, and significantly superior sulfidation resistance. Also, because of its larger reservoir of aluminum, Fe{sub 3}Al would be expected to exhibit longer lifetimes at the temperatures of interest. Since the strengthening effects of ODS processing are expected to confer similar high-temperature creep properties to those found for the FeCrAl-based alloys, ODS-Fe{sub 3}Al is considered to have excellent potential for the very high-temperature heat exchanger application. The program effort on ODS Fe{sub 3}Al includes examination of the properties of available ODS-FeCrAl alloys; development of mechanical alloying parameters for ODS-Fe{sub 3}Al; determination of the effects of a dispersion of reactive element oxides on the high-temperature oxidation behavior of Fe{sub 3}Al; and evaluation of methods for joining them.

  6. ODS iron aluminides

    SciTech Connect

    Wright, I.G.; Pint, B.A.; Ohriner, E.K.; Tortorelli, P.F.

    1996-08-01

    The overall goal of this program is to develop an oxide dispersion-strengthened (ODS) version of Fe{sub 3}Al that has sufficient creep strength and resistance to oxidation at temperatures in the range 1000 to 1200{degrees}C to be suitable for application as heat exchanger tubing in advanced power generation cycles. The program has two main thrusts: (a) alloy processing, which involves mechanical alloying and thermomechanical processing to achieve the desired size and distribution of the oxide dispersoid, and (b) optimization of the oxidation behavior to provide increased service life compared to ODS-FeCrAl alloys intended for the same applications. Control of the grain size and shape in the final alloy is very dependent on the homogeneity of the alloy powder, in terms of the size and distribution of the dispersed oxide particles, and on the level of strain and temperature applied in the recrystallization step. Studies of the effects of these variables are being made using mechanically-alloyed powder from two sources: a commercial powder metallurgy alloy vendor and an in-house, controlled environment high-energy mill. The effects of milling parameters on the microstructure and composition of the powder and consolidated alloy are described. Comparison of the oxidation kinetics of ODS-Fe{sub 3}Al alloys with commercial ODS-FeCrAl alloys in air at 1000-1300{degrees}C indicated that the best Fe{sub 3}Al-based alloys oxidized isothermally at the same rate as the ODS-FeCrAl alloys but, under thermal cycling conditions, the oxidation rate of ODS-Fe{sub 3}Al was faster. The main difference was that the ODS-Fe{sub 3}Al experienced significantly more scale spallation above 1000{degrees}C. The differences in oxidation behavior were translated into expected lifetimes which indicated that, for an alloy section thickness of 2.5 mm, the scale spallation of ODS-Fe{sub 3}Al leads to an expected service lifetime similar to that for the INCO alloy MA956 at 1100 to 1300{degrees}C.

  7. ODS iron aluminides

    SciTech Connect

    Wright, I.G.; Pint, B.A.; Tortorelli, P.F.; Ohriner, E.K.

    1996-06-01

    Interest in advanced cycles that involve indirectly-fired gas turbines, in which coal- or gas-fired high-temperature heat exchangers are used to heat a working fluid in a closed system, has led to investigation of materials for heat exchangers capable of operation at temperatures of the order of 1200 to 1300{degrees}C. The candidate materials are ceramics and, possibly, oxide dispersion-strengthened (ODS) alloys. An ODS FeCrAl alloy was found to meet the strength requirements for such an application, in which the working fluid at 0.9 MPa was to be heated from 800 to 1100{degrees}C over a tube length of 4 m. The oxidation life of ODS FeCrAl alloys is determined by their ability to form or reform a protective alumina scale, and can be related to the time for the aluminum content of the alloy to be depleted to some minimum level. As a result, the service life is a function of the available aluminum content of the alloys and the minimum aluminum level at which breakaway oxidation occurs, hence there is a limit on the minimum cross section which can be safely employed at temperatures above 1200{degrees}C. Because of their significantly higher aluminum content ({ge}28 atom %/{ge}16 wt. percent compared to {approx}9 atom %15 wt. percent), alloys based on Fe{sub 3}Al afford a potentially larger reservoir of aluminum to sustain oxidation resistance at higher temperatures and, therefore, offer a possible improvement over the currently-available ODS FeCrAl alloys, providing they can be strengthened in a similar manner.

  8. ODS iron aluminides

    SciTech Connect

    Wright, I.G.; McKamey, C.G.; Pint, B.A.

    1995-06-01

    There has been a recent increase of interest in advanced cycles that involve indirectly-fired gas turbines, in which coal- or gas-fired high-temperature heat exchangers are used to heat a working fluid in a closed system. In a program conducted as part of the European COST-501 Concerted Action Project, available alloys based on FeCrAl-Y{sub 2}O{sub 3} were evaluated for use in the main heat exchanger in a similar closed-cycle gas turbine application. One of the currently available ODS FeCrAl alloys was found to meet the strength requirements for this application, in which the working fluid at 0.9 MPa (131 psi) flowing at 5,889 kg/hr (12,955 lb/hr) was to be heated from 800 to 1100{degrees}C (1472 to 2012{degrees}F) over a tube length of 4 m (13 ft).

  9. Characterization of Two ODS Alloys: Chromium-18 ODS and Chromium-9 ODS

    NASA Astrophysics Data System (ADS)

    Goddard, Julianne

    ODS alloys, or oxide dispersion strengthened alloys, are made from elemental or pre-alloyed metal powders mechanically alloyed with oxide powders in a high-energy attributor mill, and then consolidated by either hot isostatic pressing or hot extrusion causing the production of nanometer scale oxide and carbide particles within the alloy matrix; crystalline properties such as creep strength, ductility, corrosion resistance, tensile strength, swelling resistance, and resistance to embrittlement are all observed to be improved by the presence of nanoparticles in the matrix. The presented research uses various methods to observe and characterize the microstructural and microchemical properties of two experimental ODS alloys, 18Cr ODS and 9Cr ODS. The results found aid in assessing the influence of chemical and structural variations on the effectiveness of the alloy, and further aid in the optimization of these advanced alloys for future use in nuclear cladding and structural applications in Generation IV nuclear reactors. Characterization of these alloys has been conducted in order to identify the second-phase small precipitates through FESEM, TEM, EDS, Synchrotron X-ray diffraction analysis, and CuKalpha XRD analysis of bulk samples and of nanoparticles after extraction from the alloy matrix. Comparison of results from these methods allows further substantiation of the accuracy of observed nanoparticle composition and identification. Also, TEM samples of the two alloys have been irradiated in-situ with 1 MeV Kr and 300 keV Fe ions to various doses and temperatures at the IVEM-Tandem TEM at Argonne National Laboratory and post-irradiated characterization has been conducted and compared to the pre-irradiated characterization results in order to observe the microstructural and microchemical evolution of nanoparticles under irradiation. Overall in the as-received state, the initial Y2O3 is not found anymore and in addition to oxide particles the alloys contain carbides

  10. The oxidation and corrosion of ODS alloys

    NASA Technical Reports Server (NTRS)

    Lowell, Carl E.; Barrett, Charles A.

    1990-01-01

    The oxidation and hot corrosion of high temperature oxide dispersion strengthened (ODS) alloys are reviewed. The environmental resistance of such alloys are classified by oxide growth rate, oxide volatility, oxide spalling, and hot corrosion limitations. Also discussed are environmentally resistant coatings for ODS materials. It is concluded that ODS NiCrAl and FeCrAl alloys are highly oxidation and corrosion resistant and can probably be used uncoated.

  11. Progress in ODS Alloys: A Synopsis of a 2010 Workshop on Fe- Based ODS Alloys

    SciTech Connect

    Kad, Bimal; Dryepondt, Sebastien N; Jones, Andy R.; Vito, Cedro III; Tatlock, Gordon J; Pint, Bruce A; Tortorelli, Peter F; Rawls, Patricia A.

    2012-01-01

    In Fall 2010, a workshop on the role and future of Fe-based Oxide Dispersion Strengthened (ODS) alloys gathered together ODS alloy suppliers, potential industrial end-users, and technical experts in relevant areas. Presentations and discussions focused on the current state of development of these alloys, their availability from commercial suppliers, past major evaluations of ODS alloy components in fossil and nuclear energy applications, and the technical and economic issues attendant to commercial use of ODS alloys. Significant progress has been achieved in joining ODS alloys, with creep resistant joints successfully made by inertia welding, friction stir welding and plasma-assisted pulse diffusion bonding, and in improving models for the prediction of lifetime components. New powder and alloy fabrication methods to lower cost or improve endproduct properties were also described. The final open discussion centered on challenges and pathways for further development and large-scale use of ODS alloys.

  12. Reduction in Defect Content in ODS Alloys

    SciTech Connect

    Ritherdon, J.; Jones, A.R.

    2000-02-01

    The work detailed within this report is a continuation of earlier work that was carried out under contract number IDX-SY382V. The earlier work comprised a literature review of the sources and types of defects found principally in Fe-based ODS alloys together with a series of experiments designed to identify defects in ODS Fe{sub 3}Al material and recommend methods of defect reduction. Defects found in the Mechanically Alloyed (MA) ODS Fe{sub 3}Al included regions of incomplete MA, porosity, intrusions and fine-grained stringers. Some defects tended to be found in association with one another e.g. intrusions and fine-grained stringers. Preliminary powder separation experiments were also performed. The scope and objectives of the present work were laid out in the technical proposal ``Reduction in Defect Content in ODS Alloys--II'' which formed the basis of amendment 3 of the current contract. The current studies were devised in the context of the preceding work with a view to extending and concluding certain experiments while exploring new avenues of investigation of defect control and reduction where appropriate. All work proposed was within the context of achieving an ODS Fe{sub 3}Al alloy of improved overall quality and potential creep performance (particularly) in the consolidated, release condition. The interim outturn of the experimental work performed is also reported.

  13. Dissociative Recombination of CD 3 OD 2 +

    NASA Astrophysics Data System (ADS)

    Geppert, W. D.; Hellberg, F.; Österdahl, F.; Semaniak, J.; Millar, T. J.; Roberts, H.; Thomas, R. D.; Hamberg, M.; Ugglas, M. Af; Ehlerding, A.; Zhaunerchyk, V.; Kaminska, M.; Larsson, M.

    2005-08-01

    The branching ratios of the different reaction pathways and the overall rate of the dissociative recombination of CD_{3}OD_{2}^{+} were measured at the CRYRING storage ring located at the Manne Siegbahn Laboratory in Stockholm, Sweden. A preliminary analysis of the data yielded that formation of methanol accounts for only 6 ± 2% of the total reaction rate. Largely, dissociative recombination of CD_{3}OD_{2}^{+} involves fragmentation of the C-O bond, the major process being the three-body break-up forming CD_{3}, OD and D (branching ratio 0.59). A non-negligible formation of interstellar methanol by the previously proposed mechanism is therefore very unlikely.

  14. SEDS Tether M/OD Damage Analyses

    NASA Technical Reports Server (NTRS)

    Hayashida, K. B.; Robinson, J. H.; Hill, S. A.

    1997-01-01

    The Small Expendable Deployer System (SEDS) was designed to deploy an endmass at the end of a 20-km-long tether which acts as an upper stage rocket, and the threats from the meteoroid and orbital debris (M/OD) particle environments on SEDS components are important issues for the safety and success of any SEDS mission. However, the possibility of severing the tether due to M/OD particle impacts is an even more serious concern, since the SEDS tether has a relatively large exposed area to the M/OD environments although its diameter is quite small. The threats from the M/OD environments became a very important issue for the third SEDS mission, since the project office proposed using the shuttle orbiter as a launch platform instead of the second stage of a Delta II expendable rocket, which was used for the first two SEDS missions. A series of hyper-velocity impact tests were performed at the Johnson Space Center and Arnold Engineering Development Center to help determine the critical particle sizes required to sever the tether. The computer hydrodynamic code or hydrocode called CTH, developed by the Sandia National Laboratories, was also used to simulate the damage on the SEDS tether caused by both the orbital debris and test particle impacts. The CTH hydrocode simulation results provided the much needed information to help determine the critical particle sizes required to sever the tether. The M/OD particle sizes required to sever the tether were estimated to be less than 0.1 cm in diameter from these studies, and these size particles are more abundant in low-Earth orbit than larger size particles. Finally, the authors performed the M/OD damage analyses for the three SEDS missions; i.e., SEDS-1, -2, and -3 missions, by using the information obtained from the hypervelocity impact test and hydrocode simulations results.

  15. Reduction in Defect Content of ODS Alloys

    SciTech Connect

    Ritherdon, J

    2001-05-15

    The work detailed within this report is a continuation of earlier work carried out under contract number 1DX-SY382V. The earlier work comprises a literature review of the sources and types of defects found principally in Fe-based ODS alloys as well as experimental work designed to identify defects in the prototype ODS-Fe{sub 3}Al alloy, deduce their origins and to recommend methods of defect reduction. The present work is an extension of the experimental work already reported and concentrates on means of reduction of defects already identified rather than the search for new defect types. This report also includes results gathered during powder separation trials, conducted by the University of Groningen, Netherlands and coordinated by the University of Liverpool, involving the separation of different metallic powders in terms of their differing densities. The scope and objectives of the present work were laid out in the technical proposal ''Reduction in Defect Content in ODS Alloys-III''. All the work proposed in the ''Statement of Work'' section of the technical proposal has been carried out and all work extra to the ''Statement of Work'' falls within the context of an ODS-Fe{sub 3}Al alloy of improved overall quality and potential creep performance in the consolidated form. The outturn of the experimental work performed is reported in the following sections.

  16. La Station Laser ultra mobile: de l'Obtention d'une Exactitude centimétrique des Mesures à des Applications en Océanographie et Géodésie Spatiales

    NASA Astrophysics Data System (ADS)

    Nicolas, Joëlle

    2000-12-01

    La Station Laser Ultra Mobile est la plus petite station de télémétrie laser au monde, ne pesant que 300 kg, dédiée à la poursuite de satellites équipés de rétroréflecteurs laser. Elle utilise un petit télescope de 13 cm de diamètre placé sur une monture issue d'un théodolite de précision et motorisé, un laser très compact et une photodiode à avalanche permettant la détection au niveau du simple photo-électron. Les premières expériences (Corse, fin 1996) ont révélé de nombreuses instabilités dans la qualité des mesures. Ce travail concerne l'étude et la mise en place de nombreuses modifications techniques afin d'atteindre une exactitude centimétrique des mesures et de pouvoir participer à la campagne de validation des orbites et d'étalonnage de l'altimètre du satellite océanographique JASON-1 (2001). La précision instrumentale souhaitée a été vérifiée avec succès en laboratoire. Outre cet aspect instrumental et métrologique, une analyse a été développée afin de pouvoir estimer l'exactitude et la stabilité des observations de la station mobile après intégration des modifications. A partir d'une expérience de co-localisation entre les deux stations laser fixe du plateau de Calern, l'analyse est basée sur l'ajustement, par station, de coordonnées et d'un biais instrumental moyen à partir d'une orbite de référence des satellites LAGEOS. Des variations saisonnières ont été mises en évidence dans les séries temporelles des différentes composantes. La comparaison locale des déformations de la croûte terrestre se traduisant par des variations d'altitude issues des données laser a montré une cohérence remarquable avec les mesures du gravimètre absolu transportable FG5. Des signaux de même amplitude ont aussi été observés par GPS. Ces variations sont également mises en évidence à l'échelle mondiale et leur interprétation géophysique est faite (combinaison des effets de marées terrestres et polaire

  17. Reduction in Defect Content in ODS Alloys

    SciTech Connect

    Jones, A.R.; Ritherdon, J.; Prior, D.J.

    2003-04-22

    In order to develop FeCrAl-based ODS alloy tubing with the coarse, high aspect ratio, appropriately oriented grain structures likely to deliver enhanced high temperature (11000C) hoop creep strength compared to conventionally formed ODS alloy tubing, flow forming techniques were explored in a European funded programme. The evolution of microstructure in PM2000 alloy tubing formed by warm flow forming techniques has been the subject of continuing investigation and more detailed study in the current work. The warm flow formed tubes investigated were produced by reverse flow forming using three, 1200 opposed rollers described around a tube preform supported on a driven mandrel. This produced a complex pattern of shape changing deformation, driven from the outer surface of the tube preforms. The grain size and shape together with the pattern of nucleation and growth of secondary recrystallization that developed through the thickness of the tube wall during the subsequent high temperature annealing (13800C) of these warm flow formed samples is described, as are the textures that formed. The unusual pattern and shape of secondary recrystallized grain structures that formed on the outer surfaces of the flow formed tubes closely follows the pattern and pitch of the flow forming rollers. The local texture, grain shape and pattern of misorientation in the surface of warm flow formed tubes that was associated with the development of these outer surface microstructures are described. Parallel studies have continued on the influence of microstructural inhomogeneities on the development of secondary recrystallized grain structures in ODS alloys. As part of this work, a separate variant of PM2000 alloy with additions of 1 wt.% ODS-free Fe powder have been manufactured as extruded bar by Plansee GmbH. The initial recrystallization behavior of the variant has been studied and cross-compared with the recrystallization behavior found in a prototype ODS-Fe3Al alloy, notably where the

  18. The Bgo-Od Experiment at Elsa

    NASA Astrophysics Data System (ADS)

    Bantes, B.; Bayadilov, D.; Beck, R.; Becker, M.; Bella, A.; Bieling, J.; Böse, S.; Braglieri, A.; Brinkmann, K.; Burdeynyi, D.; Curciarello, F.; de Leo, V.; di Salvo, R.; Dutz, H.; Elsner, D.; Fantini, A.; Frese, T.; Friedrick, S.; Frommberger, F.; Ganenko, V.; Gervino, G.; Ghio, F.; Giardina, G.; Girolami, B.; Glazier, D.; Goertz, S.; Gridnev, A.; Gutz, E.; Hammann, D.; Hannappel, J.; Hillert, W.; Ignatov, A.; Jahn, O.; Jahn, R.; Joosten, R.; Jude, T. C.; Klein, F.; Koop, K.; Krusche, B.; Lapik, A.; Levi Sandri, P.; Lopatin, I.; Mandaglio, G.; Messi, F.; Messi, R.; Metag, V.; Moricciani, D.; Nanova, M.; Nedorezov, V.; Noviskiy, D.; Pedroni, P.; Romaniuk, M.; Rostomyan, T.; Schaerf, C.; Schmieden, H.; Sumachev, V.; Tarakonov, V.; Vegna, V.; Vlasov, P.; Walther, D.; Watts, D.; Zaunick, H.-G.; Zimmermann, T.

    2014-01-01

    Meson photoproduction is a key tool for the experimental investigation of the nucleon excitation spectrum. To disentangle the specific couplings of resonances, in addition to the rather well measured pion and eta photoproduction channels it is mandatory to obtain information on channels involving strange and vector mesons and higher mass pseudoscalar mesons, and the associated multi-particle final states with both charged and neutral particles. In this respect, the new BGO-OD experiment at the ELSA accelerator of the University of Bonn's Physikalisches Institut provides unique instrumentation. We describe the experiment, present its status and the initial program of measurements.

  19. DEVELOPMENT OF ODS HEAT EXCHANGER TUBING

    SciTech Connect

    Mark A. Harper, Ph.D.

    2001-01-01

    The Vision 21 project titled ''Development of ODS Heat Exchanger Tubing'' has been initiated. A project kick-off meeting was held in Huntington, WV, the MA956 powder that will be used in the extrusion campaign has been obtained, and some of the MA956 tubing and rod required for joining trials has been shipped to the appropriate subcontractors. Acquisition of the MA956 alloy powder will allow the extrusion campaign to begin during the month of February. Also, tubing shipped to Edison Welding Institute and rod shipped to Michigan Technological University will allow joining trials to begin. In addition to these technical aspects, negotiations with all the subcontractors have been completed and the Project Management Plan and Project Work Plan have been prepared and submitted for approval.

  20. Fabrication and characterization of ODS austenitic steels

    NASA Astrophysics Data System (ADS)

    Xu, Yingli; Zhou, Zhangjian; Li, Ming; He, Pei

    2011-10-01

    Pure Fe, Cr, Ni, W, Ti elemental powders and nano-Y 2O 3 powders (the compositions of the mixed powders are Fe-18Cr-8Ni-2W-1Ti-0.35Y 2O 3) were processed by high energy mechanical milling. The as milled powders were consolidated by hot isostatic pressing for 3 h at 1423 K under a pressure of 200 MPa. The microstructure of the fabricated ODS austenitic steels and chemical composition of the oxide particles were examined by field emission scanning electron microscopy with energy dispersive spectrometry. The dispersed fine oxides were determined to be Y-Ti-O oxides. The tensile properties were improved significantly by oxide dispersion strengthening but the ductility deteriorated.

  1. Joining Techniques for Ferritic ODS Alloys

    SciTech Connect

    V.G. Krishnardula; V.G. Krishnardula; D.E. Clark; T.C. Totemeier

    2005-06-01

    This report presents results of research on advanced joining techniques for ferritic oxide-dispersion strengthened alloys MA956 and PM2000. The joining techniques studied were resistance pressure welding (also known as pressure forge welding), transient liquid phase bonding, and diffusion bonding. All techniques were shown to produce sound joints in fine-grained, unrecrystallized alloys. Post-bond heat treatment to produce a coarse-grained, recrystallized microstructure resulted in grain growth across the bondline for transient liquid phase and diffusion bonds, giving microstructures essentially identical to that of the parent alloy in the recrystallized condition. The effects of bond orientation, boron interlayer thickness, and bonding parameters are discussed for transient liquid phase and diffusion bonding. The report concludes with a brief discussion of ODS joining techniques and their applicability to GEN IV reactor systems.

  2. Transient liquid-phase bonding of ODS steels

    NASA Astrophysics Data System (ADS)

    Noto, H.; Ukai, S.; Hayashi, S.

    2011-10-01

    The use of transient liquid-phase bonding of 9CrODS steels using Fe-3B-2Si-0.5C filler was investigated for bonding temperature of 1180 °C and hold times of 0.5-4.0 h. The sequential process, consisting of isothermal melting, solidification and homogenization, was confirmed for bonding the 9CrODS steel. The precipitation of chromium boride found in 19CrODS steel is avoided in 9CrODS steel due to the lower Cr content. Silicon tends to be slightly enriched inside the bonding zone. Agglomeration and coarsening of Y 2O 3 particles in 9CrODS steel lead to softening inside the bonding zone formed by incipient melting of the foil bonding alloy, and in a diffusion affected zone (DAZ) adjacent to the bonding zone.

  3. The oxidation behavior of ODS iron aluminides

    SciTech Connect

    Pint, B.A.; Tortorelli, P.F.; Wright, I.G.

    1996-05-01

    Oxide-dispersed Fe-28at.%Al-2%Cr alloys were produced by a powder metallurgy technique followed by hot extrusion. A variety of stable oxides were added to the base alloy to assess the effect of these dopants on the oxidation behavior at 1200{degrees}C in air and O{sub 2}. An Al{sub 2}O{sub 3} dispersion flattened the {alpha}-Al{sub 2}O{sub 3} scale, but produced none of the other reactive element effects and had an adverse influence on the long-term oxidation behavior. A Y{sub 2}O{sub 3} dispersion improved the alumina scale adhesion relative to a Zr alloy addition at 1200{degrees} and 1300{degrees}C. However, the Y{sub 2}O{sub 3} dispersion was not as effective in improving scale adhesion in Fe{sub 3}Al as it is in FeCrAl. This inferior performance is attributed to a larger amount of interfacial void formation on ODS Fe{sub 3}Al.

  4. Lasers.

    ERIC Educational Resources Information Center

    Schewe, Phillip F.

    1981-01-01

    Examines the nature of laser light. Topics include: (1) production and characteristics of laser light; (2) nine types of lasers; (3) five laser techniques including holography; (4) laser spectroscopy; and (5) laser fusion and other applications. (SK)

  5. Lasers.

    ERIC Educational Resources Information Center

    Schewe, Phillip F.

    1981-01-01

    Examines the nature of laser light. Topics include: (1) production and characteristics of laser light; (2) nine types of lasers; (3) five laser techniques including holography; (4) laser spectroscopy; and (5) laser fusion and other applications. (SK)

  6. It's Often Family to The Rescue During Opioid ODs

    MedlinePlus

    ... page: https://medlineplus.gov/news/fullstory_165671.html It's Often Family to the Rescue During Opioid ODs ... Narcan, Evzio) -- and found that family members used it in about 20 percent of slightly over 4, ...

  7. Strangeness Photoproduction at the BGO-OD Experiment

    NASA Astrophysics Data System (ADS)

    Jude, T. C.; Alef, S.; Bayadilov, D.; Beck, R.; Becker, M.; Bella, A.; Bielefeldt, P.; Boese, S.; Braghieri, A.; Brinkmann, K.; Cole, P.; Curciarello, F.; De Leo, V.; Di Salvo, R.; Dutz, H.; Elsner, D.; Fantini, A.; Freyermuth, O.; Friedrich, S.; Frommberger, F.; Ganenko, V.; Gervino, G.; Ghio, F.; Giardina, G.; Goertz, S.; Gridnev, A.; Gutz, E.; Hammann, D.; Hannappel, J.; Hartmann, P.; Hillert, W.; Ignatov, A.; Jahn, R.; Joosten, R.; Klein, F.; Koop, K.; Krusche, B.; Lapik, A.; Levi Sandri, P.; Lopatin, I. V.; Mandaglio, G.; Messi, F.; Messi, R.; Metag, V.; Moricciani, D.; Mushkarenkov, A.; Nanova, M.; Nedorezov, V.; Novinskiy, D.; Pedroni, P.; Reitz, B.; Romaniuk, M.; Rostomyan, T.; Rudnev, N.; Scheluchin, G.; Schmieden, H.; Stugelev, A.; Sumachev, V.; Tarakanov, V.; Vegna, V.; Walther, D.; Watts, D.; Zaunick, H.; Zimmermann, T.

    BGO-OD is a newly commissioned experiment to investigate the internal structure of the nucleon, using an energy tagged bremsstrahlung photon beam at the ELSA electron facility. The setup consists of a highly segmented BGO calorimeter surrounding the target, with a particle tracking magnetic spectrometer at forward angles. BGO-OD is ideal for investigating meson photoproduction. The extensive physics programme for open strangeness photoproduction is introduced, and preliminary analysis presented.

  8. Inhibited Aluminization of an ODS FeCr Alloy

    SciTech Connect

    Vande Put Ep Rouaix, Aurelie; Pint, Bruce A

    2012-01-01

    Aluminide coatings are of interest for fusion energy applications both for compatibility with liquid Pb-Li and to form an alumina layer that acts as a tritium permeation barrier. Oxide dispersion strengthened (ODS) ferritic steels are a structural material candidate for commercial reactor concepts expected to operate above 600 C. Aluminizing was conducted in a laboratory scale chemical vapor deposition reactor using accepted conditions for coating Fe- and Ni-base alloys. However, the measured mass gains on the current batch of ODS Fe-14Cr were extremely low compared to other conventional and ODS alloys. After aluminizing at two different Al activities at 900 C and at 1100 C, characterization showed that the ODS Fe-14Cr specimens formed a dense, primarily AlN layer that prevented Al uptake. This alloy batch contained a higher (> 5000 ppma) N content than the other alloys coated and this is the most likely reason for the inhibited aluminization. Other factors such as the high O content, small ({approx} 140 nm) grain size and Y-Ti oxide nano-clusters in ODS Fe-14Cr also could have contributed to the observed behavior. Examples of typical aluminide coatings formed on conventional and ODS Fe- and Ni-base alloys are shown for comparison.

  9. The Optical Depth Sensor (ODS) for Mars atmosphere

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2013-09-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in the martian atmosphere. The principal goal of ODS is to carry out the opacity due to the Martian dust as well as to characterize the high altitude clouds at twilight, crucial parameters in understanding of Martian meteorology. The instrument was initially designed for the failed MARS96 Russian mission, and also was included in the payload of several other missions [1]. Until recently, it was selected (NASA/ESA AO) in the payload of the atmospheric package DREAMS onboard the MARS 2016 mission. But following a decision of the CNES, it is no more included in the payload. In order to study the performance of ODS under a wide range of conditions as well as its capable to provide daily measurements of both dust optical thickness and high altitude clouds, the instrument has participated in different terrestrial campaigns. A good performance of ODS prototype (Figure 1) on cirrus clouds detection and in dust opacity estimation was previously archived in Africa during 2004-2005 and in Brasil from 2012 to nowadays. Moreover, a campaign in the arctic is expected before 2016 where fifteen ODSs will be part of an integrated observing system over the Arctic Ocean, allowing test the ODS performance in extreme conditions. In this presentation we present main principle of the retrieval, the instrumental concept, the result of the tests performed and the principal objectives of ODS in Mars.

  10. The Optical Depth Sensor (ODS) for Mars atmosphere

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2015-10-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in both Martian and Earth environments. The principal goal of ODS is to carry out the opacity due to the Martian dust as well as to characterize the high altitude clouds at twilight, crucial parameters in understanding of Martian meteorology. The instrument was initially designed for the failed MARS96 Russian mission, and also was included in the payload of several other missions [1]. Until recently, it was selected (NASA/ESA AO) in the payload of the atmospheric package DREAMS onboard the MARS 2016 mission. But following a decision of the CNES, it is no more included in the payload. In order to study the performance of ODS under a wide range of conditions as well as its capable to provide daily measurements of both dust optical thickness and high altitude clouds properties, the instrument has participated in different terrestrial campaigns. A good performance of ODS prototype (Figure 1) on cirrus clouds detection and in dust opacity estimation was previously archived in Africa during 2004-2005 and in Brasil from 2012 to nowadays. Moreover, a campaign in the arctic is expected before 2016 where fifteen ODSs will be part of an integrated observing system over the Arctic Ocean, allowing test the ODS performance in extreme conditions. In this presentation we present main principle of the retrieval, the instrumental concept, the result of the tests performed and the principal objectives of ODS in Mars.

  11. High yttria ferritic ODS steels through powder forging

    NASA Astrophysics Data System (ADS)

    Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

    2017-05-01

    Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y2O3 (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility.

  12. Machinery alignment tables: Face-OD and reverse indicator methods

    SciTech Connect

    Buck, G.S.

    1984-01-01

    Many alignment techniques are too complex for practical use, and guessing never provides the needed precision. The face-OD (face-rim) and reverse indicator methods are the two most popular techniques experienced millwrights use, but both methods require time-consuming calculations. These tables replace the graphs, formulas, and calculations used to determine shim requirements. Contents: Face-OD method and reverse indicator method: Setting up Data forms. Equations and calculations. Examples. Alignment Tolerances. Errors in taking data. Typical alignment tolerances. Indicator sag. Cause of indicator sag. Correction of indicator sag. Typical values of indicator sag. Hot alignment. References.

  13. DISTANT VIEW OF EXTERIOR OD UPPER (NORTHERN) LOCK GATES, WITH ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    DISTANT VIEW OF EXTERIOR OD UPPER (NORTHERN) LOCK GATES, WITH TIMBER GUIDE WALL AND CONTROL HOUSE ON RIGHT AND TIMBER PYLONS AND LEVEE ON LEFT, BAFFLES ARE IN FRONT OF GATES FOR THE DRAINING OF THE LOCK, VIEW TOWARDS SOUTH - Moore Haven Lock, Hurricane Gate No. 1, Cross-State Canal, Okeechobee Intracoastal Waterway, Moore Haven, Glades County, FL

  14. 46 CFR 280.4 - Standards governing payment of ODS.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... each service if, during the calendar year, at least 50 percent of the inbound and 50 percent of the outbound gross freight revenues earned on voyages terminated during the calendar year, for each service.... The amount of ODS payable for the inbound leg of a service for the calendar year shall be reduced...

  15. Development of ODS-Fe{sub 3}Al alloys

    SciTech Connect

    Wright, I.G.; Pint, B.A.; Tortorelli, P.F.; McKamey, C.G.

    1997-12-01

    The overall goal of this program is to develop an oxide dispersion-strengthened (ODS) version of Fe{sub 3}Al that has sufficient creep strength and resistance to oxidation at temperatures in the range 1000 to 1200 C to be suitable for application as heat exchanger tubing in advanced power generation cycles. The main areas being addressed are: (a) alloy processing to achieve the desired alloy grain size and shape, and (b) optimization of the oxidation behavior to provide increased service life compared to semi-commercial ODS-FeCrAl alloys intended for the same applications. The recent studies have focused on mechanically-alloyed powder from a commercial alloy vendor. These starting alloy powders were very clean in terms of oxygen content compared to ORNL-produced powders, but contained similar levels of carbon picked up during the milling process. The specific environment used in milling the powder appears to exert a considerable influence on the post-consolidation recrystallization behavior of the alloy. A milling environment which produced powder particles having a high surface carbon content resulted in a consolidated alloy which readily recrystallized, whereas powder with a low surface carbon level after milling resulted in no recrystallization even at 1380 C. A feature of these alloys was the appearance of voids or porosity after the recrystallization anneal, as had been found with ORNL-produced alloys. Adjustment of the recrystallization parameters did not reveal any range of conditions where recrystallization could be accomplished without the formation of voids. Initial creep tests of specimens of the recrystallized alloys indicated a significant increase in creep strength compared to cast or wrought Fe{sub 3}Al, but the specimens failed prematurely by a mechanism that involved brittle fracture of one of the two grains in the test cross section, followed by ductile fracture of the remaining grain. The reasons for this behavior are not yet understood. The

  16. Mechanical testing of anisotropy in ODS steel tubes

    NASA Astrophysics Data System (ADS)

    Špirit, Z.; Chocholoušek, M.; Šíma, M.

    2017-02-01

    Anisotropy of fuel claddings made from Fe-9Cr and Fe-14Cr ODS (oxide dispersion-strengthened) steel for Generation IV reactors with coolants based on liquid metals was examined. Basic mechanical tests were performed at temperatures of 30 °C, 500 °C and 625 °C on ODS steel thin-walled tubes. Tensile tests were performed in axial and tangential directions in a vacuum to avoid oxidation of the small specimens. A scanning electron microscope with a small in-situ tensile testing device was used to conduct the tests. The result of this paper describes the basic mechanical properties of thin-walled tubes as ultimate tensile strength, yield strength, tensile modulus, etc. depending on the direction of loading.

  17. Casting technology for ODS steels - the internal oxidation approach

    NASA Astrophysics Data System (ADS)

    Miran, S.; Franke, P.; Möslang, A.; Seifert, H. J.

    2017-07-01

    The formation of stainless ODS steel by internal oxidation of as-cast steel has been investigated. An alloy (Fe-16Cr-0.2Al-0.05Y, wt.%) was embedded in a (VO/V2O3) powder mixture serving as an oxygen activity buffer and heat treated at 1450 °C for 20 h. After this procedure no oxide scale was present on the surface of the sample but a zone of internal oxidation with a depth of about 2000 μm was formed in its interior. The precipitates within this zone consisted of two types of oxides. Discrete aluminium oxide particles with a size of a few micrometres were formed in outer regions of the specimen. Finer aluminium-yttrium oxides with a size of some hundred nanometres were mainly precipitated in inner regions of the sample. The results can be considered as a promising step towards an alternative production route for ODS steels.

  18. Residual ferrite formation in 12CrODS steels

    NASA Astrophysics Data System (ADS)

    Ukai, S.; Kudo, Y.; Wu, X.; Oono, N.; Hayashi, S.; Ohtsuka, S.; Kaito, T.

    2014-12-01

    Increasing Cr content from 9 to 12 mass% leads to superior corrosion and high-temperature oxidation resistances, and usually changes microstructure from martensite to a ferrite. To make transformable martensitic type of 12CrODS steels that have superior processing capability by using α/γ phase transformation, alloy design was conducted through varying nickel content. The structure of 12CrODS steels was successfully modified from full ferrite to a transformable martensite-base matrix containing ferrite. This ferrite consists of both equilibrium ferrite and a metastable residual ferrite. It was shown that the fraction of the equilibrium ferrite is predictable by computed phase diagram and formation of the residual ferrite was successfully evaluated through pinning of α/γ interfacial boundaries by oxide particles.

  19. Diffusion bonding a creep-resistant Fe-ODS alloy

    NASA Astrophysics Data System (ADS)

    Bucklow, I. A.

    A method is described for diffusion bonding iron-based alloys in which the grain structure is continuous along the interface. The method is based on oxide-dispersion-strengthened (ODS) alloying for producing fine-grained materials with highly directional strain. Samples of the Fe-based MA956 alloy are rapidly diffusion bonded at about 1200 C and 200-300 MPa with either one or two induction heat treatments, and secondary recrystallization is seeded epitaxially. Sections are etched in glyceregia and studied by means of micrographs, and the diffusion rates of the ferritic alloys are found to be high enough to allow bonding at temperatures below the recrystallization level. Some mechanical damage to the specimens is noted that can lead to suboptimal grain directionality. The present results are of interest to the development of Fe-ODS alloys for turbine applications and for use in sulfurous atmospheres.

  20. Direct frequency comb measurement of OD + CO → DOCO kinetics.

    PubMed

    Bjork, B J; Bui, T Q; Heckl, O H; Changala, P B; Spaun, B; Heu, P; Follman, D; Deutsch, C; Cole, G D; Aspelmeyer, M; Okumura, M; Ye, J

    2016-10-28

    The kinetics of the hydroxyl radical (OH) + carbon monoxide (CO) reaction, which is fundamental to both atmospheric and combustion chemistry, are complex because of the formation of the hydrocarboxyl radical (HOCO) intermediate. Despite extensive studies of this reaction, HOCO has not been observed under thermal reaction conditions. Exploiting the sensitive, broadband, and high-resolution capabilities of time-resolved cavity-enhanced direct frequency comb spectroscopy, we observed deuteroxyl radical (OD) + CO reaction kinetics and detected stabilized trans-DOCO, the deuterated analog of trans-HOCO. By simultaneously measuring the time-dependent concentrations of the trans-DOCO and OD species, we observed unambiguous low-pressure termolecular dependence of the reaction rate coefficients for N2 and CO bath gases. These results confirm the HOCO formation mechanism and quantify its yield.

  1. Evaluation of Oxide Dispersion Strengthened (ODS) Molybdenum Alloys

    DTIC Science & Technology

    1997-01-01

    containing 4 parts concentrated sulfuric acid and 1 part distilled water using a Type 304 stainless steel cathode and a direct current accelerating...Ductile-to-Brittle Transition Temperature ( DBTT ): The following mechanical properties were measured from the ODS molybdenum alloy rods: (a) 0.2...and to determine the DBTT . Elevated Temperature Tensile Tests: Elevated temperature tensile specimens of each as- swaged alloy were equilibrated

  2. Sensitivity enhancement of OD- and OD-CNT-based humidity sensors by high gravity thin film deposition technique

    NASA Astrophysics Data System (ADS)

    Karimov, Kh. S.; Fatima, Noshin; Sulaiman, Khaulah; Mahroof Tahir, M.; Ahmad, Zubair; Mateen, A.

    2015-03-01

    The humidity sensing properties of the thin films of an organic semiconductor material orange dye (OD) and its composite with CNTs deposited at high gravity conditions have been reported. Impedance, phase angle, capacitance and dissipation of the samples were measured at 1 kHz and room temperature conditions. The impedance decreases and capacitance increases with an increase in the humidity level. It was found that the sensitivity of the OD-based thin film samples deposited at high gravity condition is higher than the samples deposited at low gravity condition. The impedances and capacitance sensitivities of the of the samples deposited under high gravity condition are 6.1 times and 1.6 times higher than the films deposited under low gravity condition.

  3. Mechanical properties of oxide dispersion strengthened (ODS) molybdenum alloys

    SciTech Connect

    Bianco, R.; Buckman, R.W. Jr.

    1998-03-01

    Oxide dispersion strengthened molybdenum, Mo-ODS, developed by a proprietary powder metallurgy process, exhibits a creep rupture life at 0.65T{sub m} (1,600 C) of three to five orders of magnitude greater than unalloyed molybdenum, while maintaining ductile fracture behavior at temperatures significantly below room temperature. In comparison, the creep rupture life of the Mo-50Re solid solution strengthened alloy at 1,600 C is only an order of magnitude greater than unalloyed molybdenum. The results of microstructural characterization and thermal stability and mechanical property testing are discussed.

  4. Loss of DNC from ionized 4-hydroxypyridine-OD

    NASA Astrophysics Data System (ADS)

    Jobst, Karl J.; Khan, Tanya R.; Terlouw, Johan K.

    2007-07-01

    Low energy 4-hydroxypyridine ions (HP-1) decarbonylate but also readily lose hydrogen (iso)cyanide. Surprisingly, this reaction leads to a specific loss of the label from the OD-labelled isotopomer. Our tandem mass spectrometry experiments show that ionized vinylketene, CH2CHCHCO+ (1), is the product ion. This ion is also generated by the decarbonylation of 4-cyclopentene-1,3-dione ions (CP-1) and a computational analysis using the CBS-QB3 model chemistry indicates that these seemingly unrelated ionic systems share similar dissociation mechanisms. In this study, a mechanism is presented for the decarbonylation of metastable ions CP-1 that satisfies the energy requirement dictated by its appearance energy. Our computational analysis further shows that ions HP-1 may isomerize into the (iso)imino analogues of CP-1, by consecutive H-shift, ring-opening and cyclization steps. The CP-1 analogues serve as the immediate precursors for the specific loss of DNC (rather than DCN) from OD-labelled HP-1 and also its decarbonylation into the vinyl(iso)ketenimine ions CH2CHCHNCH+ (3) and CH2CHCHCNH+ (4).

  5. Precipitates and boundaries interaction in ferritic ODS steels

    NASA Astrophysics Data System (ADS)

    Sallez, Nicolas; Hatzoglou, Constantinos; Delabrouille, Fredéric; Sornin, Denis; Chaffron, Laurent; Blat-Yrieix, Martine; Radiguet, Bertrand; Pareige, Philippe; Donnadieu, Patricia; Bréchet, Yves

    2016-04-01

    In the course of a recrystallization study of Oxide Dispersion Strengthened (ODS) ferritic steels during extrusion, particular interest was paid to the (GB) Grain Boundaries interaction with precipitates. Complementary and corresponding characterization experiments using Transmission Electron Microscopy (TEM), Energy Dispersive X-ray spectroscopy (EDX) and Atom Probe Tomography (APT) have been carried out on a voluntarily interrupted extrusion or extruded samples. Microscopic observations of Precipitate Free Zones (PFZ) and precipitates alignments suggest precipitate interaction with migrating GB involving dissolution and Oswald ripening of the precipitates. This is consistent with the local chemical information gathered by EDX and APT. This original mechanism for ODS steels is similar to what had been proposed in the late 80s for similar observation made on Ti alloys reinforced by nanosized yttrium oxides: An interaction mechanism between grain boundaries and precipitates involving a diffusion controlled process of precipitates dissolution at grain boundaries. It is believed that this mechanism can be of primary importance to explain the mechanical behaviour of such steels.

  6. ODS Characterization Progress Report 06/27/08

    SciTech Connect

    El-Dasher, B

    2008-11-25

    This progress report is intended to help keep track of the work that has been performed in characterizing ODS steels for the LIFE project. This specific report details the current status of the characterization of a 24% Cr, 1% Y{sub 2}O{sub 3} ODS steel obtained from Wayne King via Geoff Campbell. Since no pedigree of the material could be obtained, a baseline characterization was necessary prior to studying processing, welding, and corrosion behavior. This document details the results obtained from analysis performed using scanning electron microscopy (SEM), electron backscatter diffraction (EBSD) and energy dispersive spectroscopy (EDS). At the time of writing, transmission electron microscopy (TEM) and microhardness measurements have not been completed, and will be included in a future report. The results are presented in two sections: microstructure, and phase identification. As the names suggest, the first section will report on the microstructure in the general sense and include details such as grain size and texture, and the second section will include the identification of the phases present in the baseline material.

  7. Microstructure and impact properties of ferritic ODS ODM401 (14%Cr-ODS of MA957 type)

    NASA Astrophysics Data System (ADS)

    Hadraba, Hynek; Kazimierzak, Bohumil; Stratil, Ludek; Dlouhy, Ivo

    2011-10-01

    The oxide dispersion strengthened (ODS) steel ODM401 is one of the ODS steels developed during the 1960-1970s as a structural tubing material for fast breeder reactors, mainly because of their high-temperature strength and swelling resistance under irradiation. Nowadays, these steels are taken under consideration as a structural material for blanket and heat exchanger components in fusion reactors. The aim of the work was to describe fracture behaviour of ODM401 steel in connection to the microstructure. The microstructure of as-extruded ODM401 steel has fine grains elongated in the extrusion direction. The two population of Y-Ti-O particles sizes were found in the microstructure of size about 10-20 nm and 2-3 nm. Temperature dependence of KLST impact energy was measured and transition temperature tDBTT evaluated about -110 °C. The fracture surface was formed by alternated cleavage areas connected by inclined areas fractured by dimple micro mechanism proportional to the impact energy.

  8. Organon OD 14 (tibolone) and menopausal dynamic hormone profiles.

    PubMed

    Abdalla, H I; Hart, D M; Lindsay, R; Beastall, G H

    1986-03-01

    Hormonal profiles were studied in 15 post-menopausal women, 7 of whom had been treated with Organon OD 14 (Tibolone) and 8 with placebo tablets for 3 yr. In the Tibolone-treated group, the sex hormone binding globulin (SHBG) levels were significantly lower, while the estimated free testosterone levels, the testosterone/SHBG ratio and the thyroid-stimulating hormone (TSH) response to thyrotrophin-releasing hormone (TRH) were significantly higher than in the placebo group. Prolactin and triiodothyronine (T3) concentrations were lower in the actively treated group, although the differences were not statistically significant. No significant differences were observed with respect to thyroxine (T4), TSH, basal cortisol or cortisol response to synacthen.

  9. The crystal structure of Sr(OD) 2

    NASA Astrophysics Data System (ADS)

    Partin, D. E.; O'Keeffe, M.

    1995-10-01

    The crystal structure of Sr(OD) 2 has been determined from a Reitveld refinement of time-of-flight neutron diffraction data, and the deuterium atom positions have been determined for the first time. The structure is orthorhombic: Pnma, a = 9.8269(5) Å, b = 3.9051(2) Å, c = 6.0733(3) Å, V = 233.06 Å 3, D x = 3.466 g cm -3, Rwp = 3.93%, Rp = 2.95%, reduced X2 = 4.774 for 81 variables. Although the data were collected at 12 K, the H atoms have large thermal parameters suggesting the possibility of some disorder. Relationships of the structure to the structures of YOOH, SrBr 2, SrI 2, and SrBr 2 · H 2O are discussed.

  10. [Lasers].

    PubMed

    Passeron, T

    2012-11-01

    Lasers are a very effective approach for treating many hyperpigmented lesions. They are the gold standard treatment for actinic lentigos and dermal hypermelanocytosis, such as Ota nevus. Becker nevus, hyperpigmented mosaicisms, and lentigines can also be successfully treated with lasers, but they could be less effective and relapses can be observed. However, lasers cannot be proposed for all types of hyperpigmentation. Thus, freckles and café-au-lait macules should not be treated as the relapses are nearly constant. Due to its complex pathophysiology, melasma has a special place in hyperpigmented dermatoses. Q-switched lasers (using standard parameters or low fluency) should not be used because of consistent relapses and the high risk of post-inflammatory hyperpigmentation. Paradoxically, targeting the vascular component of the melasma lesion with lasers could have a beneficial effect. However, these results have yet to be confirmed. In all cases, a precise diagnosis of the type of hyperpigmentation is mandatory before any laser treatment, and the limits and the potential side effects of the treatment must be clearly explained to patients.

  11. Lasers.

    PubMed

    Passeron, T

    2012-12-01

    Lasers are a very effective approach for treating many hyperpigmented lesions. They are the gold standard treatment for actinic lentigos and dermal hypermelanocytosis, such as Ota nevus. Becker nevus, hyperpigmented mosaicisms, and lentigines can also be successfully treated with lasers, but they could be less effective and relapses can be observed. However, lasers cannot be proposed for all types of hyperpigmentation. Thus, freckles and café-au-lait macules should not be treated as the relapses are nearly constant. Due to its complex pathophysiology, melasma has a special place in hyperpigmented dermatoses. Q-switched lasers (using standard parameters or low fluency) should not be used because of consistent relapses and the high risk of post-inflammatory hyperpigmentation. Paradoxically, targeting the vascular component of the melasma lesion with lasers could have a beneficial effect. However, these results have yet to be confirmed. In all cases, a precise diagnosis of the type of hyperpigmentation is mandatory before any laser treatment, and the limits and the potential side effects of the treatment must be clearly explained to patients.

  12. High Velocity Oxidation and Hot Corrosion Resistance of Some ODS Alloys

    NASA Technical Reports Server (NTRS)

    Lowell, C. E.; Deadmore, D. L.

    1977-01-01

    Several oxide dispersion strengthened (ODS) alloys were tested for cyclic, high velocity, oxidation, and hot corrosion resistance. These results were compared to the resistance of an advanced, NiCrAl coated superalloy. An ODS FeCrAl were identified as having sufficient oxidation and hot corrosion resistance to allow potential use in an aircraft gas turbine without coating.

  13. 46 CFR 280.9 - Special rules for last year of ODS agreement.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ...) of this section, if on a cumulative basis for each quarter of the calendar year: (1) Less than 50... ODS payable for the preceding calendar year as required by paragraph (b) (3) of § 280.4. (b) Amount..., the amount payable on the ODS voucher for the last month of any quarter of the last calendar year...

  14. Ultra-high temperature tensile properties of ODS steel claddings under severe accident conditions

    NASA Astrophysics Data System (ADS)

    Yano, Y.; Tanno, T.; Oka, H.; Ohtsuka, S.; Inoue, T.; Kato, S.; Furukawa, T.; Uwaba, T.; Kaito, T.; Ukai, S.; Oono, N.; Kimura, A.; Hayashi, S.; Torimaru, T.

    2017-04-01

    Ultra-high temperature ring tensile tests were performed to investigate the tensile behavior of oxide dispersion strengthened (ODS) steel claddings and wrapper materials under severe accident conditions with temperatures ranging from room temperature to 1400 °C which is close to the melting point of core materials. The experimental results showed that the tensile strength of 9Cr-ODS steel claddings was highest in the core materials at ultra-high temperatures of 900-1200 °C, but there was significant degradation in the tensile strength of 9Cr-ODS steel claddings above 1200 °C. This degradation was attributed to grain boundary sliding deformation with γ/δ transformation, which is associated with reduced ductility. By contrast, the tensile strength of recrystallized 12Cr-ODS and FeCrAl-ODS steel claddings retained its high value above 1200 °C, unlike the other tested materials.

  15. The BGO Calorimeter of BGO-OD Experiment

    NASA Astrophysics Data System (ADS)

    Bantes, B.; Bayadilov, D.; Beck, R.; Becker, M.; Bella, A.; Bielefeldt, P.; Bieling, J.; Bleckwenn, M.; Böse, S.; Braghieri, A.; Brinkmann, K.-Th; Burdeynyi, D.; Curciarello, F.; De Leo, V.; Di Salvo, R.; Dutz, H.; Elsner, D.; Fantini, A.; Freyermuth, O.; Friedrich, S.; Frommberger, F.; Ganenko, V.; Geffers, D.; Gervino, G.; Ghio, F.; Giardina, G.; Girolami, B.; Glazier, D.; Goertz, S.; Gridnev, A.; Gutz, E.; Hammann, D.; Hannappel, J.; Hartmann, P.-F.; Hillert, W.; Ignatov, A.; Jahn, R.; Joosten, R.; Jude, T. C.; Klein, F.; Koop, K.; Krusche, B.; Lapik, A.; Levi Sandri, P.; Lopatin, I.; Mandaglio, G.; Mei, P.; Messi, F.; Messi, R.; Metag, V.; Moricciani, D.; Nanova, M.; Nedorezov, V.; Novinskiy, D.; Pedroni, P.; Romaniuk, M.; Rostomyan, T.; Rudnev, N.; Schaerf, C.; Scheluchin, G.; Schmieden, H.; Sumachev, V.; Tarakanov, V.; Vegna, V.; Walther, D.; Watts, D.; Zaunick, H.-G.; Zimmermann, T.

    2015-02-01

    The BGO Rugby Ball is a large solid angle electromagnetic calorimeter now installed in the ELSA Facility in Bonn. The BGO is operating in the BGO-OD experiment aiming to study meson photoproduction off proton and neutron induced by a Bremsstrahlung polarized gamma beam of energies from 0.2 to 3.2 GeV and an intensity of 5 × 107 photons per second. The scintillating material characteristics and the photomultiplier read-out make this detector particularly suited for the detection of medium energy photons and electrons with very good energy resolution. The detector has been equipped with a new electronics read-out system, consisting of 30 sampling ADC Wie-Ne-R modules which perform the off-line reconstruction of the signal start-time allowing for a good timing resolution. Performances in linearity, resolution and time response have been carefully tested at the Beam Test Facility of the INFN National Laboratories in Frascati by using a matrix of 7 BGO crystals coupled to photomultipliers and equipped with the Wie-Ne-R sampling ADCs.

  16. [Enantioseparation behavior of chiral stationary phases AD, AS and OD].

    PubMed

    Li, Liqun; Fan, Jun; Zhang, Jing; Chen, Xiaodong; Wang, Tai; He, Jianfeng; Zhang, Weiguang

    2016-01-01

    Over the past decades, HPLC enantioseparation with chiral stationary phases (CSPs) has been widely applied in chiral analysis and preparation of new pharmaceuticals, pesticides, food, etc. Herein, enantioseparation of 20 chiral compounds have been carried out on three polysaccharide-based CSPs (EnantioPak AD, AS and OD) with normal phases by HPLC, separately. The influences of skeletal structure and the kinds of derivative groups on separation behaviors of these CSPs have been studied in detail. As results indicated, except for compound 13, the other compounds were baseline separated on EnantioPak AD, with most of resolution over 2. 0; in addition, better separation for acidic or basic compounds was achieved through adding acidic/basic additives into the mobile phase of hexane-alcohol. For four aromatic alcohols (compounds 13-16), their retention in the EnantioPak AD column showed a weakening tendency with increase of carbon number in side chain group, and the reverse trend of their resolution was observed. Furthermore, EnantioPak AD showed much better separation performance for eight compounds (13-20) than the others. In short, these results have provided some references for further investigation of separation behavior and applications of polysaccharide-based CSPs.

  17. Behavior of Fe-ODS Alloys After Thermal Aging Treatments

    NASA Astrophysics Data System (ADS)

    Serrano Garcia, Marta; Hernández-Mayoral, Mercedes; Esparraguera, Elvira Oñorbe

    2016-06-01

    Oxide dispersion alloys are one of the candidates as cladding materials for Gen IV fast reactors, due to their high strength at high temperature, good creep properties, and swelling resistance. This good performance is mainly due to a fine dispersion of nano-oxide particles on the microstructure and to non-grained structure. The microstructural stability and the mechanical properties of a Fe-ODS alloy are studied after different thermal aging experiments at 973 K (700 °C), 5000 hours; 973 K (700 °C), 10,000 hours; and 1123 K (850 °C), 10,000 hours. SEM/EBSD and TEM together with tensile and impact tests on the as-received and thermally aged material have been carried out. In general, for all the tested conditions, a slight softening effect is observed attributed to the changes in the grain structure as well as to the changes in the amount and size of nano-oxide particles. In addition, the aged material shows a lower impact USE value while the DBTT is maintained.

  18. Microstructure Evolution of Gas Atomized Iron Based ODS Alloys

    SciTech Connect

    Rieken, J.R.; Anderson, I.E.; Kramer, M.J.; Anderegg, J.W.; Shechtman, D.

    2009-12-01

    In a simplified process to produce precursor powders for oxide dispersion-strength- ened (ODS) alloys, gas-atomization reaction synthesis (GARS) was used to induce a surface oxide layer on molten droplets of three differing erritic stainless steel alloys during break-up and rapid solidification. The chemistry of the surface oxide was identified using auger electron spectroscopy (AES) and scanning electron microscopy (SEM) with energy dispersive spectroscopy (EDS). The precursor iron-base powders were consolidated at 850 C and 1,300 C using hot isostatic pressing (HIPing). Consolidation at the lower temperature resulted in a fully dense microstructure, while preventing substantial prior particle-boundary-oxide dissociation. Microstructural analysis of the alloys consolidated at the higher temperature confirmed a significant reduction in prior-particle-boundary-oxide volume fraction, in comparison with the lower-temperature-consolidated sample. This provided evidence that a high-temperature internal oxygen-exchange reaction occurred between the metastable prior particle-boundary-oxide phase (chromium oxide) and the yttrium contained within each prior particle. This internal oxygen-exchange reaction is shown to result in the formation of yttrium-enriched oxide dispersoids throughout the alloy microstructure. The evolving microstructure was characterized using transmission electron microscopy (TEM) and high-energy X-ray diffraction (HE-XRD).

  19. Microstructure Evolution of Gas Atomized Iron Based ODS Alloys

    SciTech Connect

    Rieken, J.R.; Anderson, I.E.; Kramer, M.J.

    2011-08-09

    In a simplified process to produce precursor powders for oxide dispersion-strengthened (ODS) alloys, gas-atomization reaction synthesis (GARS) was used to induce a surface oxide layer on molten droplets of three differing erritic stainless steel alloys during break-up and rapid solidification. The chemistry of the surface oxide was identified using auger electron spectroscopy (AES) and scanning electron microscopy (SEM) with energy dispersive spectroscopy (EDS). The precursor iron-base powders were consolidated at 850 C and 1,300 C using hot isostatic pressing (HIPing). Consolidation at the lower temperature resulted in a fully dense microstructure, while preventing substantial prior particle-boundary-oxide dissociation. Microstructural analysis of the alloys consolidated at the higher temperature confirmed a significant reduction in prior-particle-boundary-oxide volume fraction, in comparison with the lower-temperature-consolidated sample. This provided evidence that a high-temperature internal oxygen-exchange reaction occurred between the metastable prior particle-boundary-oxide phase (chromium oxide) and the yttrium contained within each prior particle. This internal oxygen-exchange reaction is shown to result in the formation of yttrium-enriched oxide dispersoids throughout the alloy microstructure. The evolving microstructure was characterized using transmission electron microscopy (TEM) and high-energy X-ray diffraction (HE-XRD).

  20. Thermal-induced phase-change ODS and photo-excited bistable state-change DVD-RAM

    NASA Astrophysics Data System (ADS)

    Rong, Ailun; Huang, De-yin; Lu, Yanwu; Zhang, Zhonglin; Shi, Luqing; Wang, Rui

    1996-09-01

    High density and high data rate are two key points in the development of ODS (optical data storage) which has advanced remarkably in recent years. The aim of this contribution is to report on the migration from CD-E to DVD-RAM by changing: 1) the recording media from heat-mode material to photo-mode material, 2) the recording laser from near infrared to green or blue wavelength, and 3) the recording methods from CD- format to sectorial format and from PPM-RLL to PWM-RLL, where PPM and PWM are pulse position modulation and pulse width modulation respectively, of which all have a potential to achieve an ultrafast recording rate-60ps/bit.

  1. Direct Measurement of OD+CO→ cis-DOCO, trans-DOCO, and D+CO_2 Branching Kinetics Using Time-Resolved Frequency Comb Spectroscopy

    NASA Astrophysics Data System (ADS)

    Bjork, Bryce J.; Bui, Thinh Quoc; Changala, Bryan; Spaun, Ben; Iwakuni, Kana; Ye, Jun

    2017-06-01

    The kinetics of the reaction OH+CO→H+CO_2 has attracted experimental and theoretical studies for more than 40 years due to its importance in atmospheric and combustion environments. This reaction proceeds on a rich potential energy landscape, first by forming vibrationally excited HOCO*; subsequently, HOCO* either back reacts to OH+CO, dissociates to H+CO_2, or is stabilized to ground state HOCO by collisions with a third body. Due to the formation of the HOCO intermediate, the rate coefficient displays anomalous temperature and strong pressure dependences. Time-resolved Frequency Comb Spectroscopy (TRFCS) combines a mid-IR mode-locked femtosecond laser, a broadband optical enhancement cavity, and spatially dispersive detection system to simultaneously provide broad spectral bandwidth, high spectral resolution, high absorption sensitivity, and microsecond time resolution. We have applied this powerful technique to identify the deuterated analogues of HOCO isomers, trans-DOCO and cis-DOCO, for the first time in the reaction OD+CO under ambient conditions. By directly monitoring the concentrations of OD (reactant), trans-DOCO, cis-DOCO (intermediates), and CO_2(product), we unambiguously measure all pressure-dependent branching rates of the OD+CO reaction.

  2. Continuation of Studies on Development of ODS Heat Exchanger Tubing

    SciTech Connect

    Lawrence Brown; David Workman; Bimal Kad; Gaylord Smith; Archie Robertson; Ian Wright

    2008-04-15

    The Department of Energy (DOE), National Energy Technology Center (NETL), has initiated a strategic plan for the development of advanced technologies needed to design and build fossil fuel plants with very high efficiency and environmental performance. These plants, referred to as 'Vision 21' and FutureGen programs by DOE, will produce electricity, chemicals, fuels, or a combination of these products, and possibly secondary products such as steam/heat for industrial use. MA956 is a prime candidate material being considered for a high temperature heat exchanger in the 'Vision 21' and FutureGen programs. This material is an oxide dispersion strengthened (ODS) alloy; however, there are some gaps in the data required to commit to the use of these alloys in a full-size plant. To fill the technology gaps for commercial production and use of the material for 'Advanced Power Generation Systems' this project has performed development activity to significant increase in circumferential strength of MA956 as compared to currently available material, investigated bonding technologies for bonding tube-to-tube joints through joining development, and performed tensile, creep and fire-side corrosion tests to validate the use and fabrication processes of MA956 to heat exchanger tubing applications. Development activities within this projected has demonstrated increased circumferential strength of MA956 tubes through flow form processing. Of the six fabrication technologies for bonding tube-to-tube joints, inertia friction welding (IFW) and flash butt welding (FBW) were identified as processes for joining MA956 tubes. Tensile, creep, and fire-side corrosion test data were generated for both base metal and weld joints. The data can be used for design of future systems employing MA956. Based upon the positive development activities, two test probes were designed and fabricated for field exposure testing at 1204 C ({approx}2200 F) flue gas. The probes contained tube portions with FBW

  3. Determination of OB/OD/SF Emission Factors using Unmanned Aerial Systems

    EPA Science Inventory

    Instrumented, unmanned aerial systems (UASs) have been used successfully in eight campaigns since 2010 to determine emission factors from open burning (OB), open detonation (OD), and static firing (SF) demilitarization activities. These systems have sampled directly from the plu...

  4. Microstructural and mechanical property characterization of ingot metallurgy ODS iron aluminide

    SciTech Connect

    Sikka, V.K.; Howell, C.R.; Hall, F.; Valykeo, J.

    1997-12-01

    This paper deals with a novel, lower cost method of producing a oxide dispersion strengthened (ODS) iron-aluminide alloy. A large 250-kg batch of ODS iron-aluminide alloy designated as FAS was produced by Hoskins Manufacturing Company (Hoskins) [Hamburg, Michigan] using the new process. Plate and bar stock of the ODS alloy were the two major products received. Each of the products was characterized for its microstructure, including grain size and uniformity of oxide dispersion. Tensile tests were completed from room temperature to 1100 C. Only 100-h creep tests were completed at 800 and 1000 C. The results of these tests are compared with the commercial ODS alloy designated as MA-956. An assessment of these data is used to develop future plans for additional work and identifying applications.

  5. Effects of mechanical alloying time on microstructure and properties of 9Cr-ODS steels

    NASA Astrophysics Data System (ADS)

    Xie, Rui; Lu, Zheng; Lu, Chenyang; Liu, Chunming

    2014-12-01

    Pre-alloyed powders of oxide dispersion strengthened (ODS) steels were produced by atomization. The atomized powders without mechanical alloying (MA) and with short-time MA were consolidated by hot isostatic pressing (HIP). The morphology and microstructure of the atomized and the MA powders were studied by scanning electron microscopy (SEM) and X-ray diffraction (XRD). The microstructure of 9Cr-ODS steels with different MA time was characterized by high-resolution transmission electron microscopy (HRTEM), electron backscatter diffraction (EBSD) and atom probe tomography (APT). The results showed that high-density of nanosized precipitates and ultrafine grains are formed in the ODS steels using the processing route, which remarkably reduce MA time. The yield strength and ultimate tensile strength of ODS steels are improved with the increase of MA time.

  6. Detection of OD towards the low-mass protostar IRAS 16293-2422

    NASA Astrophysics Data System (ADS)

    Parise, B.; Du, F.; Liu, F.-C.; Belloche, A.; Wiesemeyer, H.; Güsten, R.; Menten, K. M.; Hübers, H.-W.; Klein, B.

    2012-06-01

    Context. Although water is an essential and widespread molecule in star-forming regions, its chemical formation pathways are still not very well constrained. Observing the level of deuterium fractionation of OH, a radical involved in the water chemical network, is a promising way to infer its chemical origin. Aims: We aim at understanding the formation mechanisms of water by investigating the origin of its deuterium fractionation. This can be achieved by observing the abundance of OD towards the low-mass protostar IRAS 16293-2422, where the HDO distribution is already known. Methods: Using the GREAT receiver on board SOFIA, we observed the ground-state OD transition at 1391.5 GHz towards the low-mass protostar IRAS 16293-2422. We also present the detection of the HDO 111-000 line using the APEX telescope. We compare the OD/HDO abundance ratio inferred from these observations with the predictions of chemical models. Results: The OD line is detected in absorption towards the source continuum. This is the first detection of OD outside the solar system. The SOFIA observation, coupled to the observation of the HDO 111-000 line, provides an estimate of the abundance ratio OD/HDO ~ 17-90 in the gas where the absorption takes place. This value is fairly high compared with model predictions. This may be reconciled if reprocessing in the gas by means of the dissociative recombination of H2DO+ further fractionates OH with respect to water. Conclusions: The present observation demonstrates the capability of the SOFIA/GREAT instrument to detect the ground transition of OD towards star-forming regions in a frequency range that was not accessible before. Dissociative recombination of H2DO+ may play an important role in setting a high OD abundance. Measuring the branching ratios of this reaction in the laboratory will be of great value for chemical models. Figure 5 is available in electronic form at http://www.aanda.org

  7. [Study on the correlation between PMI and OD changes in rat's plasma].

    PubMed

    Li, Wei; Ke, Yong; He, Guang-she; Xu, Yong-cheng; Wang, Zhen-yuan

    2008-12-01

    We chose the UV-Vis spectrophotometry as a new way to investigate the postmortem interval (PMI). One hundred fifty Sprague-Dawley female rats (weight 260 g +/- 10 g, from Xi'an Jiaotong University Animal Center) were chosen and sacrificed by cervical dislocation. The bodies were kept in a controlled environmental chamber set at (20 +/- 2) degrees C. The plasma was harvested in course of 0 to 24 hours after death. The optical density (OD) at different wavelengths was measured with an UV-Vis spectrophotometer (type-UV250). It was shown that the OD changes of plasma at 577, 416 and 275 nm in 24 hours were dramatically related to PMI, and the R-indexes were 0.969, 0.97 and 0.898. The regression formulae of these indexes were worked out taking OD as independent variable, and PMI as variable. The quadratic equations were: PMI = 231.2270D(plasma at wavelength of 577 nm) - 501.160D(plasma at wavelength of 577 nm)2 - 3.0809(R2 = 0.945), PMI = 31.7426OD(plasma at wavelength of 416 nm) - 9.1847OD(plasma at wavelength of 416 nm)2 - 31837(R2 = 0.94), and PMI = 95.2388OD(plasma at wavelength of 275 nm) - 39.343OD(plama at wavelength of 275 nm)2 - 32.408(R2 = 0.795). It was concluded that the OD changes of rat's plasma are good and potential markers for the estimation of PMI and should be very useful in forensic practice.

  8. Commissioning and initial experimental program of the BGO-OD experiment at ELSA

    NASA Astrophysics Data System (ADS)

    Alef, S.; Bauer, P.; Bayadilov, D.; Beck, R.; Becker, M.; Bella, A.; Bielefeldt, P.; Böse, S.; Braghieri, A.; Brinkmann, K.; Cole, P.; Di Salvo, R.; Dutz, H.; Elsner, D.; Fantini, A.; Freyermuth, O.; Friedrich, S.; Frommberger, F.; Ganenko, V.; Geffers, D.; Gervino, G.; Ghio, F.; Görtz, S.; Gridnev, A.; Gutz, E.; Hammann, D.; Hannappel, J.; Hillert, W.; Ignatov, A.; Jahn, R.; Joosten, R.; Jude, T. C.; Klein, F.; Knaust, J.; Kohl, K.; Koop, K.; Krusche, B.; Lapik, A.; Levi Sandri, P.; Lopatin, I. V.; Mandaglio, G.; Messi, F.; Messi, R.; Metag, V.; Moricciani, D.; Mushkarenkov, A.; Nanova, M.; Nedorezov, V.; Novinskiy, D.; Pedroni, P.; Reitz, B.; Romaniuk, M.; Rostomyan, T.; Rudnev, N.; Schaerf, C.; Scheluchin, G.; Schmieden, H.; Stugelev, A.; Sumachev, V.; Tarakanov, V.; Vegna, V.; Walther, D.; Watts, D.; Zaunick, H.; Zimmermann, T.

    2016-11-01

    BGO-OD is a new meson photoproduction experiment at the ELSA facility of Bonn University. It aims at the investigation of non strange and strange baryon excitations, and is especially designed to be able to detect weekly bound meson-baryon type structures. The setup for the BGO-OD experiment is presented, the characteristics of the photon beam and the detector performances are shown and the initial experimental program is discussed.

  9. Chemical engineering and structural and pharmacological characterization of the α-scorpion toxin OD1.

    PubMed

    Durek, Thomas; Vetter, Irina; Wang, Ching-I Anderson; Motin, Leonid; Knapp, Oliver; Adams, David J; Lewis, Richard J; Alewood, Paul F

    2013-01-01

    Scorpion α-toxins are invaluable pharmacological tools for studying voltage-gated sodium channels, but few structure-function studies have been undertaken due to their challenging synthesis. To address this deficiency, we report a chemical engineering strategy based upon native chemical ligation. The chemical synthesis of α-toxin OD1 was achieved by chemical ligation of three unprotected peptide segments. A high resolution X-ray structure (1.8 Å) of synthetic OD1 showed the typical βαββ α-toxin fold and revealed important conformational differences in the pharmacophore region when compared with other α-toxin structures. Pharmacological analysis of synthetic OD1 revealed potent α-toxin activity (inhibition of fast inactivation) at Nav1.7, as well as Nav1.4 and Nav1.6. In addition, OD1 also produced potent β-toxin activity at Nav1.4 and Nav1.6 (shift of channel activation in the hyperpolarizing direction), indicating that OD1 might interact at more than one site with Nav1.4 and Nav1.6. Investigation of nine OD1 mutants revealed that three residues in the reverse turn contributed significantly to selectivity, with the triple OD1 mutant (D9K, D10P, K11H) being 40-fold more selective for Nav1.7 over Nav1.6, while OD1 K11V was 5-fold more selective for Nav1.6 than Nav1.7. This switch in selectivity highlights the importance of the reverse turn for engineering α-toxins with altered selectivity at Nav subtypes.

  10. The OD interpretation of the crystal structure of kettnerite CaBiOFCO[3

    NASA Astrophysics Data System (ADS)

    Hybler, J.; Durovic, S.

    2009-11-01

    The mineral kettnerite, CaBi(OFCO[3]), has an order-disorder (OD) structure with a quadratic net built up by more than one kind of layer. Two maximum-degree-of-order (MDO) (1O, 2O) and one non-MDO (2Q) polytypes are derived by stacking of regularly alternating polar OD packets instead of layers. The stacking rule allows the existence of out-of-step, twin and upside-down domains.

  11. Development of Oxide Dispersion Strengthened (ODS) Ferritic Steel Through Powder Forging

    NASA Astrophysics Data System (ADS)

    Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

    2017-02-01

    Oxide dispersion strengthened (ODS) ferritic steels are candidates for cladding tubes in fast breeder nuclear reactors. In this study, an 18%Cr ODS ferritic steel was prepared through powder forging route. Elemental powders with a nominal composition of Fe-18Cr-2 W-0.2Ti (composition in wt.%) with 0 and 0.35% yttria were prepared by mechanical alloying in a Simoloyer attritor under argon atmosphere. The alloyed powders were heated in a mild steel can to 1473 K under flowing hydrogen atmosphere. The can was then hot forged. Steps of sealing, degassing and evacuation are eliminated by using powder forging. Heating ODS powder in hydrogen atmosphere ensures good bonding between alloy powders. A dense ODS alloy with an attractive combination of strength and ductility was obtained after re-forging. On testing at 973 K, a loss in ductility was observed in yttria-containing alloy. The strength and ductility increased with increase in strain rate at 973 K. Reasons for this are discussed. The ODS alloy exhibited a recrystallized microstructure which is difficult to achieve by extrusion. No prior particle boundaries were observed after forging. The forged compacts exhibited isotropic mechanical properties. It is suggested that powder forging may offer several advantages over the traditional extrusion/HIP routes for fabrication of ODS alloys.

  12. Development of Oxide Dispersion Strengthened (ODS) Ferritic Steel Through Powder Forging

    NASA Astrophysics Data System (ADS)

    Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

    2017-04-01

    Oxide dispersion strengthened (ODS) ferritic steels are candidates for cladding tubes in fast breeder nuclear reactors. In this study, an 18%Cr ODS ferritic steel was prepared through powder forging route. Elemental powders with a nominal composition of Fe-18Cr-2 W-0.2Ti (composition in wt.%) with 0 and 0.35% yttria were prepared by mechanical alloying in a Simoloyer attritor under argon atmosphere. The alloyed powders were heated in a mild steel can to 1473 K under flowing hydrogen atmosphere. The can was then hot forged. Steps of sealing, degassing and evacuation are eliminated by using powder forging. Heating ODS powder in hydrogen atmosphere ensures good bonding between alloy powders. A dense ODS alloy with an attractive combination of strength and ductility was obtained after re-forging. On testing at 973 K, a loss in ductility was observed in yttria-containing alloy. The strength and ductility increased with increase in strain rate at 973 K. Reasons for this are discussed. The ODS alloy exhibited a recrystallized microstructure which is difficult to achieve by extrusion. No prior particle boundaries were observed after forging. The forged compacts exhibited isotropic mechanical properties. It is suggested that powder forging may offer several advantages over the traditional extrusion/HIP routes for fabrication of ODS alloys.

  13. odNEAT: An Algorithm for Decentralised Online Evolution of Robotic Controllers.

    PubMed

    Silva, Fernando; Urbano, Paulo; Correia, Luís; Christensen, Anders Lyhne

    2015-01-01

    Online evolution gives robots the capacity to learn new tasks and to adapt to changing environmental conditions during task execution. Previous approaches to online evolution of neural controllers are typically limited to the optimisation of weights in networks with a prespecified, fixed topology. In this article, we propose a novel approach to online learning in groups of autonomous robots called odNEAT. odNEAT is a distributed and decentralised neuroevolution algorithm that evolves both weights and network topology. We demonstrate odNEAT in three multirobot tasks: aggregation, integrated navigation and obstacle avoidance, and phototaxis. Results show that odNEAT approximates the performance of rtNEAT, an efficient centralised method, and outperforms IM-(μ + 1), a decentralised neuroevolution algorithm. Compared with rtNEAT and IM-(μ + 1), odNEAT's evolutionary dynamics lead to the synthesis of less complex neural controllers with superior generalisation capabilities. We show that robots executing odNEAT can display a high degree of fault tolerance as they are able to adapt and learn new behaviours in the presence of faults. We conclude with a series of ablation studies to analyse the impact of each algorithmic component on performance.

  14. Optical Depth Sensor (ODS) for the measurement of dust and clouds properties in the Mars atmosphere

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2014-04-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in both Martian and Earth environments. The principal goal of ODS is to carry out the opacity due to the Martian dust as well as to characterize the high altitude clouds at twilight, crucial parameters in understanding of Martian meteorology. The instrument was initially designed for the failed MARS96 Russian mission, and also was included in the payload of several other missions [1]. Until recently, it was selected (NASA/ESA AO) in the payload of the atmospheric package DREAMS onboard the MARS 2016 mission. But following a decision of the CNES, it is no more included in the payload. In order to study the performance of ODS under a wide range of conditions as well as its capable to provide daily measurements of both dust optical thickness and high altitude clouds properties, the instrument has participated in different terrestrial campaigns. A good performance of ODS prototype (Figure 1) on cirrus clouds detection and in dust opacity estimation was previously archived in Africa during 2004-2005 and in Brasil from 2012 to nowadays. Moreover, a campaign in the arctic is expected before 2016 where fifteen ODSs will be part of an integrated observing system over the Arctic Ocean, allowing test the ODS performance in extreme conditions. In this presentation we present main principle of the retrieval, the instrumental concept, the result of the tests performed and the principal objectives of ODS in Mars.

  15. Evaluation of oxide dispersion strengthened (ODS) molybdenum and molybdenum-rhenium Alloys

    SciTech Connect

    Mueller, A.J.; Bianco, R.; Buckman, R.W. Jr.

    1999-10-22

    Oxide dispersion strengthened (ODS) molybdenum alloys being developed for high temperature applications possess excellent high temperature strength and creep resistance. In addition they exhibit a ductile-to-brittle transition temperature (DBIT) in the worked and stress-relieved condition under longitudinal tensile load well below room temperature. However, in the recrystallized condition, the DBTT maybe near or above room temperature, depending on the volume fraction of oxide dispersion and the amount of prior work. Dilute rhenium additions (7 and 14 wt.%) to ODS molybdenum were evaluated to determine their effect on low temperature ductility. The addition of 7 wt.% rhenium to the ODS molybdenum did not significantly enhance the mechanical properties. However, the addition of 14 wt.% rhenium to the ODS molybdenum resulted in a DBTT well below room temperature in both the stress-relieved and recrystallized condition. Additionally, the tensile strength of ODS Mo-14Re is greater than the base ODS molybdenum at 1,000 to 1,250 C.

  16. Utilization of scanning laser ophthalmoscopy in laser-induced bilateral human retinal nerve fiber layer damage

    NASA Astrophysics Data System (ADS)

    Zwick, Harry; Gagliano, Donald A.; Ruiz, S.; Stuck, Bruce E.

    1995-05-01

    In this paper, we describe a military laser accident case where bilateral Q-switched laser exposure resulted in bilateral macular damage with immediate visual acuity loss in one eye (OS) and delayed visual acuity loss in the other exposed eye (OD), where retinal damage appeared more parafoveal. At 6 weeks post exposure, OS had recovered to 20/17 and OD had dropped to 20/100 Snellen activity. Retinal nerve fiber damage was observed in both eyes at this time. Contrast sensitivity measurements made in OS were suppressed across all spatial frequencies, even though Snellen acuity measured in the normal range. More severe high spatial frequency loss in contrast was measured in the right eye as well as low spatial frequency loss. Both OS and OD revealed a parafoveal preferred retinal locus with scanning laser ophthalmoscopy contrast sensitivity measurements, suggesting parafoveal retinal compensatory processes.

  17. Development of Austenitic ODS Strengthened Alloys for Very High Temperature Applications

    SciTech Connect

    Stubbins, James; Heuser, Brent; Robertson, Ian; Sehitoglu, Huseyin; Sofronis, Petros; Gewirth, Andrew

    2015-04-22

    This “Blue Sky” project was directed at exploring the opportunities that would be gained by developing Oxide Dispersion Strengthened (ODS) alloys based on the Fe-Cr-Ni austenitic alloy system. A great deal of research effort has been directed toward ferritic and ferritic/martensitic ODS alloys which has resulted in reasonable advances in alloy properties. Similar gains should be possible with austenitic alloy which would also take advantage of other superior properties of that alloy system. The research effort was aimed at the developing an in-depth understanding of the microstructural-level strengthening effects of ODS particles in austentic alloys. This was accomplished on a variety of alloy compositions with the main focus on 304SS and 316SS compositions. A further goal was to develop an understanding other the role of ODS particles on crack propagation and creep performance. Since these later two properties require bulk alloy material which was not available, this work was carried out on promising austentic alloy systems which could later be enhanced with ODS strengthening. The research relied on a large variety of micro-analytical techniques, many of which were available through various scientific user facilities. Access to these facilities throughout the course of this work was instrumental in gathering complimentary data from various analysis techniques to form a well-rounded picture of the processes which control austenitic ODS alloy performance. Micromechanical testing of the austenitic ODS alloys confirmed their highly superior mechanical properties at elevated temperature from the enhanced strengthening effects. The study analyzed the microstructural mechanisms that provide this enhanced high temperature performance. The findings confirm that the smallest size ODS particles provide the most potent strengthening component. Larger particles and other thermally- driven precipitate structures were less effective contributors and, in some cases, limited

  18. Microstructure of a 14Cr-ODS ferritic steel before and after helium ion implantation

    NASA Astrophysics Data System (ADS)

    Lu, Chenyang; Lu, Zheng; Xie, Rui; Liu, Chunming; Wang, Lumin

    2014-12-01

    A 14Cr-ODS ferritic steel with the nominal compositions of Fe-14Cr-2 W-0.3Ti-0.3Y2O3 (wt.%) was produced by mechanical alloying (MA) and hot isostatic pressing (HIP). Helium ion was implanted into the 14Cr-ODS steel along with Eurofer 97 steel as reference at 400 °C to a fluence of 1 × 1017 He+/cm2. High resolution transmission electron microscopy (HRTEM), high angle annual dark field (HAADF) scanning TEM (STEM) and atom probe tomography (APT) were used to characterize the microstructure of 14Cr-ODS and Eurofer 97 steels before and after helium implantation. High-density Y-Ti-O-rich nanoclusters and Y2Ti2O7 precipitates as well as large Cr-Ti rich oxides were observed in the 14Cr-ODS steel. The average size of Y-Ti-O nanoclusters and Y2Ti2O7 precipitates is 9 nm. After helium implantation, the helium bubbles formed in the 14Cr-ODS steel exhibit the smaller size and the lower volume fraction than that in Eurofer 97 steel, indicating high-density nano-scale precipitates can effectively suppress the coarsening of helium bubbles.

  19. Creep constitutive equation of dual phase 9Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Sakasegawa, Hideo; Ukai, Shigeharu; Tamura, Manabu; Ohtsuka, Satoshi; Tanigawa, Hiroyasu; Ogiwara, Hiroyuki; Kohyama, Akira; Fujiwara, Masayuki

    2008-02-01

    9Cr-ODS (oxide dispersion strengthened) steels developed by JAEA (Japan Atomic Energy Agency) have superior creep properties compared with conventional heat resistant steels. The ODS steels can enormously contribute to practical applications of fast breeder reactors and more attractive fusion reactors. Key issues are developments of material processing procedures for mass production and creep life prediction methods in present R&D. In this study, formulation of creep constitutive equation was performed against the backdrop. The 9Cr-ODS steel displaying an excellent creep property is a dual phase steel. The ODS steel is strengthened by the δ ferrite which has a finer dispersion of oxide particles and shows a higher hardness than the α' martensite. The δ ferrite functions as a reinforcement in the dual phase 9Cr-ODS steel. Its creep behavior is very unique and cannot be interpreted by conventional theories of heat resistant steels. Alternative qualitative model of creep mechanism was formulated at the start of this study using the results of microstructural observations. Based on the alternative creep mechanism model, a novel creep constitutive equation was formulated using the exponential type creep equation extended by a law of mixture.

  20. In situ synchrotron tensile investigations on 14 YWT, MA957, and 9-Cr ODS alloys

    SciTech Connect

    Miao, Yinbin; Mo, Kun; Yun, Di; Lin, Jun-Li; LIu, XIang; Zhao, Huijuan; Hoelzer, D T; Park, Jun-Sang; Almer, Jonathan; Zhang, Guangming; Zhou, Z; Stubbins, James F.

    2016-04-01

    Advanced ODS alloys provide exceptional radiation tolerance and high-temperature mechanical properties when compared to traditional ferritic and ferritic/martensitic 9F/M) steels. Their remarkable properties result from ultrahigh density and ultrafine size of Y-Ti-O nanoclusters within the ferritic matrix. In this work, we applied a high-energy synchrotron radiation X-ray to study the deformation process of three advanced ODS materials including 14YWT, MA957, and 9-Cr ODS steel. Only the relatively large nanoparticles in the 9-Cr ODS were observed in the synchrotron X-ray diffraction. The nanoclusters in both 14YWT and MA957 were invisible in the measurement due to their non-stoichiometric nature. Due to the different sizes of nanoparticles and nanoclusters in the materials, the Orowan looping was considered to be the major strengthening mechanism in the 9-Cr ODS, while the dispersed-barrier-hardening is dominant strengthening mechanism in both 14YWT and MA957, This analysis was inferred from the different build-up rates of dislocation density when plastic deformation was initiated. Finally, the dislocation densities interpreted from the X-ray measurements were successfully modeled using the Bergstrom's dislocation models. (C) 2016 Elsevier B.V. All rights reserved.

  1. Characterization of precipitates in nano structured 14% Cr ODS alloys for fusion application

    NASA Astrophysics Data System (ADS)

    He, P.; Klimenkov, M.; Lindau, R.; Möslang, A.

    2012-09-01

    Oxide dispersion strengthened (ODS) reduced activation ferritic (RAF) steels, have been considered as promising materials for application in fusion power reactors up to about 750 °C. Four ODS RAF steels, with compositions of Fe-13.5Cr-2W-(0-0.2-0.3-0.4)Ti-0.3Y2O3 (in wt.%) were produced by powder metallurgy technique. For the different Ti-contents, the correlation between microstructure and mechanical properties was analyzed by means of scanning electron microscope (SEM) and transmission electron microscope (TEM) equipped with energy- dispersive X-ray spectrometer (EDX) and electron energy loss spectrometer (EELS). A bimodal grain size distribution was observed in all as-hipped Ti-containing ODS alloys. These alloys consisted of coarse grains typical ranging from 1 μm to 8 μm and fine grains well below 1 μm in diameter. The addition of Ti resulted in the formation of spherical Ti oxides rather than Cr oxides owing to the stronger affinity of Ti. The influence of Ti on particle size refinement was striking and the optimum effect was obtained when adding 0.3% Ti. Generally the hardness increased consistently with increasing in Ti content. The ODS alloying with 0.3% Ti exhibit the highest strength due to the optimum refinement of mean ODS particle size.

  2. Status of FeCrAl ODS Irradiations in the High Flux Isotope Reactor

    SciTech Connect

    Field, Kevin G.; Howard, Richard H.

    2016-08-19

    FeCrAl oxide-dispersion strengthened (ODS) alloys are an attractive sub-set alloy class of the more global FeCrAl material class for nuclear applications due to their high-temperature steam oxidation resistance and hypothesized enhanced radiation tolerance. A need currently exists to determine the radiation tolerance of these newly developed alloys. To address this need, a preliminary study was conducted using the High Flux Isotope Reactor (HFIR) to irradiate an early generation FeCrAl ODS alloy, 125YF. Preliminary post-irradiation examination (PIE) on these irradiated specimens have shown good radiation tolerance at elevated temperatures (≥330°C) but possible radiation-induced hardening and embrittlement at irradiations of 200°C to a damage level of 1.9 displacement per atom (dpa). Building on this experience, a new series of irradiations are currently being conceptualized. This irradiation series called the FCAD irradiation program will irradiate the latest generation FeCrAl ODS and FeCr ODS alloys to significantly higher doses. These experiments will provide the necessary information to determine the mechanical performance of irradiated FeCrAl ODS alloys at light water reactor and fast reactor conditions.

  3. Influences of process parameters and microstructure on the fracture mechanisms of ODS steels

    NASA Astrophysics Data System (ADS)

    Rouffié, A. L.; Wident, P.; Ziolek, L.; Delabrouille, F.; Tanguy, B.; Crépin, J.; Pineau, A.; Garat, V.; Fournier, B.

    2013-02-01

    The present work investigates the impact response of three ODS steels containing 9%Cr and 14%Cr. These steels were produced by hot extrusion in the shapes of a rod and a plate. The 9%Cr ODS steel has a quasi-isotropic microstructure and is given as a reference material. In comparison, the 14%Cr ODS steel has a strong morphological and crystallographic texture given by the process route. The impact behaviour is anisotropic and the fracture energies are higher when the material is tested in the longitudinal direction compared to the transverse direction. Moreover, the 14%Cr ODS steel has a better impact behaviour when it is extruded in the shape of a rod rather than in the shape of a plate. This work focuses on the fracture mechanisms involved in the ductile to brittle transition regime and in the brittle regime of these materials. In the case of the 14%Cr ODS steel, the cleavage facets observed at very low temperature are much larger than the actual size of the grains. Packets of grains with less than 15° of internal misorientation were defined as effective grains for cleavage. In the transition range, the texture enhances intergranular delamination on the 14%Cr rod material. The occurrence of delamination consumes a lot of energy and tends to enhance scattering in impact energies.

  4. Reorientational Tunneling and Elastic Dipole Properties of OH^- and OD^- Molecular Defects in Alkali-Fluorides.

    NASA Astrophysics Data System (ADS)

    An, C. P.; Luty, F.

    1997-03-01

    A microscopic model of OH^- and OD^- molecular defects and their reorientational tunneling have been, for the first time, determined in LiF, NaF, and KF hosts, using high-resolution FTIR studies of their stretching-mode absorptions. In all 3 cases, the measured stress-dichroism of integrated intensities yield symmetries and values of their elastic dipoles, which are found to be disk-shaped <111> oriented tensors, aligning their molecular axes parallel to an applied <111> stress with a Curie-law temperature dependence. Analysis of the stretching-band spectral shape allows us to estimate their tunneling splitting Δ and vibrational lifetime τ. This is best detectable in LiF:OH^-, for which the stretching-band consists at 2 ~40K of two overlapping Lorentzian bands, which reflect in their separation and width the large tunneling Δ=1.2cm-1 and very short lifetime τ ≈ 8ps values, respectively. This two-band structur! e disappears under stress-alignment into a single Lorentzian as expected. In contrast to this OH^- behavior, the narrower OD^- stretching-band allows only an upper limit estimate of Δ(OD^-) <= 0.2cm-1, yielding an extremely large isotope ratio for the tunneling splitting Δ(OH^-)/Δ(OD^-) >= 6. This OH^- and OD^- tunneling behavior under LiFarrowNaFarrowKF host variation will also be discussed.

  5. HRTEM Study of the Role of Nanoparticles in ODS Ferritic Steel

    SciTech Connect

    Hsiung, L; Tumey, S; Fluss, M; Serruys, Y; Willaime, F

    2011-08-30

    Structures of nanoparticles and their role in dual-ion irradiated Fe-16Cr-4.5Al-0.3Ti-2W-0.37Y{sub 2}O{sub 3} (K3) ODS ferritic steel produced by mechanical alloying (MA) were studied using high-resolution transmission electron microscopy (HRTEM) techniques. The observation of Y{sub 4}Al{sub 2}O{sub 9} complex-oxide nanoparticles in the ODS steel imply that decomposition of Y{sub 2}O{sub 3} in association with internal oxidation of Al occurred during mechanical alloying. HRTEM observations of crystalline and partially crystalline nanoparticles larger than {approx}2 nm and amorphous cluster-domains smaller than {approx}2 nm provide an insight into the formation mechanism of nanoparticles/clusters in MA/ODS steels, which we believe involves solid-state amorphization and re-crystallization. The role of nanoparticles/clusters in suppressing radiation-induced swelling is revealed through TEM examinations of cavity distributions in (Fe + He) dual-ion irradiated K3-ODS steel. HRTEM observations of helium-filled cavities (helium bubbles) preferably trapped at nanoparticle/clusters in dual-ion irradiated K3-ODS are presented.

  6. Effect of irradiation temperature on microstructure of ferritic-martensitic ODS steel

    NASA Astrophysics Data System (ADS)

    Klimenkov, M.; Lindau, R.; Jäntsch, U.; Möslang, A.

    2017-09-01

    The EUROFER-ODS alloy with 0.5% Y2O3 was neutron irradiated with doses up to 16.2 dpa at 250 °C, 350 °C and 450 °C. The radiation induced changes in the microstructure (e.g. dislocation loops and voids) were investigated using transmission electron microscopy (TEM). The number density of radiation induced defects was found to be significantly lower than in EUROFER 97 irradiated at the same conditions. It was found that the appearance and extent of radiation damage strongly depend not only on the irradiation temperature but also on the local number density and size distribution of ODS particles. The higher number density of dislocation loops and voids was found in the local areas with low number density of ODS particles. The interstitial loops with Burgers vector of both ½<111> and <100> types were detected by imaging using different diffraction conditions.

  7. OD + CO → D + CO2 branching kinetics probed with time-resolved frequency comb spectroscopy

    NASA Astrophysics Data System (ADS)

    Bui, Thinh Q.; Bjork, Bryce J.; Changala, P. Bryan; Heckl, Oliver H.; Spaun, Ben; Ye, Jun

    2017-09-01

    Time-resolved direct frequency comb spectroscopy was used to study the kinetics of the OD + CO → D + CO2 reaction, which is important for atmospheric and combustion chemistry. Complementing our recent work on quantifying the formation rate of the trans-DOCO radical, we report measurements of the kinetics of the chemically activated product channel, D + CO2, at room temperature. Simultaneous measurements of the time-dependence of OD and CO2 concentrations directly yield the products' formation rate and its dependence on pressure and bath gas. Together with the trans-DOCO formation rate, these new measurements provide absolute yields of branching channels for both products of OD + CO in the low-pressure limit.

  8. Research on Methods of Processing Transit IC Card Information and Constructing Transit OD Matrix

    NASA Astrophysics Data System (ADS)

    Han, Xiuhua; Li, Jin; Peng, Han

    Transit OD matrix is of vital importance when planning urban transit system. Traditional transit OD matrix constructing method needs a large range of spot check survey. It is expensive and needs long cycle time to process information. Recently transit IC card charging systems have been widely applied in big cities. Being processed reasonably, transit passenger information stored in IC card database can turn into information resource. It will reduce survey cost a lot. The concept of transit trip chain is put forward in this paper. According to the characteristics of closed transit trip chain, it discusses how to process IC card information and construct transit OD matrix. It also points out that urban transit information platform and data warehouse should be constructed, and how to integrate IC card information.

  9. Structure and mechanical properties of Fe-Ni-Zr oxide-dispersion-strengthened (ODS) alloys

    NASA Astrophysics Data System (ADS)

    Darling, K. A.; Kapoor, M.; Kotan, H.; Hornbuckle, B. C.; Walck, S. D.; Thompson, G. B.; Tschopp, M. A.; Kecskes, L. J.

    2015-12-01

    A series of bulk nanostructured Fe-Ni-Zr oxide-dispersion-strengthened (ODS) alloys were synthesized using high energy mechanical alloying and consolidated using high temperature equal channel angular extrusion. The resultant microstructures are composed of nano/ultrafine or micrometer-sized grains with larger intermetallic precipitates and small Zr oxide clusters (<10 nm diameter, measured and confirmed by atom probe tomography). The ODS alloys possess elevated compression properties, e.g., 1.2 and 2.4 GPa compressive yield stress at room temperature for samples consolidated at 700 °C and 1000 °C, respectively. This work highlights the relationship between processing, microstructure, and properties for this class of ferritic ODS alloys.

  10. Structure of Oxide Nanoparticles in Fe-16Cr MA/ODS Ferritic Steel

    SciTech Connect

    Hsiung, L; Fluss, M; Kimura, A

    2010-04-06

    Oxide nanoparticles in Fe-16Cr ODS ferritic steel fabricated by mechanical alloying (MA) method have been examined using high-resolution transmission electron microscopy (HRTEM) techniques. A partial crystallization of oxide nanoparticles was frequently observed in as-fabricated ODS steel. The crystal structure of crystalline oxide particles is identified to be mainly Y{sub 4}Al{sub 2}O{sub 9} (YAM) with a monoclinic structure. Large nanoparticles with a diameter larger than 20 nm tend to be incoherent and have a nearly spherical shape, whereas small nanoparticles with a diameter smaller than 10 nm tend to be coherent or semi-coherent and have faceted boundaries. The oxide nanoparticles become fully crystallized after prolonged annealing at 900 C. These results lead us to propose a three-stage formation mechanism of oxide nanoparticles in MA/ODS steels.

  11. Investigation of microstructure changes in ODS-EUROFER after hydrogen loading

    NASA Astrophysics Data System (ADS)

    Emelyanova, O. V.; Ganchenkova, M. G.; Malitskii, E.; Yagodzinskyy, Y. N.; Klimenkov, M.; Borodin, V. A.; Vladimirov, P. V.; Lindau, R.; Möslang, A.; Hänninen, H.

    2016-01-01

    The effect of hydrogen on the microstructure of mechanically tested ODS-EUROFER steel was investigated by means of transmission electron microscopy, thermal desorption spectroscopy, and atomistic simulations. The presence of yttrium oxide particles notably increases hydrogen uptake in ODS-EUROFER steel as compared to ODS-free EUROFER 97. Under tensile loading, hydrogen accumulation promotes the loss of cohesion at the oxide particle interfaces. First-principles molecular dynamics simulations indicate that hydrogen can be trapped at nanoparticle/matrix interface, creating OH-groups. The accumulation of hydrogen atoms at the oxide particle surface can be the reason for the observed hydrogen-induced oxide/matrix interface weakening and de-cohesion under the action of external tensile stress.

  12. Optimization of High Temperature Hoop Creep Response in ODS-Fe3Al Tubes

    SciTech Connect

    Kad, B.K.; Heatherington, J.H.; McKamey, C.; Wright, I.; Sikka, V.; Judkins, R.

    2003-04-22

    Oxide dispersion strengthened (ODS) Fe3Al alloys are currently being developed for heat-exchanger tubes for eventual use at operating temperatures of up to 1100 C in the power generation industry. The development challenges include (a) efforts to produce thin walled ODS-Fe3Al tubes, employing powder extrusion methodologies, with (b) adequate increased strength for service at operating temperatures to (c) mitigate creep failures by enhancing the as-processed grain size. A detailed and comprehensive research and development methodology is prescribed to produce ODS-Fe3Al thin walled tubes. Current single step extrusion consolidation methodologies typically yield 8ft. lengths of 1-3/8 inch diameter, 1/8 inch wall thickness ODS-Fe3Al tubes. The process parameters for such consolidation methodologies have been prescribed and evaluated as being routinely reproducible. Recrystallization treatments at 1200 C produce elongated grains (with their long axis parallel to the extrusion axis), typically 200-2000 {micro}m in diameter, and several millimeters long. The dispersion distribution is unaltered on a micro scale by recrystallization, but the high aspect ratio grain shape typically obtained limits grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloys requires an understanding and manipulating the factors that control grain alignment and recrystallization behavior. Current efforts are focused on examining the processing dependent longitudinal vs. transverse creep anisotropy, and exploring post-extrusion methods to improve hoop creep response in ODS-Fe3Al alloy tubes. In this report we examine the mechanisms of hoop creep failure and describe our efforts to improve creep performance via variations in thermal-mechanical treatments.

  13. Effect of displacement damage on the stability of oxide nanoparticles in model ODS alloys: TEM studies

    SciTech Connect

    Santra, Sumita; Balaji, S.; Panigrahi, B. K.; Serruys, Yves; Robertson, C.; Ana, Alamo; Sundar, C. S.

    2012-06-05

    Model ODS alloy containing Fe-0.3% yttria was prepared by ball milling and hipping at high temperature and the effect of irradiation on stability of yttria nanoclusters in model ODS alloy is studied by dual beam ion irradiation using 5 MeV Fe{sup +} and 1.5 MeV He{sup +} ions. TEM studies on irradiated sample show that these particles are stable at 25 dpa and 40 appm He concentration. However, at 80 dpa and 360 appm He concentration Yttria particles were found to be unstable as evidenced from increase in average particle size and particle size distribution.

  14. Initial Development in Joining of ODS Alloys Using Friction Stir Welding

    SciTech Connect

    Ren, Weiju; Feng, Zhili

    2007-08-01

    Solid-state welding of oxide-dispersion-strengthened (ODS) alloy MA956 sheets using friction stir welding (FSW) was investigated. Butt weld was successfully produced. The weld and base metals were characterized using optical microscopy, scanning electronic microscopy, transmission electronic microscopy, and energy dispersion x-ray spectrum. Microhardness mapping was also conducted over the weld region. Analyses indicate that the distribution of the strengthening oxides was preserved in the weld. Decrease in microhardness of the weld was observed but was insignificant. The preliminary results seem to confirm the envisioned feasibility of FSW application to ODS alloy joining. For application to Gen IV nuclear reactor heat exchanger, further investigation is suggested.

  15. The photodissociation lifetimes of the OH and OD radicals in comets

    NASA Technical Reports Server (NTRS)

    Singh, P. D.; Van Dishoeck, E. F.; Dalgarno, A.

    1983-01-01

    The photodissociation rates of OH and OD molecules due to absorption of solar radiation in the X(2)Pi-A(2)Sigma(+) electronic transition are calculated to lie between 3.5 and 6.7 x 10 to the -6th/sec for OH for heliocentric velocities between -60 and +60 km/sec and at about 4.7 x 10 to the -7th/sec for OD at 1 AU from the sun. The corresponding lifetimes, which are upper bounds to the actual lifetimes, are generally consistent with the observational cometary data.

  16. Radiation Stability of Nanoclusters in Nano-structured Oxide Dispersion Strengthened (ODS) Steels

    SciTech Connect

    Certain, Alicia G.; Kuchibhatla, Satyanarayana V N T; Shutthanandan, V.; Hoelzer, D. T.; Allen, T. R.

    2013-03-01

    Nanostructured oxide dispersion strengthened (ODS) steels are considered candidates for nuclear fission and fusion applications at high temperature and dose. The complex oxide nanoclusters in these alloys provide high-temperature strength and are expected to afford better radiation resistance. Proton, heavy ion, and neutron irradiations have been performed to evaluate cluster stability in 14YWT and 9CrODS steel under a range of irradiation conditions. Energy-filtered transmission electron microscopy and atom probe tomography were used in this work to analyze the evolution of the oxide population.

  17. Effect of displacement damage on the stability of oxide nanoparticles in model ODS alloys: TEM studies

    NASA Astrophysics Data System (ADS)

    Santra, Sumita; Balaji, S.; Panigrahi, B. K.; Serruys, Yves; Robertson, C.; Ana, Alamo; Sundar, C. S.

    2012-06-01

    Model ODS alloy containing Fe-0.3% yttria was prepared by ball milling and hipping at high temperature and the effect of irradiation on stability of yttria nanoclusters in model ODS alloy is studied by dual beam ion irradiation using 5 MeV Fe+ and 1.5 MeV He+ ions. TEM studies on irradiated sample show that these particles are stable at 25 dpa and 40 appm He concentration. However, at 80 dpa and 360 appm He concentration Yttria particles were found to be unstable as evidenced from increase in average particle size and particle size distribution.

  18. Irradiation effects in oxide dispersion strengthened (ODS) Ni-base alloys for Gen. IV nuclear reactors

    NASA Astrophysics Data System (ADS)

    Oono, Naoko; Ukai, Shigeharu; Kondo, Sosuke; Hashitomi, Okinobu; Kimura, Akihiko

    2015-10-01

    Oxide particle dispersion strengthened (ODS) Ni-base alloys are irradiated by using simulation technique (Fe/He dual-ion irradiation) to investigate the reliability to Gen. IV high-temperature reactors. The fine oxide particles with less than 10 nm in average size and approximately 8.0 × 1022 m-3 in number density remained after 101 dpa irradiation. The tiny helium bubbles were inside grains, not at grain-boundaries; it is advantageous effect of oxide particles which trap the helium atoms at the particle-matrix interface. Ni-base ODS alloys demonstrated their great ability to overcome He embrittlement.

  19. Development of ODS FeCrAl alloys for accident-tolerant fuel cladding

    SciTech Connect

    Dryepondt, Sebastien N.; Hoelzer, David T.; Pint, Bruce A.; Unocic, Kinga A.

    2015-09-18

    FeCrAl alloys are prime candidates for accident-tolerant fuel cladding due to their excellent oxidation resistance up to 1400 C and good mechanical properties at intermediate temperature. Former commercial oxide dispersion strengthened (ODS) FeCrAl alloys such as PM2000 exhibit significantly better tensile strength than wrought FeCrAl alloys, which would alloy for the fabrication of a very thin (~250 m) ODS FeCrAl cladding and limit the neutronic penalty from the replacement of Zr-based alloys by Fe-based alloys. Several Fe-12-Cr-5Al ODS alloys where therefore fabricated by ball milling FeCrAl powders with Y2O3 and additional oxides such as TiO2 or ZrO2. The new Fe-12Cr-5Al ODS alloys showed excellent tensile strength up to 800 C but limited ductility. Good oxidation resistance in steam at 1200 and 1400 C was observed except for one ODS FeCrAl alloy containing Ti. Rolling trials were conducted at 300, 600 C and 800 C to simulate the fabrication of thin tube cladding and a plate thickness of ~0.6mm was reached before the formation of multiple edge cracks. Hardness measurements at different stages of the rolling process, before and after annealing for 1h at 1000 C, showed that a thinner plate thickness could likely be achieved by using a multi-step approach combining warm rolling and high temperature annealing. Finally, new Fe-10-12Cr-5.5-6Al-Z gas atomized powders have been purchased to fabricate the second generation of low-Cr ODS FeCrAl alloys. The main goals are to assess the effect of O, C, N and Zr contents on the ODS FeCrAl microstructure and mechanical properties, and to optimize the fabrication process to improve the ductility of the 2nd gen ODS FeCrAl while maintaining good mechanical strength and oxidation resistance.

  20. Infrared spectroscopic analysis of OH - and OD - in crystalline Li 2O as a function of chemical treatment

    NASA Astrophysics Data System (ADS)

    Kurasawa, T.; Maroni, V. A.

    1983-11-01

    Infrared spectroscopy has been used to study the chemical form and approximate concentration of OH - and OD - in Li 2O single crystals as a function of chemical treatment. Infrared absorption maxima at (3671±0.5) cm-1and (2711±3.3) cm-1 were observed for OH - and OD -, respectively. The absorption coefficient for OD - was determined to be 4.0±0.4 absorbance units per mol part per million OD - per mm of sample thickness. Vacuum baking of Li 2O crystals reduced the OH - and OD - concentrations to <50 mppm; baking in a low moisture-level D 2 environment at 600 to 800°C appeared to lead to volatilization of LiD from the Li 2O crystals; and baking in D 2 containing ( 350±50) mppm D 2O at 600 to 800°C produced a measurable quantity of LiOD. In all cases, the observed spectra indicated the presence of only one distinguishable form of OH - or OD - in the Li 2O lattice. Because of the close correspondence of the observed absorption maxima to reported values for pure LiOH and LiOD, the most consistent (although not conclusive) interpretation is that the OH - and OD - are present as a separate LiOH or LiOD phase at room temperature. Only limited conclusions can be drawn regarding the chemical state of OH - and OD - during the elevated temperatures exposures. An estimate of the approximate value for the solubility of tritium in Li 2O at 800°C was made using data from D 2/Li 2O isothermal exposure experiments — this value was ⩾ 25 wppm.

  1. Corrosion behavior of ODS steels with several chromium contents in hot nitric acid solutions

    NASA Astrophysics Data System (ADS)

    Tanno, Takashi; Takeuchi, Masayuki; Ohtsuka, Satoshi; Kaito, Takeji

    2017-10-01

    Oxide dispersion strengthened (ODS) steel cladding tubes have been developed for fast reactors. Tempered martensitic ODS steels with 9 and 11 wt% of chromium (9Cr-, 11Cr-ODS steel) are the candidate material in research being carried out at JAEA. In this work, fundamental immersion tests and electrochemical tests of 9 to 12Cr-ODS steels were systematically conducted in various nitric acid solutions at 95 °C. The corrosion rate decreased exponentially with effective solute chromium concentration (Creff) and nitric acid concentration. Addition of vanadium (V) and ruthenium (Ru) also decreased the corrosion rate. The combination of low Creff and dilute nitric acid could not avoid the active mass dissolution during active domain at the beginning of immersion, and the corrosion rate was high. Higher Creff decreased the partial anodic current during the active domain and assisted the passivation of the surface of the steel. Concentrated nitric acid and addition of Ru and V increased partial cathodic current and shifted the corrosion potential to noble side. These effects should have prevented the active mass dissolution and decreased the corrosion rate.

  2. Development of Advanced Ods Ferritic Steels for Fast Reactor Fuel Cladding

    NASA Astrophysics Data System (ADS)

    Ukai, S.; Oono, N.; Ohtsuka, S.; Kaito, T.

    Recent progress of the 9CrODS steel development is presented focusing on their microstructure control to improve sufficient high-temperature strength as well as cladding manufacturing capability. The martensitic 9CrODS steel is primarily candidate cladding materials for the Generation IV fast reactor fuel. They are the attractive composite-like materials consisting of the hard residual ferrite and soft tempered martensite, which are able to be easily controlled by α-γ phase transformation. The residual ferrite containing extremely nanosized oxide particles leads to significantly improved creep rupture strength in 9CrODS cladding. The creep strength stability at extended time of 60,000 h at 700 ºC is ascribed to the stable nanosized oxide particles. It was also reviewed that 9CrODS steel has well irradiation stability and fuel pin irradiation test was conducted up to 12 at% burnup and 51 dpa at the cladding temperature of 700ºC.

  3. Assessment of a new fabrication route for Fe-9Cr-1W ODS cladding tubes

    NASA Astrophysics Data System (ADS)

    Toualbi, L.; Cayron, C.; Olier, P.; Malaplate, J.; Praud, M.; Mathon, M.-H.; Bossu, D.; Rouesne, E.; Montani, A.; Logé, R.; de Carlan, Y.

    2012-09-01

    Oxide Dispersion Strengthened ferritic/martensitic steels are developed as future cladding materials for Generation IV Sodium-Cooled Fast Reactors. ODS alloys are elaborated by powder metallurgy, consolidated by hot extrusion and manufactured into tube cladding using cold rolling process. ODS steels present low ductility and high hardness at room temperature which complicate their manufacturing. Cold working leads to the hardening of the tube which needs to be softened by heat treatment. A new high temperature fabrication route performed on a Fe-9Cr-1W-Ti-Y2O3-ODS martensitic steel has been designed by following the hardness values, the morphological and crystallographic anisotropy and the nano-precipitation size evolution at each step of the fabrication route. Observations show that phase transformation from ferrite (α) to austenite (γ) is crucial to reduce the morphological and the crystallographic anisotropy induced by the manufacturing processes. The high temperature heat treatments permit to make the austenitic grain grow leading to an improvement of the cold workability. Ultimate Tensile Strength values obtained in the hoop direction remain about 315 MPa at 650 °C which is slightly lower compared to other Fe-9Cr ODS tubes but the new microstructure could be more favorable for creep properties.

  4. 46 CFR 280.9 - Special rules for last year of ODS agreement.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Special rules for last year of ODS agreement. 280.9 Section 280.9 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS LIMITATIONS ON THE AWARD AND PAYMENT OF OPERATING-DIFFERENTIAL SUBSIDY FOR LINER OPERATORS § 280.9 Special rules for...

  5. Microstructural characterizations of 14Cr ODS ferritic steels subjected to hot torsion

    NASA Astrophysics Data System (ADS)

    Karch, A.; Sornin, D.; Barcelo, F.; Bosonnet, S.; de Carlan, Y.; Logé, R.

    2015-04-01

    Oxide dispersion strengthened (ODS) steels are very promising materials for nuclear applications. In this paper, the hot working behavior of ODS ferritic steels, consolidated by hot extrusion, is studied through torsion tests. Three ODS steels are produced acting on both the quantity of Ti and Y2O3 added to the matrix (wt% Fe-14Cr-1W), and the density and size of the nanoparticles. A temperature range of 1000-1200 °C and strain rates from 5 ṡ 10-2 to 5 s-1 are considered. The microstructures of deformed samples are examined by Electron Back-Scatter Diffraction and X-ray diffraction techniques. It is observed that hot plastic strain leads to an early damage with nucleation and growth of cavities along grain boundaries. Except for the damage, very few microstructural and textural evolutions are noticed. The three tested ODS steels exhibit almost the same behavior under hot torsion straining, regardless of the precipitation state. Overall, the experimental results are interpreted through a mechanism of strain accommodation at grain boundaries, with low dislocation activity in the bulk of the grains.

  6. Coaching, HRD, and OD: Towards Three "Silo" Fields of Practice or a Single "Unified" Profession?

    ERIC Educational Resources Information Center

    Ellinger, Andrea D.; Hamlin, Robert G.; Beattie, Rona S.

    2008-01-01

    During the past few years, the growth of an emergent "coaching industry" in many countries has resulted in some scholars calling for the development of a "coaching profession." Yet, contemporary HRD and OD professionals conceive of coaching as a necessary area of expertise. This paper reports the results of a qualitative study of different…

  7. Differences in ODS formatting for HTML with Proc Print and Proc Report

    USDA-ARS?s Scientific Manuscript database

    While proc print is a terrific tool for data checking and data summary, proc report is similar to, but more powerful because it can do some basic calculations or statistics and data can be broken more effectively into manageable fields. The ODS procedure can produce HTML files from either procedure...

  8. odò: weed management issues in North American edamame

    USDA-ARS?s Scientific Manuscript database

    Despite the fact that the United States is a global leader in commodity soybean production, most of the vegetable soybean (i.e. edamame or máodò) consumed in North America is imported from Asia. Interest in domestically grown edamame is on the rise among consumers; however, the U.S. vegetable proces...

  9. The optical depth sensor (ODS) for column dust opacity measurements and cloud detection on martian atmosphere

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Foujols, T.

    2016-08-01

    A lightweight and sophisticated optical depth sensor (ODS) able to measure alternatively scattered flux at zenith and the sum of the direct flux and the scattered flux in blue and red has been developed to work in martian environment. The principal goals of ODS are to perform measurements of the daily mean dust opacity and to retrieve the altitude and optical depth of high altitude clouds at twilight, crucial parameters in the understanding of martian meteorology. The retrieval procedure of dust opacity is based on the use of radiative transfer simulations reproducing observed changes in the solar flux during the day as a function of 4 free parameters: dust opacity in blue and red, and effective radius and effective width of dust size distribution. The detection of clouds is undertaken by looking at the time variation of the color index (CI), defined as the ratio between red and blue ODS channels, at twilight. The retrieval of altitude and optical depth of clouds is carried out using a radiative transfer model in spherical geometry to simulate the CI time variation at twilight. Here the different retrieval procedures to analyze ODS signals, as well as the results obtained in different sensitivity analysis are presented and discussed.

  10. Advanced ODS FeCrAl alloys for accident-tolerant fuel cladding

    SciTech Connect

    Dryepondt, Sebastien N; Unocic, Kinga A; Hoelzer, David T; Pint, Bruce A

    2014-09-01

    ODS FeCrAl alloys are being developed with optimum composition and properties for accident tolerant fuel cladding. Two oxide dispersion strengthened (ODS) Fe-15Cr-5Al+Y2O3 alloys were fabricated by ball milling and extrusion of gas atomized metallic powder mixed with Y2O3 powder. To assess the impact of Mo on the alloy mechanical properties, one alloy contained 1%Mo. The hardness and tensile properties of the two alloys were close and higher than the values reported for fine grain PM2000 alloy. This is likely due to the combination of a very fine grain structure and the presence of nano oxide precipitates. The nano oxide dispersion was however not sufficient to prevent grain boundary sliding at 800 C and the creep properties of the alloys were similar or only slightly superior to fine grain PM2000 alloy. Both alloys formed a protective alumina scale at 1200 C in air and steam and the mass gain curves were similar to curves generated with 12Cr-5Al+Y2O3 (+Hf or Zr) ODS alloys fabricated for a different project. To estimate the maximum temperature limit of use for the two alloys in steam, ramp tests at a rate of 5 C/min were carried out in steam. Like other ODS alloys, the two alloys showed a significant increase of the mas gains at T~ 1380 C compared with ~1480 C for wrought alloys of similar composition. The beneficial effect of Yttrium for wrought FeCrAl does not seem effective for most ODS FeCrAl alloys. Characterization of the hardness of annealed specimens revealed that the microstructure of the two alloys was not stable above 1000 C. Concurrent radiation results suggested that Cr levels <15wt% are desirable and the creep and oxidation results from the 12Cr ODS alloys indicate that a lower Cr, high strength ODS alloy with a higher maximum use temperature could be achieved.

  11. The microstructure and mechanical properties of Al-containing 9Cr ODS ferritic alloy

    SciTech Connect

    Zhang, Guangming; Zhou, Zhangjian; Mo, Kun; Wang, Pinghuai; Li, Shaofu; Wang, Man; Liu, Xiang; Gong, Mengqiang; Almer, Jonathan; Stubbins, James F.

    2015-11-05

    In this study, a 9Cr oxide-dispersion strengthened (ODS) alloy with additional corrosion resistant element Al was fabricated by mechanical alloying (MA) and hot pressing (HP) to explore the impact of Al on the microstructure and mechanical property of a 9Cr ODS alloy. It is found that the Al completely dissolved into the FeeCr matrix after milling for 30 h. The minor phases in the Al-containing 9Cr ODS ferritic alloy were investigated by a high-energy X-ray, and were identified to be orthorhombic-YAlO3 (YAP), bcc-Y3Al5O12 (YAG), monoclinic-Al2Y4O9 (YAM), and hexagonal-YAlO3 (YAH). These phases were further confirmed by selected area diffraction pattern (SADP), energy dispersive spectroscopy (EDS), and high resolution transmission electron microscopy (HRTEM). In addition, their volume fractions were also calculated from the integrated intensities. According to the analysis of the particles and their formation sequences, the larger particles (greater than 100 nm) are identified as mainly YAG and Al2O3 particles, while the particles with small size (less than 30 nm) are likely primarily YAM, YAH, and YAP particles. The yielding strength (YS) and ultimate tensile strength (UTS) at RT are 563 MPa and 744 MPa, respectively, while the YS and UTS at 700 C are 245 MPa and 276 MPa, respectively. Although the addition Al in ODS alloys decreases the strength at RT, the values at high temperature are similar to those obtained for 9Cr ODS alloys strengthened by fine YeTieO particles.

  12. Mechanosynthesis of A Ferritic ODS (Oxide Dispersion Strengthened) Steel Containing 14% Chromium and Its Characterization

    NASA Astrophysics Data System (ADS)

    Rivai, A. K.; Dimyati, A.; Adi, W. A.

    2017-05-01

    One of the advanced materials for application at high temperatures which is aggressively developed in the world is ODS (Oxide Dispersion strengthened) steel. ODS ferritic steels are one of the candidate materials for future nuclear reactors in the world (Generation IV reactors) because it is able to be used in the reactor above 600 °C. ODS ferritic steels have also been developed for the interconnect material of SOFC (Solid Oxide Fuel Cell) which will be exposed to about 800 °C of temperature. The steel is strengthened by dispersing homogeneously of oxide particles (ceramic) in nano-meter sized in the matrix of the steel. Synthesis of a ferritic ODS steel by dispersion of nano-particles of yttrium oxide (yttria: Y2O3) as the dispersion particles, and containing high-chromium i.e. 14% has been conducted. Synthesis of the ODS steels was done mechanically (mechanosynthesis) using HEM (High Energy ball Milling) technique for 40 and 100 hours. The resulted samples were characterized using SEM-EDS (Scanning Electron Microscope-Energy Dispersive Spectroscope), and XRD (X-ray diffraction) to analyze the microstructure characteristics. The results showed that the crystal grains of the sample with 100 hours milling time was much smaller than the sample with 40 hours milling time, and some amount of alloy was formed during the milling process even for 40 hours milling time. Furthermore, the structure analysis revealed that some amount of iron atom substituted by a slight amount of chromium atom as a solid solution. The quantitative analysis showed that the phase mostly consisted of FeCr solid-solution with the structure was BCC (body-centered cubic).

  13. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-05-31

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (1) prescribe extrusion consolidation methodologies via detailed

  14. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-03-31

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (1) prescribe extrusion consolidation methodologies via detailed

  15. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2005-02-28

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  16. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-08-31

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  17. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2005-06-27

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  18. CROSS-ROLL FLOW FORMING OF ODS ALLOY HEAT EXCHANGER TUBES FOR HOOP CREEP ENHANCEMENT

    SciTech Connect

    Bimal K. Kad

    2004-11-30

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in cross-rolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (i) prescribe extrusion consolidation methodologies via detailed

  19. A stable, high power optically pumped far infrared laser system

    NASA Technical Reports Server (NTRS)

    Farhoomand, Jam; Pickett, Herbert M.

    1988-01-01

    The generation of 1.25 watts of CW laser power at the 119-micron (2522.8 GHz) methanol line is reported. The maximum frequency fluctuation of the free running laser is less than + or - 100 kHz per hour. This laser has also been tested on numerous other lines ranging from 403.7 GHz (HCOOH) to 5260 GHz (CH3OD) with improved power and stability.

  20. O(D-1) production in ozone photolysis near 310 nm

    NASA Technical Reports Server (NTRS)

    Lin, C.; Demore, W. B.

    1973-01-01

    Relative quantum yields of O(D-1)production, phi, in ozone photolysis from 275 nm to 334 nm were determined in the gas phase at 233 K. The O(D-1) was monitored by means of its reaction with isobutane to form isobutyl alcohol. The light source was a high pressure mercury lamp combined with a monochromator, with a bandwidth of 1.6 nm. The results show a constant phi below 300 nm, which is taken as unity on the basis of previous work. There is a very sharp fall-off in phi which is centered at 308 nm. At 313 nm phi is not greater than 0.1.

  1. Transmission electron microscopy of oxide dispersion strengthened (ODS) molybdenum: effects of irradiation on material microstructure

    SciTech Connect

    Baranwal, R. and Burke, M.G.

    2003-03-03

    Oxide dispersion strengthened (ODS) molybdenum has been characterized using transmission electron microscopy (TEM) to determine the effects of irradiation on material microstructure. This work describes the results-to-date from TEM characterization of unirradiated and irradiated ODS molybdenum. The general microstructure of the unirradiated material consists of fine molybdenum grains (< 5 {micro}m average grain size) with numerous low angle boundaries and isolated dislocation networks. 'Ribbon'-like lanthanum oxides are aligned along the working direction of the product form and are frequently associated with grain boundaries, serving to inhibit grain boundary and dislocation movement. In addition to the 'ribbons', discrete lanthanum oxide particles have also been detected. After irradiation, the material is characterized by the presence of nonuniformly distributed large ({approx} 20 to 100 nm in diameter), multi-faceted voids, while the molybdenum grain size and oxide morphology appear to be unaffected by irradiation.

  2. STS-79 Ku-band antenna, ODS and Spacehab module at PCR

    NASA Technical Reports Server (NTRS)

    1996-01-01

    The orbiter Ku-band antenna looms large in this view of the Space Shuttle Atlantis' payload bay. Visible just past the antenna system -- stowed on the starboard side of the payload bay wall -- is the Orbiter Docking System (ODS), and connected to the ODS via a tunnel is the Spacehab Double Module in the aft area of the payload bay. This photograph was taken from the starboard wing platform on the fifth level of the Payload Changeout Room (PCR) at Launch Pad 39A. Work is under way in the PCR to close Atlantis' payload bay doors for flight. Atlantis currently is being targeted for liftoff on Mission STS-79, the fourth docking of the U.S. Shuttle to the Russian Space Station Mir, around September 12.

  3. The Okavango Dike Swarm (ODS) of Northern Botswana: Was it associated with a failed Rift System?

    NASA Astrophysics Data System (ADS)

    LePera, Alan; Atekwana, Estella; Abdelsalam, Mohamed

    2014-05-01

    Dikes and dike swarms often play a significant role in the initiation and extension of rift zones. The giant ODS in northern Botswana, Africa represents a Jurassic aged (~180Ma) thermo-tectonic event which developed during the initial lithospheric weakening phase of Gondwana. Detailed investigations of the mafic dike swarm over the last four decades have provided insights into its age, shape, orientation, and chemistry but have thus far been limited in addressing the crustal structure below the swarm. Historically, the ODS has been interpreted as a failed rift arm based on its association with the Bouvet Hotspot and geometric relationship with two other prominent dike swarms. More recent studies suggest instead that the ODS was emplaced along a preexisting Precambrian basement fabric. Accordingly, the origin of the swarm still remains a matter of debate. The objectives of this study were: (1) determine the role of crustal heterogeneities on the emplacement of the dikes, (2) determine variations in crustal thickness below the ODS and geographically related Okavango Rift Zone (ORZ), a zone of incipient rifting and (3) determine along-strike variations in Curie Point Depth (CPD) below the swarm. We used high resolution aeromagnetic data and applied mathematical filters to enhance structures associated with the swarm's oblique geometry. Crustal thicknesses were estimated using the radial average power spectrum method, applied to 1.2km spatial resolution gravity data. 3D inversions were used to map the magnetic basement and determine the depth to the base of the swarm. Our results showed: (1) There were no apparent basement structures with the same 110° orientation as the ODS. (2) Crustal thickness below the swarm ranges from 39 to 45km with an average of 42± 3km, comparable with thicknesses derived from the Southern African Seismic Experiment (SASE). In contrast, crustal thickness below the ORZ is 9 to 16km thinner than the surrounding blocks. (3) The magnetic

  4. Terahertz-visible two-photon rotational spectroscopy of cold OD-

    NASA Astrophysics Data System (ADS)

    Lee, Seunghyun; Hauser, Daniel; Lakhmanskaya, Olga; Spieler, Steffen; Endres, Eric S.; Geistlinger, Katharina; Kumar, Sunil S.; Wester, Roland

    2016-03-01

    We present a method to measure rotational transitions of molecular anions in the terahertz domain by sequential two-photon absorption. Ion excitation by bound-bound terahertz absorption is probed by absorption in the visible on a bound-free transition. The visible frequency is tuned to a state-selective photodetachment transition of the excited anions. This provides a terahertz action spectrum for just a few hundred molecular ions. To demonstrate this we measure the two lowest rotational transitions, J =1 ←0 and J =2 ←1 of OD- anions in a cryogenic 22-pole trap. We obtain rotational transition frequencies of 598 596.08(19) MHz for J =1 ←0 and 1 196 791.57(27) MHz for J =2 ←1 of OD-, in good agreement with their only previous measurement. This two-photon scheme opens up terahertz rovibrational spectroscopy for a range of molecular anions, in particular for polyatomic and cluster anions.

  5. Texture evolution in Oxide Dispersion Strengthened (ODS) steel tubes during pilgering process

    NASA Astrophysics Data System (ADS)

    Vakhitova, E.; Sornin, D.; Barcelo, F.; François, M.

    2017-10-01

    Oxide Dispersion Strengthened (ODS) steels are foreseen as fuel cladding material in the coming generation of Sodium Fast Reactors (SFR). Cladding tubes are manufactured by hot extrusion and subsequent cold forming steps. In this study, a 9 wt% Cr ODS steel exhibiting α-γ phase transformation at high temperature is cold formed under industrial conditions with a large section reduction in two pilgering steps. The influence of pilgering process parameters and intermediate heat treatment on the microstructure evolution is studied experimentally using Electron Backscattering Diffraction (EBSD) and X-ray Diffraction (XRD) methods. Pilgered samples show elongated grains and a high texture formation with a preferential orientation along the rolling direction. During the heat treatment, grain morphology is recovered from elongated grains to almost equiaxed ones, while the well-known α-fiber texture presents an unexpected increase in intensity. The remarkable temperature stability of this fiber is attributed to a crystallographic structure memory effect during phase transformations.

  6. Intermolecular potential and rovibrational states of the H2O-D2 complex

    NASA Astrophysics Data System (ADS)

    van der Avoird, Ad; Scribano, Yohann; Faure, Alexandre; Weida, Miles J.; Fair, Joanna R.; Nesbitt, David J.

    2012-05-01

    A five-dimensional intermolecular potential for H2O-D2 was obtained from the full nine-dimensional ab initio potential surface of Valiron et al. [P. Valiron, M. Wernli, A. Faure, L. Wiesenfeld, C. Rist, S. Kedžuch, J. Noga, J. Chem. Phys. 129 (2008) 134306] by averaging over the ground state vibrational wave functions of H2O and D2. On this five-dimensional potential with a well depth De of 232.12 cm-1 we calculated the bound rovibrational levels of H2O-D2 for total angular momentum J = 0-3. The method used to compute the rovibrational levels is similar to a scattering approach—it involves a basis of coupled free rotor wave functions for the hindered internal rotations and the overall rotation of the dimer—while it uses a discrete variable representation of the intermolecular distance coordinate R. The basis was adapted to the permutation symmetry associated with the para/ortho (p/o) nature of both H2O and D2, as well as to inversion symmetry. As expected, the H2O-D2 dimer is more strongly bound than its H2O-H2 isotopologue [cf. A. van der Avoird, D.J. Nesbitt, J. Chem. Phys. 134 (2011) 044314], with dissociation energies D0 of 46.10, 50.59, 67.43, and 73.53 cm-1 for pH2O-oD2, oH2O-oD2, pH2O-pD2, and oH2O-pD2. A rotationally resolved infrared spectrum of H2O-D2 was measured in the frequency region of the H2O bend mode. The ab initio calculated values of the rotational and distortion constants agree well with the values extracted from this spectrum.

  7. Low Cost Process for Manufacture of Oxide Dispersion Strengthened (ODS) Turbine Nozzle Components.

    DTIC Science & Technology

    1979-12-01

    SWTTPROCESS FORJIANUFACTURE OF9OXIDE)ISPERSIONSTRENGTHENED (ODS) O0 TURBINE !IJOZZLE COMPONENTS, -- , General Electric Company Aircraft Engine Group...machining processes for low pressure turbine (LPT) vanes , high pressure turbine (HPT) vanes , and HPT band segments for the F101 engine . The primary intent...for aircraft turbine nozzle components. These processes were shown capable of maintaining required microstructures and properties for the vane and

  8. ODS Ferritic/martensitic alloys for Sodium Fast Reactor fuel pin cladding

    NASA Astrophysics Data System (ADS)

    Dubuisson, Philippe; Carlan, Yann de; Garat, Véronique; Blat, Martine

    2012-09-01

    The development of ODS materials for the cladding for Sodium Fast Reactors is a key issue to achieve the objectives required for the GEN IV reactors. CEA, AREVA and EDF have launched in 2007 an important program to determine the optimal fabrication parameters, and to measure and understand the microstructure and properties before, under and after irradiation of such cladding materials. The aim of this paper is to present the French program and the major results obtained recently at CEA on Fe-9/14/18Cr1WTiY2O3 ferritic/martensitic ODS materials. The first step of the program was to consolidate Fe-9/14/18Cr ODS materials as plates and bars to study the microstructure and the mechanical properties of the new alloys. The second step consists in producing tubes at a geometry representative of the cladding of new Sodium Fast Reactors. The optimization of the fabrication route at the laboratory scale is conducted and different tubes were produced. Their microstructure depends on the martensitic (Fe-9Cr) or ferritic (Fe-14Cr) structure. To join the plug to the tube, the reference process is the welding resistance. A specific approach is developed to model the process and support the development of the welds performed within the "SOPRANO" facility. The development at CEA of Fe-9/14/18Cr new ODS materials for the cladding for GENIV Sodium Fast Reactors is in progress. The first microstructural and mechanical characterizations are very encouraging and the full assessment and qualification of this new alloys and products will pass through the irradiation of specimens, tubes, fuel pins and subassemblies up to high doses.

  9. 2nd Gen FeCrAl ODS Alloy Development For Accident-Tolerant Fuel Cladding

    SciTech Connect

    Dryepondt, Sebastien N.; Massey, Caleb P.; Edmondson, Philip D.

    2016-08-01

    Extensive research at ORNL aims at developing advanced low-Cr high strength FeCrAl alloys for accident tolerant fuel cladding. One task focuses on the fabrication of new low Cr oxide dispersion strengthened (ODS) FeCrAl alloys. The first Fe-12Cr-5Al+Y2O3 (+ ZrO2 or TiO2) ODS alloys exhibited excellent tensile strength up to 800 C and good oxidation resistance in steam up to 1400 C, but very limited plastic deformation at temperature ranging from room to 800 C. To improve alloy ductility, several fabrication parameters were considered. New Fe-10-12Cr-6Al gas-atomized powders containing 0.15 to 0.5wt% Zr were procured and ball milled for 10h, 20h or 40h with Y2O3. The resulting powder was then extruded at temperature ranging from 900 to 1050 C. Decreasing the ball milling time or increasing the extrusion temperature changed the alloy grain size leading to lower strength but enhanced ductility. Small variations of the Cr, Zr, O and N content did not seem to significantly impact the alloy tensile properties, and, overall, the 2nd gen ODS FeCrAl alloys showed significantly better ductility than the 1st gen alloys. Tube fabrication needed for fuel cladding will require cold or warm working associated with softening heat treatments, work was therefore initiated to assess the effect of these fabrications steps on the alloy microstructure and properties. This report has been submitted as fulfillment of milestone M3FT 16OR020202091 titled, Report on 2nd Gen FeCrAl ODS Alloy Development for the Department of Energy Office of Nuclear Energy, Advanced Fuel Campaign of the Fuel Cycle R&D program.

  10. Hardening of ODS ferritic steels under irradiation with high-energy heavy ions

    NASA Astrophysics Data System (ADS)

    Ding, Z. N.; Zhang, C. H.; Yang, Y. T.; Song, Y.; Kimura, A.; Jang, J.

    2017-09-01

    Influence of the nanoscale oxide particles on mechanical properties and irradiation resistance of oxide-dispersion-strengthened (ODS) ferritic steels is of critical importance for the use of the material in fuel cladding or blanket components in advanced nuclear reactors. In the present work, impact of structures of oxide dispersoids on the irradiation hardening of ODS ferritic steels was studied. Specimens of three high-Cr ODS ferritic steels containing oxide dispersoids with different number density and average size were irradiated with high-energy Ni ions at about -50 °C. The energy of the incident Ni ions was varied from 12.73 MeV to 357.86 MeV by using an energy degrader at the terminal so that a plateau of atomic displacement damage (∼0.8 dpa) was produced from the near surface to a depth of 24 μm in the specimens. A nanoindentor (in constant stiffness mode with a diamond Berkovich indenter) and a Vickers micro-hardness tester were used to measure the hardeness of the specimens. The Nix-Gao model taking account of the indentation size effect (ISE) was used to fit the hardness data. It is observed that the soft substrate effect (SSE) can be diminished substantially in the irradiated specimens due to the thick damaged regions produced by the Ni ions. A linear correlation between the nano-hardeness and the micro-hardness was found. It is observed that a higher number density of oxide dispersoids with a smaller average diameter corresponds to an increased resistance to irradiation hardening, which can be ascribed to the increased sink strength of oxides/matrix interfaces to point defects. The rate equation approach and the conventional hardening model were used to analyze the influence of defect clusters on irradiation hardening in ODS ferritic steels. The numerical estimates show that the hardening caused by the interstitial type dislocation loops follows a similar trend with the experiment data.

  11. Techniques to Improve the Environmental Safety of OB and OD Operations

    DTIC Science & Technology

    2007-11-02

    PEP material to be detonated will be lowered into the ODOBi by a crane and suspended approximately 2 m above the floor. The pan comprising the...Noise From OD Activities. Salter and Parkes10, Keenan and Wager9, Barrett12 and the DTEO11 have shown conclusively that water can be used to...National Laboratory, Livermore CA, September 1995, 40 pp. ’ 9. W.A. Keenan and P.C. Wager, "Mitigation of confined explosive effects by

  12. Development of ODS FeCrAl for compatibility in fusion and fission energy applications

    DOE PAGES

    Pint, Bruce A.; Dryepondt, Sebastien N.; Unocic, Kinga A.; ...

    2014-11-15

    In this paper, oxide dispersion strengthened (ODS) FeCrAl alloys with 12–15% Cr are being evaluated for improved compatibility with Pb-Li for a fusion energy application and with high temperature steam for a more accident-tolerant light water reactor fuel cladding application. A 12% Cr content alloy showed low mass losses in static Pb-Li at 700°C, where a LiAlO2 surface oxide formed and inhibited dissolution into the liquid metal. All the evaluated compositions formed a protective scale in steam at 1200°C, which is not possible with ODS FeCr alloys. However, most of the compositions were not protective at 1400°C, which is amore » general and somewhat surprising problem with ODS FeCrAl alloys that is still being studied. More work is needed to optimize the alloy composition, microstructure and oxide dispersion, but initial promising tensile and creep results have been obtained with mixed oxide additions, i.e. Y2O3 with ZrO2, HfO2 or TiO2.« less

  13. In Situ Synchrotron Tensile Investigations on 14YWT, MA957 and 9-Cr ODS Alloys

    SciTech Connect

    Lin, Jun-Li; Mo, Kun; Yun, Di; Miao, Yinbin; Liu, Xiang; Zhao, Huijuan; Hoelzer, David T; Park, Jun-Sang; Almer, Jonathan; Zhang, Guangming; Zhou, Zhangjian; Stubbins, James; Yacout, Abdellatif

    2016-01-01

    Nanostructured ferritic alloys (NFAs) provide exceptional radiation tolerance and high-temperature mechanical properties when compared to traditional ferritic and ferritic/martensitic (F/M) steels. Their remarkable properties result from ultrahigh density and ultrafine size of Y-Ti-O nanoclusters within the ferritic matrix. In this work, we applied a high-energy synchrotron radiation X-ray to study the deformation process of two NFAs including 14YWT and MA957, and a 9-Cr ODS steel. Only the relatively large nanoparticles in the 9-Cr ODS were observed in the synchrotron X-ray diffraction. The nanoclusters in both 14 YWT and MA957 were invisible in the measurement due to their non-stoichiometric nature. Due to the different sizes of nanoparticles and nanoclusters in the materials, the Orowan looping was considered to be the major strengthening mechanism in the 9-Cr ODS, while the dispersed-barrier-hardening is dominant strengthening mechanism in both 14YWT and MA957, respectively. This analysis was inferred from the different build-up rates of dislocation density when plastic deformation was initiated. Finally, the dislocation densities interpreted from the X-ray measurements were successfully modeled using the Bergstr m s dislocation models.

  14. Microstructural behavior of 8Cr-ODS martensitic steels during creep deformation

    NASA Astrophysics Data System (ADS)

    Shinozuka, K.; Esaka, H.; Tamura, M.; Tanigawa, H.

    2011-10-01

    Oxide dispersion strengthened (ODS) steels show a high anisotropy in their creep behavior because of the δ-ferrite grain elongated in the hot-rolled direction and the characteristic formation of creep cavities. In this work, the relationship between the δ-ferrite grain and the growth of creep cavities in 8Cr-ODS steels was investigated. The samples of two ODS steels with different δ-ferrite volume fractions were machined parallel and perpendicular to the hot-rolled direction. Creep rupture tests and interrupted tests were performed at 700 °C and about 197 MPa. Cavities formed in the martensite along δ-ferrite grains during creep deformation. The area fraction of the cavities of all specimens increased in proportion to the cube root of test time. When the volume fraction of δ-ferrite was high and δ-ferrite grains elongated parallel to the load direction, δ-ferrite then obstructed the propagation of cracks. However, when the volume fraction of δ-ferrite was low and δ-ferrite grains elongated perpendicular to the load direction, δ-ferrite grains had little effect on crack propagation.

  15. Vibrational spectroscopy of O-H and O-D centers in TiO2

    NASA Astrophysics Data System (ADS)

    Bekisli, Figen; Stavola, Michael; Fowler, W. Beall

    2012-02-01

    While the vibrational properties of O-H centers in TiO2 have been studied for many years, recent experiments suggest a new picture of their behavior. In the 1970s, Bates and Perkins found a single, sharp, strongly polarized O-H line in TiO2, and similarly for O-D and O-T [1]. On the contrary, recent studies by Herklotz et al. [2] find three closely spaced O-H (O-D) lines that were assigned to two different charge states of an O-H (O-D) shallow donor. We have in our possession the very TiO2 samples studied many years ago by Bates and Perkins. We have introduced H and D into these samples and also into TiO2 samples obtained recently. High-resolution vibrational spectroscopy performed as a function of temperature at Lehigh provides new insight into the different vibrational properties seen for O-H in TiO2 in the 1970's and in recent studies by Herklotz et al. [1] J.B. Bates and R.A. Perkins, Phys. Rev. B 16, 3713 (1977). [2] F. Herklotz et al., Phys. Rev. B 83, 235202 (2011)..

  16. Development of ODS FeCrAl for compatibility in fusion and fission energy applications

    SciTech Connect

    Pint, Bruce A.; Dryepondt, Sebastien N.; Unocic, Kinga A.; Hoelzer, David T.

    2014-11-15

    In this paper, oxide dispersion strengthened (ODS) FeCrAl alloys with 12–15% Cr are being evaluated for improved compatibility with Pb-Li for a fusion energy application and with high temperature steam for a more accident-tolerant light water reactor fuel cladding application. A 12% Cr content alloy showed low mass losses in static Pb-Li at 700°C, where a LiAlO2 surface oxide formed and inhibited dissolution into the liquid metal. All the evaluated compositions formed a protective scale in steam at 1200°C, which is not possible with ODS FeCr alloys. However, most of the compositions were not protective at 1400°C, which is a general and somewhat surprising problem with ODS FeCrAl alloys that is still being studied. More work is needed to optimize the alloy composition, microstructure and oxide dispersion, but initial promising tensile and creep results have been obtained with mixed oxide additions, i.e. Y2O3 with ZrO2, HfO2 or TiO2.

  17. The influence of Cr content on the mechanical properties of ODS ferritic steels

    NASA Astrophysics Data System (ADS)

    Li, Shaofu; Zhou, Zhangjian; Jang, Jinsung; Wang, Man; Hu, Helong; Sun, Hongying; Zou, Lei; Zhang, Guangming; Zhang, Liwei

    2014-12-01

    The present investigation aimed at researching the mechanical properties of the oxide dispersion strengthened (ODS) ferritic steels with different Cr content, which were fabricated through a consolidation of mechanical alloyed (MA) powders of 0.35 wt.% nano Y2O3 dispersed Fe-12.0Cr-0.5Ti-1.0W (alloy A), Fe-16.0Cr-0.5Ti-1.0W (alloy B), and Fe-18.0Cr-0.5Ti-1.0W (alloy C) alloys (all in wt.%) by hot isostatic pressing (HIP) with 100 MPa pressure at 1150 °C for 3 h. The mechanical properties, including the tensile strength, hardness, and impact fracture toughness were tested by universal testers, while Young's modulus was determined by ultrasonic wave non-destructive tester. It was found that the relationship between Cr content and the strength of ODS ferritic steels was not a proportional relationship. However, too high a Cr content will cause the precipitation of Cr-enriched segregation phase, which is detrimental to the ductility of ODS ferritic steels.

  18. Development of ODS FeCrAl for Compatibility in Fusion and Fission Energy Applications

    NASA Astrophysics Data System (ADS)

    Pint, B. A.; Dryepondt, S.; Unocic, K. A.; Hoelzer, D. T.

    2014-12-01

    Oxide dispersion strengthened (ODS) FeCrAl alloys with 12-15% Cr are being evaluated for improved compatibility with Pb-Li for a fusion energy application and with high temperature steam for a more accident-tolerant light water reactor fuel cladding application. A 12% Cr content alloy showed low mass losses in static Pb-Li at 700°C, where a LiAlO2 surface oxide formed and inhibited dissolution into the liquid metal. All the evaluated compositions formed a protective scale in steam at 1200°C, which is not possible with ODS FeCr alloys. However, most of the compositions were not protective at 1400°C, which is a general and somewhat surprising problem with ODS FeCrAl alloys that is still being studied. More work is needed to optimize the alloy composition, microstructure and oxide dispersion, but initial promising tensile and creep results have been obtained with mixed oxide additions, i.e. Y2O3 with ZrO2, HfO2 or TiO2.

  19. Distinct and diverse anaerobic bacterial communities in boreal lakes dominated by candidate division OD1

    PubMed Central

    Peura, Sari; Eiler, Alexander; Bertilsson, Stefan; Nykänen, Hannu; Tiirola, Marja; Jones, Roger I

    2012-01-01

    Lakes have a central role in the carbon cycle of the boreal landscape. These systems typically stratify in summer and their hypolimnetic microbial communities influence burial of biogenic organic matter in sediments. The composition of bacterial communities in these suboxic habitats was studied by pyrosequencing of 16S rRNA amplicons from five lakes with variable dissolved organic carbon (DOC) concentrations. Bacterioplankton communities in the hypolimnetic waters were clearly different from the surface layer with candidate division OD1, Chlorobi and Bacteroidetes as dominant community members. Several operational taxonomic units (OTUs) affiliated with candidate division OD1 were abundant and consistently present in the suboxic hypolimnion in these boreal lakes. The overall representation of this group was positively correlated with DOC and methane concentrations. Network analysis of time-series data revealed contrasting temporal patterns but suggested similar ecological roles among the abundant OTUs affiliated with candidate division OD1. Together, stable isotope data and taxonomic classification point to methane oxidation and autotrophic denitrification as important processes in the suboxic zone of boreal lakes. Our data revealed that while hypolimnetic bacterial communities are less dynamic, they appear to be more diverse than communities from the oxic surface layer. An appreciable proportion of the hypolimnetic bacteria belong to poorly described phyla. PMID:22418623

  20. Phase diagram of multiferroic KCu3As2O7(OD ) 3

    NASA Astrophysics Data System (ADS)

    Nilsen, Gøran J.; Simonet, Virginie; Colin, Claire V.; Okuma, Ryutaro; Okamoto, Yoshihiko; Tokunaga, Masashi; Hansen, Thomas C.; Khalyavin, Dmitry D.; Hiroi, Zenji

    2017-06-01

    The layered compound KCu3As2O7(OD ) 3 , comprising distorted kagome planes of S =1 /2 Cu2 + ions, is a recent addition to the family of type-II multiferroics. Previous zero-field neutron diffraction work has found two helically ordered regimes in KCu3As2O7(OD ) 3 , each showing a distinct coupling between the magnetic and ferroelectric order parameters. Here, we extend this work to magnetic fields up to 20 T using neutron powder diffraction, capacitance, polarization, and high-field magnetization measurements, hence determining the H -T phase diagram. We find metamagnetic transitions in both low-temperature phases around μ0Hc˜3.7 T, which neutron powder diffraction reveals to correspond to rotations of the helix plane away from the easy plane, as well as a small change in the propagation vector. Furthermore, we show that the sign of the ferroelectric polarization is reversible in a magnetic field, although no change is observed (or expected on the basis of the magnetic structure) due to the transition at 3.7 T. We finally justify the temperature dependence of the polarization in both zero-field ordered phases by a symmetry analysis of the free energy expansion, and attempt to account for the metamagnetic transition by adding anisotropic exchange interactions to our existing model for KCu3As2O7(OD ) 3 .

  1. Microscopy of Alloy Formation on Arc Plasma Sintered Oxide Dispersion Strengthen (ODS) Steel

    NASA Astrophysics Data System (ADS)

    Bandriyana, B.; Sujatno, A.; Salam, R.; Dimyati, A.; Untoro, P.

    2017-07-01

    The oxide dispersed strengthened (ODS) alloys steel developed as structure material for nuclear power plants (NPP) has good resistant against creep due to their unique microstructure. Microscopy investigation on the microstructure formation during alloying process especially at the early stages was carried out to study the correlation between structure and property of ODS alloys. This was possible thanks to the arc plasma sintering (APS) device which can simulate the time dependent alloying processes. The ODS sample with composition of 88 wt.% Fe and 12 wt.% Cr powder dispersed with 1 wt.% ZrO2 nano powder was mixed in a high energy milling, isostatic compressed to form sample coins and then alloyed in APS. The Scanning Electron Microscope (SEM) with X-ray Diffraction Spectroscopy (EDX) line scan and mapping was used to characterize the microstructure and elemental composition distribution of the samples. The alloying process with unification of each Fe and Cr phase continued by the alloying formation of Fe-Cr by inter-diffusion of both Fe and Cr and followed by the improvement of the mechanical properties of hardness.

  2. OD in North American Schools: A Scandinavian View, with Comments by Matthew Miles and Michael Fullan. Uppsala Reports on Education, No. 20.

    ERIC Educational Resources Information Center

    Berg, Gunnar

    This report discusses the structural conditions under which organizational development (OD), as employed in the school systems of the United States and Canada, is more or less applicable to schools. The first section (chapters 1-6) reviews papers and books, concerning either OD in general or the ways in which the ideas of OD have been used in the…

  3. OD in North American Schools: A Scandinavian View, with Comments by Matthew Miles and Michael Fullan. Uppsala Reports on Education, No. 20.

    ERIC Educational Resources Information Center

    Berg, Gunnar

    This report discusses the structural conditions under which organizational development (OD), as employed in the school systems of the United States and Canada, is more or less applicable to schools. The first section (chapters 1-6) reviews papers and books, concerning either OD in general or the ways in which the ideas of OD have been used in the…

  4. Collisional quenching of OD A 2Σ+ by H2: experimental and theoretical studies of the state-resolved OD X 2Π product distribution and branching fraction.

    PubMed

    Lehman, Julia H; Dempsey, Logan P; Lester, Marsha I; Fu, Bina; Kamarchik, Eugene; Bowman, Joel M

    2010-10-28

    We report joint experimental and theoretical studies of outcomes resulting from the nonreactive quenching of electronically excited OD A  (2)Σ(+) by H(2). The experiments utilize a pump-probe technique to detect the OD X  (2)Π product state distribution under single collision conditions. The OD X  (2)Π products are observed primarily in their lowest vibrational state (v(") = 0) with substantially less population in v(") = 1. The OD X  (2)Π products are generated with a high degree of rotational excitation, peaking at N(") = 21 with an average rotational energy of 4600 cm(-1), and a strong propensity for populating the Π(A(')) Λ-doublet component indicative of alignment of the half-filled pπ orbital in the plane of OD rotation. Branching fraction measurements show that the nonreactive channel accounts for less than 20% of quenching outcomes. Complementary classical trajectory calculations of the postquenching dynamics are initiated from representative points along seams of conical intersections between the ground and excited-state potentials of OD(A  (2)Σ(+),X  (2)Π) + H(2). Diabatic modeling of the initial momenta in the dynamical calculations captures the key experimental trends: OD X  (2)Π products released primarily in their ground vibrational state with extensive rotational excitation and a branching ratio that strongly favors reactive quenching. The OD A  (2)Σ(+) + H(2) results are also compared with previous studies on the quenching of OH A  (2)Σ(+) + H(2); the two experimental studies show remarkably similar rotational energy distributions for the OH and OD X  (2)Π radical products.

  5. Time-resolved laser-induced incandescence from multiwalled carbon nanotubes in air

    SciTech Connect

    Mitrani, J. M.; Shneider, M. N.

    2015-01-26

    We observed temporal laser-induced incandescence (LII) signals from multiwalled carbon nanotubes(MWCNTs) suspended in ambient air. Unlike previous LII experiments with soot particles, which showed that primary particles with larger diameters cool at slower timescales relative to smaller particles, we observed that thicker MWCNTs with larger outer diameters (ODs) cool at faster timescales relative to thinner MWCNTs with smaller ODs. We suggested a simple explanation of this effect, based on the solution of one-dimensional nonstationary heat conduction equation for the initial non-uniform heating of MWCNTs with ODs greater than the skin depth.

  6. Development of Al added high-Cr ODS steels for fuel cladding of next generation nuclear systems

    NASA Astrophysics Data System (ADS)

    Kimura, A.; Kasada, R.; Iwata, N.; Kishimoto, H.; Zhang, C. H.; Isselin, J.; Dou, P.; Lee, J. H.; Muthukumar, N.; Okuda, T.; Inoue, M.; Ukai, S.; Ohnuki, S.; Fujisawa, T.; Abe, T. F.

    2011-10-01

    A successful example of high-Cr oxide dispersion strengthened (ODS) steels development is introduced with showing key technologies to overcome the issues to meet material requirements for next generation nuclear systems as well as fusion blanket systems. Corrosion issue requires Cr concentration more than 14 wt.%, but aging embrittlement issue requires it less than 16 wt.%. An addition of 4 wt.%Al is effective to improve corrosion resistance of 16 wt.%Cr-ODS steel in supercritical water (SCW) and lead-bismuth eutectics (LBE), while it is detrimental to high-temperature strength. An addition of small amount of Zr or Hf results in a significant increase in creep strength at 973 K in Al-added ODS steels. Feasibility of high-Cr ODS steel without Al addition is assessed for fusion application in terms of corrosion resistance in SCW.

  7. Measurement of aerosol optical depth and sub-visual cloud detection using the optical depth sensor (ODS)

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2016-02-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in the atmosphere of Mars. The instrument measures alternatively the diffuse radiation from the sky and the attenuated direct radiation from the Sun on the surface. The principal goals of ODS are to retrieve the daily mean aerosol optical depth (AOD) and to detect very high and optically thin clouds, crucial parameters in understanding the Martian meteorology and climatology. The detection of clouds is undertaken at twilight, allowing the detection and characterization of clouds with opacities below 0.03 (sub-visual clouds). In addition, ODS is capable to retrieve the aerosol optical depth during nighttime from moonlight measurements. Recently, ODS has been selected at the METEO meteorological station on board the ExoMars 2018 Lander. In order to study the performance of ODS under Mars-like conditions as well as to evaluate the retrieval algorithms for terrestrial measurements, ODS was deployed in Ouagadougou (Africa) between November 2004 and October 2005, a Sahelian region characterized by its high dust aerosol load and the frequent occurrence of Saharan dust storms. The daily average AOD values retrieved by ODS were compared with those provided by a CIMEL sunphotometer of the AERONET (Aerosol Robotic NETwork) network localized at the same location. Results represent a good agreement between both ground-based instruments, with a correlation coefficient of 0.77 for the whole data set and 0.94 considering only the cloud-free days. From the whole data set, a total of 71 sub-visual cirrus (SVC) were detected at twilight with opacities as thin as 1.10-3 and with a maximum of occurrence at altitudes between 14 and 20 km. Although further optimizations and comparisons of ODS terrestrial measurements are required, results indicate the potential of these measurements to retrieve the AOD and detect sub-visual clouds.

  8. The comparison of microstructures and mechanical properties between 14Cr-Al and 14Cr-Ti ferritic ODS alloys

    SciTech Connect

    Zhang, Guangming; Zhou, Zhangjian; Mo, Kun; Miao, Yinbin; Li, Shaofu; Liu, Xiang; Wang, Man; Park, Jun -Sang; Almer, Jonathan; Stubbins, James F.

    2016-03-03

    In this study, two kinds of 14Cr ODS alloys (14Cr-Al and 14Cr-Ti) were investigated to reveal the different effects between Al and Ti on the microstructures and mechanical properties of 14Cr ferritic ODS alloys. The microstructure information such as grains, minor phases of these two alloys has been investigated by high-energy X-ray diffraction and transmission electron microscopy (TEM). The in situ synchrotron X-ray diffraction tensile test was applied to investigate the mechanical properties of these two alloys. The lattice strains of different phases through the entire tensile deformation process in these two alloys were analyzed to calculate their elastic stresses. From the comparison of elastic stress, the strengthening capability of Y2Ti2O7 is better than TiN in 14Cr-Ti, and the strengthening capability of YAH is much better than YAM and AlN in 14Cr-Al ODS. The dislocation densities of 14Cr-Ti and 14Cr-Al ODS alloys during tensile deformation were also examined by modified Williamson-Hall analyses of peak broadening, respectively. In conclusion, the different increasing speed of dislocation density with plastic deformation reveals the better strengthening effect of Y-Ti-O particles in 14Cr-Ti ODS than that of Y-Al-O particles in 14Cr-Al ODS alloy.

  9. The comparison of microstructures and mechanical properties between 14Cr-Al and 14Cr-Ti ferritic ODS alloys

    DOE PAGES

    Zhang, Guangming; Zhou, Zhangjian; Mo, Kun; ...

    2016-03-03

    In this study, two kinds of 14Cr ODS alloys (14Cr-Al and 14Cr-Ti) were investigated to reveal the different effects between Al and Ti on the microstructures and mechanical properties of 14Cr ferritic ODS alloys. The microstructure information such as grains, minor phases of these two alloys has been investigated by high-energy X-ray diffraction and transmission electron microscopy (TEM). The in situ synchrotron X-ray diffraction tensile test was applied to investigate the mechanical properties of these two alloys. The lattice strains of different phases through the entire tensile deformation process in these two alloys were analyzed to calculate their elastic stresses.more » From the comparison of elastic stress, the strengthening capability of Y2Ti2O7 is better than TiN in 14Cr-Ti, and the strengthening capability of YAH is much better than YAM and AlN in 14Cr-Al ODS. The dislocation densities of 14Cr-Ti and 14Cr-Al ODS alloys during tensile deformation were also examined by modified Williamson-Hall analyses of peak broadening, respectively. In conclusion, the different increasing speed of dislocation density with plastic deformation reveals the better strengthening effect of Y-Ti-O particles in 14Cr-Ti ODS than that of Y-Al-O particles in 14Cr-Al ODS alloy.« less

  10. The comparison of microstructures and mechanical properties between 14Cr-Al and 14 Cr-Ti ferritic ODS alloys

    DOE PAGES

    Zhang, Guangming; Zhou, Zhangjian; Mo, Kun; ...

    2016-05-15

    In this study, two kinds of 14Cr ODS alloys (14Cr-Al and 14Cr-Ti) were investigated to reveal the different effects between Al and Ti on the microstructures and mechanical properties of 14Cr ferritic ODS alloys. The microstructure information such as grains, minor phases of these two alloys has been investigated by high-energy X-ray diffraction and transmission electron microscopy (TEM). The in situ synchrotron X-ray diffraction tensile test was applied to investigate the mechanical properties of these two alloys. The lattice strains of different phases through the entire tensile deformation process in these two alloys were analyzed to calculate their elastic stresses.more » From the comparison of elastic stress, the strengthening capability of Y2Ti2O7 is better than TiN in 14Cr-Ti, and the strengthening capability of YAH is much better than YAM and AlN in 14Cr-Al ODS. The dislocation densities of 14Cr-Ti and 14Cr-Al ODS alloys during tensile deformation were also examined by modified Williamson-Hall analyses of peak broadening, respectively. The different increasing speed of dislocation density with plastic deformation reveals the better strengthening effect of Y-Ti-O particles in 14Cr-Ti ODS than that of Y-Al-O particles in 14Cr-Al ODS alloy.« less

  11. Infrared spectroscopy of OD vibrators in minerals at natural dilution: hydroxyl groups in talc and kaolinite, and structural water in beryl and emerald.

    PubMed

    de Donato, Philippe; Cheilletz, Alain; Barres, Odile; Yvon, Jacques

    2004-05-01

    An infrared (IR) study of natural deuteration is conducted on minerals containing hydroxyl groups (talc and kaolinite) and channel-water-bearing minerals (beryl and emerald). In talc, the OD valence vibration is located at 2710 cm(-1), corresponding to OD groups surrounded by 3 Mg atoms. In kaolinite, the OD valence vibrations are located at 2671 cm(-1) (inner OD group), 2712, 2706, and 2700 cm(-1) (three inner-surface OD groups). In beryl and emerald, natural deuteration of channel water is observed for the first time by infrared microspectroscopy. In beryl from Minas Gerais (Brazil), the OD profiles are characterized by four bands at 2735, 2686, 2672, and 2641 cm(-1). In emeralds from Colombia and Brazil, the OD profiles are characterized by five or four bands, respectively, at 2816, 2737, 2685, 2673, and 2641 cm(-1) (Colombia) and 2730, 2684, 2672, and 2640 cm(-1) (Brazil). The band at 2816 cm(-1) can be assigned to -OD or OD(-), and bands at 2686-2684, 2673-2672, and 2641-2640 cm(-1) can be assigned to type-I and type-II HOD molecules. The band at 2737-2730 cm(-1) is partially disturbed by combination bands of the mineral. Such OD profiles are different from those obtained by artificial deuteration at higher OD dilution.

  12. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes For Hoop Creep Enhancement

    SciTech Connect

    Bimal K. Kad

    2005-11-23

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. Recent studies in crossrolled ODS-alloy sheets (produced from flattened tubes) indicate that transverse creep is significantly enhanced via controlled transverse grain fibering, and similar improvements are expected for cross-rolled tubes. The research program outlined here is iterative in nature and is intended to systematically (1) examine and identify post-extrusion forming methodologies to

  13. Effects of heat treatment conditions on the microstructure and impact properties of EUROFER 97 ODS steel

    NASA Astrophysics Data System (ADS)

    Di Martino, S. F.; Faulkner, R. G.; Riddle, N. B.; Monge, M. A.; Munoz, A.

    2011-12-01

    Probably the most important range of materials to consider for the blanket material in the tokamak design for fusion reactors such as ITER and DEMO is the high alloy Fe9Cr oxide dispersion strengthened (ODS) ferritic steels. These steels possess exceptional thermal conductivity and low thermal expansion while being strongly resistant to void swelling. Their main drawback is the high ductile-to-brittle transition temperature (DBTT), particularly in the ODS versions of the material. This paper describes attempts that are being made to reduce this DBTT in as yet unirradiated materials by a novel heat treatment procedure. The principle behind this approach is that low DBTT in the unirradiated materials will lead to relatively low DBTT even in He-containing material that has been irradiated with fusion blanket-type irradiations. New batches of high alloy Fe9Cr ODS (EUROFER) ferritic steel have been produced by a powder metallurgical route, and relatively homogeneous material has been produced by a hot isostatic pressing procedure. Mini-Charpy test specimens were made from materials that had been subjected to a matrix of heat treatments designed to show up variations in solution treatment (ST) temperature, cooling rate from the ST temperature and tempering treatment. The initial DBTT was in the range 150-200 °C. Extremely interesting results have been obtained. DBTT downward shifts of up to 200 °C have been observed by using a high 1300 °C ST temperature and a low cooling rate. The paper goes on to describe the microstructure of this material, and discusses the possible microstructural factors needed to produce these very high DBTT downward shifts. Low dissolved carbon and higher proportions of low-angle grain boundaries seem to provide the key to the understanding of the alloy behaviour.

  14. Chemical and microstructural evolution on ODS Fe-14CrWTi steel during manufacturing stages

    NASA Astrophysics Data System (ADS)

    Olier, P.; Malaplate, J.; Mathon, M. H.; Nunes, D.; Hamon, D.; Toualbi, L.; de Carlan, Y.; Chaffron, L.

    2012-09-01

    Oxide Dispersion Strengthened (ODS) steels are promising candidate materials for fission and fusion applications thanks to their improved properties related to both their fine grained microstructure and high density of Y-Ti-O nanoscale clusters (NCs). The Fe-14Cr-1 W-0.3Ti-0.3Y2O3 ODS ferritic steel was produced by powder metallurgy: Iron-base gas atomized powders were mechanically alloyed with 0.3% Y2O3 particles in an attritor. Then, the ODS powders were encapsulated in a soft steel can, consolidated by hot extrusion and cold rolled under the shape of tube cladding. The present work investigates the evolution of the chemical composition and the microstructure after each stage of the fabrication route (i.e. mechanical alloying, extrusion and cold rolling). Chemical analysis indicates a significant increase of the carbon content and a moderate increase of oxygen and nitrogen after mechanical alloying compared to initial atomized powders. After extrusion, the measured oxygen content corresponds mainly to the oxygen coming from yttria addition during MA process. In addition, electron microprobe analyses are performed after hot extrusion to determine the concentration and the distribution of the constitutive elements (Cr, Ti, W, Y, O). The microstructure was investigated by transmission electron microscopy (TEM) and small angle neutron scattering (SANS) in order to characterize the size distribution of Y-Ti-O particles. TEM results reveal a fine microstructure (average grain size of 600 nm in the transverse direction) including Y-Ti-O NCs with a mean diameter close to 3 nm after extrusion. A slight coarsening of Y-Ti-O NCs is evidenced by SANS after cold rolling and heat treatments.

  15. Optimization of the chemical composition and manufacturing route for ODS RAF steels for fusion reactor application

    NASA Astrophysics Data System (ADS)

    Oksiuta, Z.; Baluc, N.

    2009-05-01

    As the upper temperature for use of reduced activation ferritic/martensitic steels is presently limited by a drop in mechanical strength at about 550 °C, Europe, Japan and the US are actively researching steels with high strength at higher operating temperatures, mainly using stable oxide dispersion. In addition, the numerous interfaces between matrix and oxide particles are expected to act as sinks for the irradiation-induced defects. The main R&D activities aim at finding a compromise between good tensile and creep strength and sufficient ductility, especially in terms of fracture toughness. Oxide dispersion strengthened (ODS) reduced activation ferritic (RAF) steels appear as promising materials for application in fusion power reactors up to about 750 °C. Six different ODS RAF steels, with compositions of Fe-(12-14)Cr-2W-(0.1-0.3-0.5)Ti-0.3Y2O3 (in wt%), were produced by powder metallurgy techniques, including mechanical alloying, canning and degassing of the milled powders and compaction of the powders by hot isostatic pressing, using various devices and conditions. The materials have been characterized in terms of microstructure and mechanical properties. The results have been analysed in terms of optimal chemical composition and manufacturing conditions. In particular, it was found that the composition of the materials should lie in the range Fe-14Cr-2W-(0.3-0.4)Ti-(0.25-0.3)Y2O3, as 14Cr ODS RAF steels exhibit higher tensile strength and better Charpy impact properties and are more stable than 12Cr materials (no risk of martensitic transformation), while materials with 0.5% Ti or more should not be further investigated, due to potential embrittlement by large TiO2 particles.

  16. Efficiency in supercritical fluid chromatography with different superficially porous and fully porous particles ODS bonded phases.

    PubMed

    Lesellier, E

    2012-03-09

    The chromatographic efficiency, in terms of plate number per second, was dramatically improved by the introduction of sub-two microns particles with ultra-high pressure liquid chromatography (UHPLC). On the other hand, the recent development of superficially porous particles, called core-shell or fused-core particles, appears to allow the achievement of the same efficiency performances at higher speed without high pressure drops. CO₂-based mobile phases exhibiting much lower viscosities than aqueous based mobile phases allow better theoretical efficiencies, even with 3-5 μm particles, but with relative low pressure drops. They also allow much higher flow rates or much longer columns while using conventional instruments capable to operate below 400 bar. Moreover, the use of superficially porous particles in SFC could enhance the chromatographic performances even more. The kinetic behavior of ODS phases bonded on these particles was studied, with varied flow rates, outlet (and obviously inlet) pressures, temperatures, by using a homologous series (alkylbenzenes) with 10% modifier (methanol or acetonitrile) in the carbon dioxide mobile phase. Results were also compared with classical fully porous particles, having different sizes, from 2.5 to 5 μm. Superior efficiency (N) and reduced h were obtained with these new ODS-bonded particles in regards to classical ones, showing their great interest for use in SFC. However, surprising behavior were noticed, i.e. the increase of the theoretical plate number vs. the increase of the chain length of the compounds. This behavior, opposite to the one classically reported vs. the retention factor, was not depending on the outlet pressure, but on the flow rate and the temperature changes. The lower radial trans-column diffusion on this particle types could explain these results. This diffusion reduction with these ODS-bonded superficially porous particles seems to decrease with the increase of the residence time of compounds.

  17. Raman OD stretching spectral differences between aqueous and alcoholic tetraalkylammonium chloride solutions

    NASA Astrophysics Data System (ADS)

    Hidaka, Fumi; Kanno, Hitoshi

    2003-09-01

    Raman OD stretching spectra were measured for aqueous and alcoholic R 4NCl solutions in both liquid state at room temperature and glassy state at liquid nitrogen temperature (alcohol=methanol and ethanol, R=alkyl group: methyl, ethyl and n-propyl). Comparison of the spectra indicates that enhancement of the low frequency region is more pronounced for the glassy aqueous solution than the corresponding alcohol solution. It is suggested that hydrophobic hydration plays a role in the strengthening of hydrogen bonds around an apolar solute (group) at low temperatures in aqueous solution system.

  18. Investigation of eddy current examination on OD fatigue crack for steam generator tubes

    NASA Astrophysics Data System (ADS)

    Kong, Yuying; Ding, Boyuan; Li, Ming; Liu, Jinhong; Chen, Huaidong; Meyendorf, Norbert G.

    2015-03-01

    The opening width of fatigue crack was very small, and conventional Bobbin probe was very difficult to detect it in steam generator tubes. Different sizes of 8 fatigue cracks were inspected using bobbin probe rotating probe. The analysis results showed that, bobbin probe was not sensitive for fatigue crack even for small through wall crack mixed with denting signal. On the other hand, the rotating probe was easily to detect all cracks. Finally, the OD phase to depth curve for fatigue crack using rotating probe was established and the results agreed very well with the true crack size.

  19. [Odón de Buen: forty-five years of commitment to the university].

    PubMed

    Gomis, Alberto

    2011-01-01

    The aragonese naturalist Odón de Buen y del Cos for twenty-two annual academic courses professor of natural history at the University of Barcelona and for twenty-three of the University of Madrid. Strong supporter of Darwin's evolutionary theory, experimental work in the field and laboratory, in this paper puts the value of their efforts, as an educator, to popularize the natural sciences and thus separated from the concerns, superstition and fanaticism, which they were basic reasons of the moral and material backwardness in which Spain was found.

  20. An Experimental Study of the Kinetics of OH/OD(ν=1,2,3) + SO2: the Limiting High Pressure Rate Coefficients as a Function of Temperature.

    PubMed

    Blitz, Mark A; Salter, Robert J; Heard, Dwayne E; Seakins, Paul W

    2017-03-31

    The kinetics of the reaction OH/OD(ν=1,2,3) + SO2 have been studied using a photolysis / laser induced fluorescence technique. The rate coefficients OH/OD(v=1,2,3) + SO2, k1, over the temperature range 295 - 810 K were used to determine the limiting high pressure limit, k1(∞). This method is usually applicable if the reaction samples the potential well of the adduct, HOSO2, and if intramolecular vibrational relaxation is fast. In the present case, however, the rate coefficients showed an additional fast removal contribution as evidenced by the increase in k1 with vibrational level; this behaviour together with its temperature dependence is consistent with the existence of a weakly bound complex on the potential energy surface prior to adduct formation. The data were analysed using a composite mechanism that incoporates energy transfer mechanisms via both the adduct and the complex, and yielded a value of k1(∞)(295 K) equal to (7.2 ± 3.3) × 10(-13) cm(3) molecule(-1) s(-1), (errors at 1σ) a factor of between two to three smaller than the current recommended IUPAC and JPL values of (2.0) and (1.6 ± 0.4) × 10(-12) cm(3) molecule(-1) s(-1) at 298 K, respectively, although the error bars do overlap. k1(∞) was observed to only depend weakly on temperature. Further evidence for a smaller k1(∞) is presented in the companion paper.

  1. Measurement of aerosol optical depth and sub-visual cloud detection using the optical depth sensor (ODS)

    NASA Astrophysics Data System (ADS)

    Toledo, D.; Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2015-09-01

    A small and sophisticated optical depth sensor (ODS) has been designed to work in the atmosphere of Earth and Mars. The instrument measures alternatively the diffuse radiation from the sky and the attenuated direct radiation from the sun on the surface. The principal goals of ODS are to retrieve the daily mean aerosol optical depth (AOD) and to detect very high and optically thin clouds, crucial parameters in understanding the Martian and Earth meteorology and climatology. The detection of clouds is undertaken at twilight, allowing the detection and characterization of clouds with opacities below 0.03 (sub-visual clouds). In addition, ODS is capable to retrieve the aerosol optical depth during night-time from moonlight measurements. In order to study the performance of ODS under Mars-like conditions as well as to evaluate the retrieval algorithms for terrestrial measurements, ODS was deployed in Ouagadougou (Africa) between November 2004 and October 2005, a sahelian region characterized by its high dust aerosol load and the frequent occurrence of Saharan dust storms. The daily average AOD values retrieved by ODS were compared with those provided by a CIMEL Sun-photometer of the AERONET (Aerosol Robotic NETwork) network localized at the same location. Results represent a good agreement between both ground-based instruments, with a correlation coefficient of 0.79 for the whole data set and 0.96 considering only the cloud-free days. From the whole dataset, a total of 71 sub-visual cirrus (SVC) were detected at twilight with opacities as thin as 1.10-3 and with a maximum of occurrence at altitudes between 14 and 20 km. Although further analysis and comparisons are required, results indicate the potential of ODS measurements to detect sub-visual clouds.

  2. ODS steel raw material local structure analysis using X-ray absorption spectroscopy

    NASA Astrophysics Data System (ADS)

    Cintins, A.; Anspoks, A.; Purans, J.; Kuzmin, A.; Timoshenko, J.; Vladimirov, P.; Gräning, T.; Hoffmann, J.

    2015-03-01

    Oxide dispersion strengthened (ODS) steels are promising materials for fusion power reactors, concentrated solar power plants, jet engines, chemical reactors as well as for hydrogen production from thermolysis of water. In this study we used X-ray absorption spectroscopy at the Fe and Cr K-edges as a tool to get insight into the local structure of ferritic and austenitic ODS steels around Fe and Cr atoms and its transformation during mechanical alloying process. Using the analysis of X-ray absorption near edge structure (XANES) and extended X-ray absorption fine structure (EXAFS) we found that for austenitic samples a transformation of ferritic steel to austenitic steel is detectable after 10 hours of milling and proceeds till 40 hours of milling; only small amount of a-phase remains after 80 hours of milling. We found that the Cr K-edge EXAFS can be used to observe distortions inside the material and to get an impression on the formation of chromium clusters. In-situ EXAFS experiments offer a reliable method to investigate the ferritic to austenitic transformation.

  3. A Comparative Study of Welded ODS Cladding materials for AFCI/GNEP Applications

    SciTech Connect

    Indrajit Charit; Megan Frary; Darryl Butt; K.L. Murty; Larry Zirker; James Cole; Mitchell Meyer; Rajiv S. Mishra; Mark Woltz

    2011-03-31

    This research project involved working on the pressure resistance welding of oxide dispersion strengthened (ODS) alloys which will have a large role to play in advanced nuclear reactors. The project also demonstrated the research collaboration between four universities and one nation laboratory (Idaho National Laboratory) with participation from an industry for developing for ODS alloys. These alloys contain a high number density of very fine oxide particles that can impart high temperature strength and radiation damage resistance suitable for in-core applications in advanced reactors. The conventional fusion welding techniques tend to produce porosity-laden microstructure in the weld region and lead to the agglomeration and non-uniform distribution of the neededoxide particles. That is why two solid state welding methods - pressure resistance welding (PRW) and friction stir welding (FSW) - were chosen to be evaluated in this project. The proposal is expected to support the development of Advanced Burner Reactors (ABR) under the GNEP program (now incorporated in Fuel Cycle R&D program). The outcomes of the concluded research include training of graduate and undergraduate students and get them interested in nuclear related research.

  4. Influence of consolidation methods on the recrystallization kinetics of a Fe-14Cr based ODS steel

    NASA Astrophysics Data System (ADS)

    Dadé, M.; Malaplate, J.; Garnier, J.; De Geuser, F.; Lochet, N.; Deschamps, A.

    2016-04-01

    The recrystallization behavior during thermal annealing with or without prior cold work has been investigated in a 14%Cr ODS steel consolidated by two different methods, hot extrusion (HE) and hot isostatic pressing (HIP). We show that a 1400°C-1 h annealing induces an increase of the oxide nanoparticles radius from 1.3 to 3 nm, however the grain size remain stable despite a recovery of sub-grain boundaries for the hot extruded material. When pre-deformation is applied before annealing, almost full recrystallization can be achieved on the HE ODS steel. In this study, we show recrystallization after 40% cold deformation and annealing 30 min at 1450 °C together with coarsening of oxide particles. At lower temperature and higher pre-deformation (70%-1150 °C/30 min), we show that recrystallization can be achieved without change of the oxide size distribution. We show that due to a lower initial dislocation density, recrystallization is strongly delayed, by at least 250 °C, in the HIP material. Finally, we show that the evolution of the size of the oxide precipitates is controlled by the time and temperature of annealing and are independent on the pre-deformation and occurrence of recrystallization.

  5. Analysis of high temperature deformation mechanism in ODS EUROFER97 alloy

    NASA Astrophysics Data System (ADS)

    Ramar, A.; Spätig, P.; Schäublin, R.

    2008-12-01

    Oxide dispersion in tempered martensitic EUROFER97 steel is an efficient approach to improve its strength. The oxide dispersion strengthened (ODS) EUROFER97 steel shows a good strength up to 600 °C, but degrades rapidly beyond that temperature. To understand the origin in the microstructure of this drop in strength in situ heating experiment in TEM was performed from room temperature to 1000 °C. Upon heating neither microstructure changes nor dislocation movement are observed up to 600 °C. Movement of dislocations are observed above 680 °C. Phase transformation to austenite starts at 840 °C. Yttria particles remain stable up to 1000 °C. Changes in mechanical properties thus do not relate to changes in yttria dispersion. It is attempted to relate these observations to the thermal activation parameters measured by the technique of conventional strain rate experiment, which allow to identify at a mesoscopic scale the microstructural mechanisms responsible for the degradation of ODS steel at high temperatures.

  6. Diffusion bonding between ODS ferritic steel and F82H steel for fusion applications

    NASA Astrophysics Data System (ADS)

    Noh, Sanghoon; Kim, Byungjun; Kasada, Ryuta; Kimura, Akihiko

    2012-07-01

    Diffusion bonding techniques were employed to join high Cr oxide dispersion strengthened (ODS) ferritic steel (Fe-15Cr-2W-0.2Ti-0.35Y2O3) and F82H steel under uni-axial hydrostatic pressure using a high vacuum hot press, and the microstructure and mechanical properties of the joints were investigated. The dissimilar joints were bonded by solid-state diffusion bonding (SSDB) and liquid phase diffusion bonding (LPDB). After bonding process, heat treatments were conducted to utilize the phase transformation of F82H steel for recovering the martensitic structure. Tensile tests with miniaturized specimens were carried out to investigate and compare the bonding strengths of each joint. Microstructure was observed for the bonding interface, and fracture mode was investigated after the tensile tests. LPDB joint of interfacial F82H steel fully recovered to martensite phase by post-joining heat treatments, while SSDB joint had ferrite phases at the interface even after heat treatment, which is considered to be due to decarburization of F82H steel during the bonding process. Therefore it is considered that the insert material plays a role as diffusion barrier of carbon during LPDB process. Microstructure observations and tensile tests of the joints revealed that the LPDB joints possess suitable tensile properties which are comparable to that of F82H steel. This indicates that LPDB is more promising method to bond ODS-FS and F82H steel than SSDB.

  7. ODS2: a multiplatform software application for creating integrated physical and genetic maps.

    PubMed

    Hall, D; Bhandarkar, S M; Wang, J

    2001-03-01

    A contig map is a physical map that shows the native order of a library of overlapping genomic clones. One common method for creating such maps involves using hybridization to detect clone overlaps. False- positive and false-negative hybridization errors, the presence of chimeric clones, and gaps in library coverage lead to ambiguity and error in the clone order. Genomes with good genetic maps, such as Neurospora crassa, provide a means for reducing ambiguities and errors when constructing contig maps if clones can be anchored with genetic markers to the genetic map. A software application called ODS2 for creating contig maps based on clone-clone hybridization data is presented. This application is also designed to exploit partial ordering information provided by anchorage of clones to a genetic map. This information, along with clone-clone hybridization data, is used by a clone ordering algorithm and is represented graphically, allowing users to interactively align physical and genetic maps. ODS2 has a graphical user interface and is implemented entirely in Java, so it runs on multiple platforms. Other features include the flexibility of storing data in a local file or relational database and the ability to create full or minimum tiling contig maps.

  8. Fracture behaviour of the 14Cr ODS steel exposed to helium and liquid lead

    NASA Astrophysics Data System (ADS)

    Hojna, Anna; Di Gabriele, Fosca; Hadraba, Hynek; Husak, Roman; Kubena, Ivo; Rozumova, Lucia; Bublikova, Petra; Kalivodova, Jana; Matejicek, Jiri

    2017-07-01

    This work describes the fracture behaviour of the 14Cr ODS steel produced by mechanical alloying process, after high temperature exposures. Small specimens were exposed to helium gas in a furnace at 720 °C for 500 h. Another set of specimens was exposed to flowing liquid lead in the COLONRI II loop at 650 °C for 1000 h. All specimens were tested for the impact and tensile behaviour. The impact test results are compared to other sets of specimens in the as received state and after isothermal annealing at 650 °C for 1000 h. The impact curves of the exposed materials showed positive shifts on the transition temperature. While the upper shelf value did not change in the Pb exposed ODS steel, it significantly increased in the He exposed one. The differences are discussed in terms of surface and subsurface microscopy observation. The embrittlement can be explained as the effect of a slight change in the grain boundary and size distribution combined with the depletion of sub-surface region from alloying elements forming oxide scale on the surface.

  9. HRTEM Study of Oxide Nanoparticles in K3-ODS Ferritic Steel Developed for Radiation Tolerance

    SciTech Connect

    Hsiung, L; Fluss, M; Tumey, S; Kuntz, J; El-Dasher, B; Wall, M; Choi, W; Kimura, A; Willaime, F; Serruys, Y

    2009-11-02

    Crystal and interfacial structures of oxide nanoparticles and radiation damage in 16Cr-4.5Al-0.3Ti-2W-0.37 Y{sub 2}O{sub 3} ODS ferritic steel have been examined using high-resolution transmission electron microscopy (HRTEM) techniques. Oxide nanoparticles with a complex-oxide core and an amorphous shell were frequently observed. The crystal structure of complex-oxide core is identified to be mainly monoclinic Y{sub 4}Al{sub 2}O{sub 9} (YAM) oxide compound. Orientation relationships between the oxide and the matrix are found to be dependent on the particle size. Large particles (> 20 nm) tend to be incoherent and have a spherical shape, whereas small particles (< 10 nm) tend to be coherent or semi-coherent and have a faceted interface. The observations of partially amorphous nanoparticles and multiple crystalline domains formed within a nanoparticle lead us to propose a three-stage mechanism to rationalize the formation of oxide nanoparticles containing core/shell structures in as-fabricated ODS steels. Effects of nanoparticle size and density on cavity formation induced by (Fe{sup 8+} + He{sup +}) dual-beam irradiation are briefly addressed.

  10. The OD interpretation of the crystal structure of kettnerite CaBiOFCO3.

    PubMed

    Hybler, Jirí; Durovic, Slavomil

    2009-11-01

    The mineral kettnerite, CaBi(OFCO(3)), is a rare example of an order-disorder (OD) structure with a quadratic net. The lattice parameters of the simplest possible 1O polytype are a = 5.3641 (1), b = 5.3641 (1), c = 13.5771 (2) A, and the space group is Pbaa. There are three kinds of OD layers, identical to structure-building layers. Two of them are non-polar: the Bi-O and Ca-F at z = 0 and z = 1/2, respectively, with the layer-group symmetry C2/m2/m(4/a,b)2(1)/m2(1)/m. The third kind of OD layer of CO(3) groups (located between the Bi-O and Ca-F layers) is polar, with alternating sense of polarity. The layer group is Pba(4)mm. Triangular CO(3) groups are parallel to (110) or (110) planes with one O atom oriented towards the Bi-O layer and the remaining two O atoms oriented towards the Ca-F layer. The orientations of CO(3) groups alternate along the [110] and [110] directions. As a result, each group parallel to (110) is surrounded by four nearest neighbors parallel to (110) and vice versa. These positions can be interchanged by an (a + b)/2 shift or by pi/2 rotation; thus stacking of the layer onto adjacent ones is ambiguous. Instead of OD layers, the polytypes are generated by stacking of OD packets, comprising the whole CO(3) layers and adjacent halves of the Bi-O and Ca-F layers. They are polar, with alternating sense of polarity; the layer group is Pba(4)mm. Stacking sequences are expressed by ball-and-stick models, with the aid of symbolic figures, and by sequences of orientational characters. There are two maximum-degree-of-order (MDO) polytypes, 1O (really found and described, see lattice parameters and space group above) and 2O, with doubled c parameter and space group Ibca (not yet found). The derivation of the MDO generating operations of both polytypes is presented in this paper. The stacking rule also allows another, non-MDO, polytype with doubled c, i.e. the 2Q polytype, space group P4(2)bc (tetragonal, not yet found). Various kinds of domains can

  11. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes For Hoop Creep Enhancement

    SciTech Connect

    Bimal Kad

    2007-09-30

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program were to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. The research program outlined was iterative and intended to systematically (i) examine and identify post-extrusion forming methodologies to create hoop strengthened tubes, to be (ii) evaluated at 'in-service' loads at service temperatures and environments. Our report outlines the significant hoop creep enhancements possible via secondary cross-rolling and/or flow-forming operations. Each of the

  12. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes For Hoop Creep Enhancement

    SciTech Connect

    Bimal K. Kad

    2006-09-30

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. The research program outlined here is iterative in nature and is intended to systematically (a) examine and identify post-extrusion forming methodologies to create hoop strengthened tubes, which will be (b) evaluated at ''in-service'' loads at service temperatures and environments. In this 12th quarter of performance, program activities are concluded for Task 2 and continuing for Tasks 3, 4 and

  13. Cross-Roll Flow Forming of ODS Alloy Heat Exchanger Tubes for Hoop Creep Enhancement

    SciTech Connect

    Bimal K. Kad

    2006-04-10

    Mechanically alloyed oxide dispersion strengthened (ODS) Fe-Cr-Al alloy thin walled tubes and sheets, produced via powder processing and consolidation methodologies, are promising materials for eventual use at temperatures up to 1200 C in the power generation industry, far above the temperature capabilities of conventional alloys. Target end-uses range from gas turbine combustor liners to high aspect ratio (L/D) heat exchanger tubes. Grain boundary creep processes at service temperatures, particularly those acting in the hoop direction, are the dominant failure mechanisms for such components. The processed microstructure of ODS alloys consists of high aspect ratio grains aligned parallel to the tube axis, a result of dominant axial metal flow which aligns the dispersoid particles and other impurities in the longitudinal direction. The dispersion distribution is unaltered on a micro scale by recrystallization thermal treatments, but the high aspect ratio grain shape typically obtained limits transverse grain spacing and consequently the hoop creep response. Improving hoop creep in ODS-alloy components will require understanding and manipulating the factors that control the recrystallization behavior, and represents a critical materials design and development challenge that must be overcome in order to fully exploit the potential of ODS alloys. The objectives of this program are to (1) increase creep-strength at temperature in ODS-alloy tube and liner components by 100% via, (2) preferential cross-roll flow forming and grain/particle fibering in the critical hoop direction. The research program outlined here is iterative in nature and is intended to systematically (1) examine and identify post-extrusion forming methodologies to create hoop strengthened tubes, which will be (2) evaluated at ''in-service'' loads at service temperatures and environments. This research program is being conducted in collaboration with the DOE's Oak Ridge National Laboratory and the vested

  14. Laser pointer induced macular damage: case report and mini review.

    PubMed

    Turaka, Kiran; Bryan, J Shepard; Gordon, Alan J; Reddy, Rahul; Kwong, Henry M; Sell, Clive H

    2012-06-01

    To report laser pointer induced damage to retina and choroid and briefly review literature. A case report of a 13-year old Caucasian boy developed blurry central vision and central scotoma in right eye (OD). He was exposed for one minute to class IIIA green laser pointer of 650 nm wavelength and 5 mW power. Clinical examination showed a grayish lesion in foveal region. Ancillary testing revealed disruption of the retinal pigment epithelial (RPE) layer in foveal region and indocyanine green angiography demonstrated evidence of choroidal hypofluorescence suggestive of choroidal infarction in OD. Visual acuity improved from 20/100 to 20/60 in one day and he was treated with tapering doses of oral prednisolone (40 mg) for 3 weeks. Laser pointer with a power of >5 mW caused damage to RPE in the macula. Children should not be given laser pointers as toys especially those with label of danger instructions.

  15. Effect of recrystallization on ion-irradiation hardening and microstructural changes in 15Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Ha, Yoosung; Kimura, Akihiko

    2015-12-01

    The effects of recrystallization on ion-irradiation hardening and microstructural changes were investigated for a 15Cr-ODS ferritic steel. Dual ion-irradiation experiments were performed at 470 °C using 6.4 MeV Fe3+ ions simultaneously with energy-degraded 1 MeV He+ ions. The displacement of damage at 600 nm depth from the specimen surface was 30 dpa. Nano-indentation test with Berkovich type indentation tip was measured by constant stiffness measurement (CSM) technique. Results from nano-indentation tests indicate irradiation hardening in ODS steels even at 470 °C, while it wasn't observed in reduced activation ferritic steel. Recrystallized ODS steel shows a larger irradiation hardening, which is considered to be due to the reduction of grain boundaries and interfaces of matrix/oxide particles. In 20% cold rolled ODS steel after recrystallization, both the hardening and bubble number density were lower than those of recrystallized ODS steel, suggesting that dislocations generated by cold rolling suppress bubble formation. Based on the estimation of irradiation hardening from TEM observation results, it is considered that the bubbles are not the main factor controlling ion-irradiation hardening.

  16. Vapor-phase catalytic oxidesulfurization (ODS) of organosulfur compounds over supported metal oxide catalysts

    NASA Astrophysics Data System (ADS)

    Choi, Sukwon

    Sulfur in transportation fuels remains a leading source of SOx emissions from vehicle engines and is a major source of air pollution. The very low levels of sulfur globally mandated for transportation fuels in the near future cannot be achieved by current practices of hydrodesulfurization (HDS) for sulfur removal, which operate under severe conditions (high T, P) and use valuable H2. Novel vapor-phase catalytic oxidesulfurization (ODS) processes of selectively oxidizing various organosulfur compounds (carbonyl sulfide, carbon disulfide, methanethiol, dimethyl sulfide (DMS), dimethyl disulfide (DMDS), thiophene, 2,5-dimenthylthiophene) typically found in various industrial streams (e.g., petroleum refining, pulp and paper) into valuable chemical intermediates (H 2CO, CO, H2, maleic anhydride and concentrated SO2) has been extensively studied. This research has primarily focused on establishing the fundamental kinetics and mechanisms of these selective oxidation reactions over well-defined supported metal oxide catalysts. The selective oxidation reactions of COS + O2 → CO + SO2; 2CS2 + 5O2 → 2CO + 4SO2; CH3SH + 2O 2 → H2CO + SO2 + H2O; C4 H4S + 3O2 → C4H2O 3 + H2O + SO2; were studied. Raman spectroscopy revealed that the supported metal oxide phases were 100% dispersed on the oxide substrate. All the catalysts were highly active and selective for the oxidesulfurization of carbonyl sulfide, carbon disulfide, methanethiol, and thiophene between 290--330°C, 230--270°C, 350--400°C, and 250--400°C, respectively and did not deactivate. The TOFs (turnover frequency, normalized activity per active catalytic site) for all ODS reactions over supported vanadia catalysts, only containing molecularly dispersed surface vanadia species, varied within one order of magnitude and revealed the V-O-Support bridging bond was involved in the critical rate-determining kinetic steps. The surface reaction mechanism for each reaction was revealed by in situ IR (infrared) and

  17. Development of Short-Wavelength Far-Infrared Lasers and Optical Elements for Plasma Diagnostics

    NASA Astrophysics Data System (ADS)

    Nakayama, Kazuya; Tomimoto, Masahiro; Okajima, Shigeki; Kawahata, Kazuo; Tanaka, Kenji; Tokuzawa, Tokihiko; Akiyama, Tsuyoshi; Ito, Yasuhiko

    Powerful 48- and 57-μm CH3OD lasers pumped by a 9R(8) CO2 laser have been developed to establish a new two-color FIR laser interferometer system for high density and large volume plasma diagnostics. To design the collimated beams for the interferometer, the beam profiles and the divergence angles have been measured for the 48- and 57-μm CH3OD lasers oscillated simultaneously. Water vapor absorptions for the laser wavelengths have been measured at 22 °C C to realize an efficient transmission line. Optical constants and transmittance and reflectance of crystal quartz, silicon, CVD-diamond, polyethylene sheet, Mylar film, TPX plate, metal mesh and wire grid have been measured to design the optical components (observation windows and beam splitters) in the 48- and 57-μm laser interferometer system.

  18. Direct correlation between morphology of (Fe,Cr) 23C 6 precipitates and impact behavior of ODS steels

    NASA Astrophysics Data System (ADS)

    Klimiankou, M.; Lindau, R.; Möslang, A.

    2007-08-01

    The microstructure of ODS steels was investigated after different thermal and thermo-mechanical treatments by means of transmission electron microscopy (TEM) and analytical TEM techniques, including energy-dispersive X-ray (EDX) mapping of the elemental distribution at the nanometer scale. In 'as-HIPped' first generation ODS-Eurofer steel the grain boundaries were decorated with Cr-rich precipitates of M 23C 6 type. In addition, EDX mapping showed Cr-depleted areas at grain boundaries. Thermal and thermo-mechanical treatments of the ODS material affect the size, composition and spatial distribution of the precipitates. Depending on the treatments, the morphology and density of the M 23C 6 can be systematically varied. A significant decrease in ductile-to-brittle-transition-temperature (DBTT) in impact tests and an improvement in the tensile ductility at high temperature can be directly linked to the changes in precipitate morphology and size.

  19. Formation mechanism and the role of nanoparticles in Fe-Cr ODS steels developed for radiation tolerance

    SciTech Connect

    Hsiung, Luke L.; Fluss, Michael J.; Tumey, Scott J.; Choi, B. William; Serruys, Yves; Willaime, Francois; Kimura, Akihiko

    2010-11-01

    Structures of nanoparticles in Fe-16Cr-4.5Al-0.3Ti-2W-0.37Y{sub 2}O{sub 3} (K3) and Fe-20Cr-4.5Al-0.34Ti-0.5Y{sub 2}O{sub 3} (MA956) oxide dispersion strengthened (ODS) ferritic steels produced by mechanical alloying (MA) and followed by hot extrusion have been studied using high-resolution transmission electron microscopy (HRTEM) techniques to understand the formation mechanism of nanoparticles in MA/ODS steels. The observations of Y-Al-O complex-oxide nanoparticles in both ODS steels imply that decomposition of Y{sub 2}O{sub 3} in association with internal oxidation of Al occurred during mechanical alloying. While the majority of oxide nanoparticles formed in both steels is Y{sub 4}Al{sub 2}O{sub 9}, a few oxide particles of YAlO{sub 3} are also observed occasionally. These results reveal that Ti (0.3 wt %) plays an insignificant role in forming oxide nanoparticles in the presence of Al (4.5 wt %). HRTEM observations of crystalline nanoparticles larger than {approx}2 nm and amorphous or disordered cluster domains smaller than {approx}2 nm provide an insight into the formation mechanism of oxide nanoparticle in MA/ODS steels, which we believe from our observations involves solid-state amorphization and recrystallization. The role of nanoparticles in suppressing radiation-induced swelling is revealed through TEM examinations of cavity distributions in ion-irradiated Fe-14Cr and K3-ODS ferritic steels. HRTEM observations of helium-filled cavities (helium bubbles) preferably trapped at nanoscale oxide particles and clusters in ion-irradiated K3-ODS are presented.

  20. Impact of friction stir welding on the microstructure of ODS steel

    NASA Astrophysics Data System (ADS)

    Dawson, H.; Serrano, M.; Cater, S.; Iqbal, N.; Almásy, L.; Tian, Q.; Jimenez-Melero, E.

    2017-04-01

    We have assessed the impact of the welding parameters on the nano-sized oxide dispersion and the grain size in the matrix of an ODS steel after friction stir welding. Our results, based on combined small angle neutron scattering and electron microscopy, reveal a decrease in the volume fraction of the particles smaller than 80 nm in the welds, mainly due to particle agglomeration. The increase in tool rotation speed or decrease in transverse speed leads to a higher reduction in nano-sized particle fraction, and additionally to the occurrence of particle melting. The dependence of the average grain size in the matrix on the particle volume fraction follows a Zener pinning-type relationship. This result points to the principal role that the particles have in pinning grain boundary movement, and consequently in controlling the grain size during welding.

  1. Study of radiation damage in ODS steels by positron annihilation spectroscopy

    NASA Astrophysics Data System (ADS)

    Bartošová, I.; Bouhaddane, A.; Dománková, M.; Slugeň, V.; Wall, D.; Selim, F. A.

    2016-01-01

    Microstructure of various oxide-dispersion-strengthened (ODS) steels with 15% chromium content was studied in term of vacancy defects presence and their accumulation after defined irradiation treatment, respectively. Studied materials originated from Kyoto University and studied via IAEA collaborative project. Samples were characterized “as received” by positron annihilation lifetime spectroscopy and their microstructure was examined by transmission electron microscopy as well. Samples were afterwards irradiated in Washington State University Nuclear Radiation Center via a strong gamma source (6TBq). Damage induced by gamma irradiation was evaluated by positron lifetime measurements in emphasis on defect accumulation in the materials. We have demonstrated strong defect production induced by gamma irradiation which results from positron measurement data.

  2. Reactions of Deuterated Methanol (CD3OD) on Fe3O4(111)

    SciTech Connect

    Li, Zhisheng; Potapenko, Denis V.; Rim, Kwang T.; Flytzani-Stephanopoulos, Maria; Flynn, George; Osgood, Richard; Wen, Xiaodong; Batista, Enrique R.

    2015-01-15

    We report an experimental and theoretical investigation of the decomposition (partial oxidation) of deuterated methanol (CD3OD) on a single-crystal Fe3O4(111) surface. The crystal surface contains majority areas of a Fe-terminated Fe3O4(111) surface as well as smaller regions of O-terminated FeO(111) or biphase surface reconstruction. Our investigation uses a combination of scanning tunneling microscopy, temperature-programmed desorption, and density functional theory calculations to examine the surface reactions and adsorbates as a function of coverage. Our studies show that the reaction of methanol on this iron–oxide surface is highly sensitive to atomic-level surface reconstructions

  3. Radiation induced microstructures in ODS 316 austenitic steel under dual-beam ions

    NASA Astrophysics Data System (ADS)

    Zhang, He Ken; Yao, Zhongwen; Zhou, Zhangjian; Wang, Man; Kaitasov, Odile; Daymond, Mark R.

    2014-12-01

    An ODS 316 austenitic steel was fabricated and irradiated using dual ion beams (1 MeV Kr+ and 15 keV He+) with in-situ transmission electron microscope (TEM) observation. Cavities formed at a low dose in samples irradiated with simultaneous helium injection. It was found that Y-Ti-O particles acted as strong traps for cavity formation at low doses. Helium exhibited a significant effect on cavity development. Cavities were also preferentially nucleated along grain boundaries, phase boundaries and twin boundaries. Irradiation induced lattice defects mainly consisted of small 1/2<1 1 0> perfect loops and 1/3<1 1 1> Frank loops. An increment of helium injection rate also greatly enhanced the Frank loop growth. Small (<10 nm) Y-Ti-O particles were found to be unstable after irradiation to high doses. M23C6 precipitates were observed after irradiation and helium might play a major role in their formation.

  4. Joining a Ni-based creep-resistant (ODS) alloy by brazing

    NASA Astrophysics Data System (ADS)

    Bucklow, I. A.

    Joints are produced in a fine-grained Ni oxide-dispersion-strengthened (ODS) alloy by means of brazing alloys with and without boron, and the resulting joints are studied mechanographically. The brazing alloys employed are either sputtered coatings or foils, and brazing is conducted in a vacuum for approximately two hours. The resulting joints are examined during the process by mass spectrometry and afterwards by means of metallographic observation following etching in glyceregia. Premature and uncontrolled recrystallization of the parent metal is noted in the samples brazed with alloys obtaining boron. The 2-micron braze coating used minimize second-phase formation and dispersoid agglomerations, and the 25-micron brazing foils lead to high porosity and dispersoid aggregation due to excessive melting. Recrystallization of the parent metal near brazing zones is concluded to be undesirable although is does not necessarily influence the quality of the joint.

  5. Polarised Photon Beams for the BGO-OD Experiment at ELSA

    NASA Astrophysics Data System (ADS)

    Zimmermann, T.; Bella, A.; Alef, S.; Bayadilov, D.; Beck, R.; Becker, M.; Bielefeldt, P.; Boese, S.; Braghieri, A.; Brinkmann, K.; Cole, P.; Curciarello, F.; De Leo, V.; Di Salvo, R.; Dutz, H.; Elsner, D.; Fantini, A.; Freyermuth, O.; Friedrich, S.; Frommberger, F.; Ganenko, V.; Gervino, G.; Ghio, F.; Giardina, G.; Goertz, S.; Gridnev, A.; Gutz, E.; Hammann, D.; Hannappel, J.; Hartmann, P.; Hillert, W.; Ignatov, A.; Jahn, R.; Joosten, R.; Jude, T. C.; Klein, F.; Koop, K.; Krusche, B.; Lapik, A.; Levi Sandri, P.; Lopatin, I. V.; Mandaglio, G.; Messi, F.; Messi, R.; Metag, V.; Moricciani, D.; Mushkarenkov, A.; Nanova, M.; Nedorezov, V.; Novinskiy, D.; Pedroni, P.; Reitz, B.; Romaniuk, M.; Rostomyan, T.; Rudnev, N.; Schaerf, C.; Scheluchin, G.; Schmieden, H.; Stugelev, A.; Sumachev, V.; Tarakanov, V.; Vegna, V.; Walther, D.; Watts, D.; Zaunick, H.

    The new BGO-OD experiment at the electron accelerator ELSA, of the University of Bonn, is designed to study the reaction dynamics of nucleon excitations in meson photoproduction. It consists of a central BGO calorimeter with a magnetic spectrometer in forward direction. The physics programme includes the measurement of polarisation observables using linearly and circularly polarised photon beams. Linear polarisation is obtained by coherent bremsstrahlung off a diamond crystal, and circular polarisation is obtained via bremsstrahlung from longitudinally polarised electrons. The degree of linear polarisation is determined from the bremsstrahlung spectrum itself. To determine the polarisation of the circularly polarised photon beam, the polarisation of the electron beam is measured by a Møller polarimeter. As a preliminary consistency check, the (linear) polarisation observable, Σ, was compared to world data for π0 and η photoproduction. To determine the degree of circular polarisation, a Møller polarimeter was setup and first measurements of the electron beam polarisation performed.

  6. Front-end electronics for the tagger of the BGO-OD experiment

    NASA Astrophysics Data System (ADS)

    Messi, Francesco

    2013-08-01

    The BGO-OD experiment is intended for the systematic investigation of the photo-production of mesons off the nucleon. The experiment will use bremsstrahlung photons from an e- beam incident upon a thin radiator. The photon energy will be measured via the deflection of the electrons in the magnetic field of a photon tagger. The B-FrED is a 16 channel double-threshold discriminator and shaper board designed as Front-End Electronics for the new Tagger detector of the experiment. It is a 6U-VME form factor card. The analog input stage has 1.7 GHz bandwidth. The output stage provides two LVDS signals with an expected jitter of ∼ 8 ps with respect to the input signal. The threshold settings are managed by a micro-controller which is remotely accessible through Ethernet.

  7. Progress toward determining the potential of ODS alloys for gas turbine applications

    NASA Technical Reports Server (NTRS)

    Dreshfield, R. L.; Hoppin, G., III; Sheffler, K.

    1983-01-01

    The Materials for Advanced Turbine Engine (MATE) Program managed by the NASA Lewis Research Center is supporting two projects to evaluate the potential of oxide dispersion strengthened (ODS) alloys for aircraft gas turbine applications. One project involves the evaluation of Incoloy (TM) MA-956 for application as a combustor liner material. An assessment of advanced engine potential will be conducted by means of a test in a P&WA 2037 turbofan engine. The other project involves the evaluation of Inconel (TM) MA 6000 for application as a high pressure turbine blade material and includes a test in a Garrett TFE 731 turbofan engine. Both projects are progressing toward these engine tests in 1984.

  8. High-temperature corrosion behavior of coatings and ODS alloys based on Fe{sub 3}Al

    SciTech Connect

    Tortorelli, P.F.; Pint, B.A.; Wright, I.G.

    1996-06-01

    Iron aluminides containing greater than about 20-25 @ % Al have oxidation/sulfidation resistance at temperatures well above those at which these alloys have adequate mechanical strength. In addition to alloying modifications for improved creep resistance of wrought material, this strength limitation is being addressed by development of oxide-dispersion- strengthened (ODS) iron aluminides and by evaluation of Fe{sub 3}Al alloy compositions as coatings or claddings on higher-strength, less corrosion-resistant materials. As part of these efforts, the high-temperature corrosion behavior of iron-aluminide weld overlays and ODS alloys is being characterized and compared to previous results for ingot-processed material.

  9. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    SciTech Connect

    Nelson, William C.; Stegen, James C.

    2015-07-21

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. ‘Housekeeping’ genes and genes for biosynthesis of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum.

  10. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    DOE PAGES

    Nelson, William C.; Stegen, James C.

    2015-07-21

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in a broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. “Housekeeping” genes and genes for biosynthesismore » of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides, and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle, or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest that the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum.« less

  11. Evaluation of Pb-17Li compatibility of ODS Fe-12Cr-5Al alloys

    NASA Astrophysics Data System (ADS)

    Unocic, Kinga A.; Hoelzer, David T.

    2016-10-01

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb-17Li and He) blanket concept requires improved Pb-17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y2O3 (125Y), (2) Y2O3 + ZrO2 (125YZ), (3) Y2O3 + HfO2 (125YH), and (4) Y2O3 + TiO2 (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb-17Li for 1000 h at 700 °C. Alloys showed promising compatibility with Pb-17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experienced the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO2 on all four alloys. A small decrease (∼1 at.%) in Al content beneath the oxide scale was observed in all four ODS alloys, which extended 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO2 product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb-17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module.

  12. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    SciTech Connect

    Nelson, William C.; Stegen, James C.

    2015-07-21

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in a broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. “Housekeeping” genes and genes for biosynthesis of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides, and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle, or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest that the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum.

  13. Irradiation hardening of ODS ferritic steels under helium implantation and heavy-ion irradiation

    NASA Astrophysics Data System (ADS)

    Zhang, Hengqing; Zhang, Chonghong; Yang, Yitao; Meng, Yancheng; Jang, Jinsung; Kimura, Akihiko

    2014-12-01

    Irradiation hardening of ODS ferritic steels after multi-energy He-ion implantation, or after irradiation with energetic heavy ions including Xe and Bi-ions was investigated with nano-indentation technique. Three kinds of high-Cr ODS ferritic steels including the commercial MA956 (19Cr-3.5Al), the 16Cr-0.1Ti and the 16Cr-3.5Al-0.1Zr were used. Data of nano-hardness were analyzed with an approach based on Nix-Gao model. The depth profiles of nano-hardness can be understood by the indentation size effect (ISE) in specimens of MA956 implanted with multi-energy He-ions or irradiated with 328 MeV Xe ions, which produced a plateau damage profile in the near-surface region. However, the damage gradient overlaps the ISE in the specimens irradiated with 9.45 Bi ions. The dose dependence of the nano-hardness shows a rapid increase at low doses and a slowdown at higher doses. An 1/2-power law dependence on dpa level is obtained. The discrepancy in nano-hardness between the helium implantation and Xe-ion irradiation can be understood by using the average damage level instead of the peak dpa level. Helium-implantation to a high dose (7400 appm/0.5 dpa) causes an additional hardening, which is possibly attributed to the impediment of motion dislocations by helium bubbles formed in high concentration in specimens.

  14. Evaluation of Pb-17Li compatibility of ODS Fe-12Cr-5Al alloys

    DOE PAGES

    Unocic, Kinga A.; Hoelzer, David T.

    2016-07-09

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb–17Li and He) blanket concept requires improved Pb–17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y2O3 (125Y), (2) Y2O3+ZrO2 (125YZ), (3) Y2O3+HfO2 (125YH), and (4) Y2O3+TiO2 (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb–17Li for 1000 h at 700°C. Alloys showed promising compatibility with Pb–17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experiencedmore » the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO2 on all four alloys. A small decrease (~1 at.%) in Al content beneath the oxide scale was observed in all 4 ODS alloys, which extended through 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO2 product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb–17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module.« less

  15. Evaluation of Pb-17Li compatibility of ODS Fe-12Cr-5Al alloys

    SciTech Connect

    Unocic, Kinga A.; Hoelzer, David T.

    2016-07-09

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb–17Li and He) blanket concept requires improved Pb–17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y2O3 (125Y), (2) Y2O3+ZrO2 (125YZ), (3) Y2O3+HfO2 (125YH), and (4) Y2O3+TiO2 (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb–17Li for 1000 h at 700°C. Alloys showed promising compatibility with Pb–17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experienced the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO2 on all four alloys. A small decrease (~1 at.%) in Al content beneath the oxide scale was observed in all 4 ODS alloys, which extended through 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO2 product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb–17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module.

  16. Advanced TEM characterization of oxide nanoparticles in ODS Fe–12Cr–5Al alloys

    DOE PAGES

    Unocic, Kinga A; Hoelzer, David T; Pint, Bruce A

    2016-01-01

    For oxide nanoparticles present in three oxide-dispersion-strengthened (ODS) Fe–12Cr–5Al alloys containing additions of (1) Y2O3 (125Y), (2) Y2O3 + ZrO2 (125YZ), and (3) Y2O3 + HfO2 (125YH), were investigated using transmission and scanning transmission electron microscopy. Furthermore, in all three alloys nano-sized (<3.5 nm) oxide particles distributed uniformly throughout the microstructure were characterized using advanced electron microscopy techniques. In the 125Y alloy, mainly Al2O3 and yttrium–aluminum garnet (YAG) phases (Y3Al5O12) were present, while in the 125YZ alloy, additional Zr(C,N) precipitates were identified. The 125YH alloy had the most complex precipitation sequence whereby in addition to the YAG and Al2O3 phases,more » Hf(C,N), Y2Hf2O7, and HfO2 precipitates were also found. The presence of HfO2 was mainly due to the incomplete incorporation of HfO2 powder during mechanical alloying of the 125YH alloy. The alloy having the highest total number density of the oxides, the smallest grain size, and the highest Vickers hardness was the 125YZ alloy indicating, that Y2O3 + ZrO2 additions had the strongest effect on grain size and tensile properties. Finally, high-temperature mechanical testing will be addressed in the near future, while irradiation studies are underway to investigate the irradiation resistance of these new ODS FeCrAl alloys.« less

  17. Evaluation of Pb-17Li compatibility of ODS Fe-12Cr-5Al alloys

    SciTech Connect

    Unocic, Kinga A.; Hoelzer, David T.

    2016-07-09

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb–17Li and He) blanket concept requires improved Pb–17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y2O3 (125Y), (2) Y2O3+ZrO2 (125YZ), (3) Y2O3+HfO2 (125YH), and (4) Y2O3+TiO2 (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb–17Li for 1000 h at 700°C. Alloys showed promising compatibility with Pb–17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experienced the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO2 on all four alloys. A small decrease (~1 at.%) in Al content beneath the oxide scale was observed in all 4 ODS alloys, which extended through 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO2 product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb–17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module.

  18. Production, microstructure and mechanical properties of two different austenitic ODS steels

    NASA Astrophysics Data System (ADS)

    Gräning, T.; Rieth, M.; Hoffmann, J.; Möslang, A.

    2017-04-01

    This article is to summarize and examine processing parameters of novel developed austenitic oxide dispersed strengthened (ODS) steels. Comparing hot-rolled and extruded conditions after the same degree of deformation after and before annealing, are just some examples to give insights into the complex processing of austenitic ODS steels. One of the major drawbacks of the material is the more sophisticated production process. Due to a ductile matrix material with an increased stickiness during milling, a two-step milling procedure with the use of ZrO2 milling balls was applied to raise the production yield and to use the abrasion of the ZrO2 as an additional element to facilitate the formation of nano-sized precipitates. To get a better understanding how the different powder particle sizes after milling affect final properties, sieving was applied and revealed a serious effect in terms of precipitate size, distribution and mechanical properties. Grain sizes in relation to the precipitate size, annealing time and processing parameters were determined and compared to the mechanical properties. Hardness and tensile test have pointed out, that the precipitate size and number are more important in respect to the ultimate tensile strength than the grain size and that in this study hot-rolled material exhibited the better properties. The investigation of the microstructure illustrated the stability of precipitates during annealing at 1100 °C for 40 h. These heat treatments also led to a consistent grain size, due to the pinning effect of the grain boundaries, caused by precipitates.

  19. The reduced genomes of Parcubacteria (OD1) contain signatures of a symbiotic lifestyle

    PubMed Central

    Nelson, William C.; Stegen, James C.

    2015-01-01

    Candidate phylum OD1 bacteria (also referred to as Parcubacteria) have been identified in a broad range of anoxic environments through community survey analysis. Although none of these species have been isolated in the laboratory, several genome sequences have been reconstructed from metagenomic sequence data and single-cell sequencing. The organisms have small (generally <1 Mb) genomes with severely reduced metabolic capabilities. We have reconstructed 8 partial to near-complete OD1 genomes from oxic groundwater samples, and compared them against existing genomic data. The conserved core gene set comprises 202 genes, or ~28% of the genomic complement. “Housekeeping” genes and genes for biosynthesis of peptidoglycan and Type IV pilus production are conserved. Gene sets for biosynthesis of cofactors, amino acids, nucleotides, and fatty acids are absent entirely or greatly reduced. The only aspects of energy metabolism conserved are the non-oxidative branch of the pentose-phosphate shunt and central glycolysis. These organisms also lack some activities conserved in almost all other known bacterial genomes, including signal recognition particle, pseudouridine synthase A, and FAD synthase. Pan-genome analysis indicates a broad genotypic diversity and perhaps a highly fluid gene complement, indicating historical adaptation to a wide range of growth environments and a high degree of specialization. The genomes were examined for signatures suggesting either a free-living, streamlined lifestyle, or a symbiotic lifestyle. The lack of biosynthetic capabilities and DNA repair, along with the presence of potential attachment and adhesion proteins suggest that the Parcubacteria are ectosymbionts or parasites of other organisms. The wide diversity of genes that potentially mediate cell-cell contact suggests a broad range of partner/prey organisms across the phylum. PMID:26257709

  20. Corrosion property of 9Cr-ODS steel in nitric acid solution for spent nuclear fuel reprocessing

    SciTech Connect

    Takeuchi, M.; Koizumi, T.; Inoue, M.; Koyama, S.I.

    2013-07-01

    Corrosion tests of oxide dispersion strengthened with 9% Cr (9Cr-ODS) steel, which is one of the desirable materials for cladding tube of sodium-cooled fast reactors, in pure nitric acid solution, spent FBR fuel solution, and its simulated solution were performed to understand the corrosion behavior in a spent nuclear fuel reprocessing. In this study, the 9Cr-ODS steel with lower effective chromium content was evaluated to understand the corrosion behavior conservatively. As results, the tube-type specimens of the 9Cr-ODS steels suffered severe weight loss owing to active dissolution at the beginning of the immersion test in pure nitric acid solution in the range from 1 to 3.5 M. In contrast, the weight loss was decreased and they showed a stable corrosion in the higher nitric acid concentration, the dissolved FBR fuel solution, and its simulated solution by passivation. The corrosion rates of the 9Cr-ODS steel in the dissolved FBR fuel solution and its simulated solution were 1-2 mm/y and showed good agreement with each other. The passivation was caused by the shift of corrosion potential to noble side owing to increase in nitric acid concentration or oxidative ions in the dissolved FBR fuel solution and the simulated spent fuel solution. (authors)

  1. A Safe Place to Stay Sharp: Action Learning Meets Cooperative Inquiry in the Service of NHS OD Capacity Building

    ERIC Educational Resources Information Center

    Traeger, James; Norgate, Carolyn

    2015-01-01

    This is an account of practice. It explores the meeting point between action learning and action research, as a way of doing capacity building in organisational development (OD) in the NHS in the UK. The authors were part of a short cooperative inquiry (Heron, J. 1996. "Co-operative Inquiry: Research into the Human Condition." London:…

  2. Effect of solution treatment on the stress rupture property of MA ODS Ni-base superalloy at 760 C

    SciTech Connect

    Park, L.J.; Kim, Y.G.; Hong, S.H.; Haeberle, R.M.; Watwe, A.S.

    1995-10-01

    The strengthening of mechanically alloyed (MA) oxide dispersion strengthened (ODS) Ni-base superalloys is obtained through the precipitation hardening by a Ni{sub 3}(Al, Ti), which is known as {gamma}{prime} phase, at the intermediate temperature region of 760--850 C. The {gamma}{prime} precipitates are ordered FCC (L1{sub 2}) structure and are coherent with the nickel-rich {gamma} matrix having FCC structure. The size, volume fraction and distribution of the {gamma}{prime} precipitates are sensitively related to the heat treatment for precipitation and these parameters can significantly affect the mechanical properties of ODS Ni-base superalloys. The aim of this study was to investigate the effect of solution heat treatment temperature on the {gamma}{prime} precipitate size and stress rupture property of MA ODS Ni-base superalloy. The deformation mechanism of ODS Ni-base superalloy was discussed by observing the interaction between dislocations and {gamma}{prime} precipitates at 760 C.

  3. A Safe Place to Stay Sharp: Action Learning Meets Cooperative Inquiry in the Service of NHS OD Capacity Building

    ERIC Educational Resources Information Center

    Traeger, James; Norgate, Carolyn

    2015-01-01

    This is an account of practice. It explores the meeting point between action learning and action research, as a way of doing capacity building in organisational development (OD) in the NHS in the UK. The authors were part of a short cooperative inquiry (Heron, J. 1996. "Co-operative Inquiry: Research into the Human Condition." London:…

  4. Measuring the Fracture Toughness of TZM and ODS Molybdenum Alloys Using Standard and Sub-Sized Bend Specimens

    SciTech Connect

    Cockeram, B. V.

    2002-12-01

    Oxide Dispersion Strengthened (ODS) and TZM molybdenum have excellent creep resistance and strength at high temperatures in inert atmospheres. Fracture toughness and tensile testing was performed at temperatures between -150 degrees C and 450 degrees C to characterize 6.35 mm thick plate material of ODS and TZM molybdenum. A transition from low fracture toughness values (5.8 to 29.6 MPa square root m) to values greater than 30 MPa square root m is observed for TZM molybdenum in the longitudinal orientation at 100 degrees C and in the transverse orientation at 150 degrees C. These results are consistent with data reported in literature for molybdenum. A transition to low fracture toughness values (less than 30 MPa square root m) was not observed for longitudinal ODS molybdenum at temperatures greater than or equal to -150 degrees C, while a transition to low fracture toughness values (12.6 to 25.4 MPa square root m) was observed for the transverse orientation at room-temperature. The fi ne spacing of La-oxide precipitates that are present in ODS molybdenum result in a transition temperature that is significantly lower than any molybdenum alloy reported to date, with upper bound fracture toughness values that bound the literature data. A comparison of fracture toughness values obtained using a 1T, 0.5T, and 0.25T Charpy shows that a 0.5T Charpy could be used as a sub-sized specimen geometry.

  5. Ion-molecule reaction dynamics: Velocity map imaging studies of N+ and O+ with CD3OD

    NASA Astrophysics Data System (ADS)

    Pei, Linsen; Farrar, James M.

    2015-08-01

    We present a study of the charge transfer reactions of the atomic ions N+and O+ with methanol in the collision energy range from ˜2 to 4 eV. Charge transfer is driven primarily by energy resonance, although the widths of the product kinetic energy distributions suggest that significant interchange between relative translation and product vibration occurs. Charge transfer with CD3OD is more exoergic for N+, and the nascent parent ion products appear to be formed in excited B ˜ and C ˜ electronic states, and fragment to CD2OD+ by internal conversion and vibrational relaxation to the ground electronic state. The internal excitation imparted to the parent ion is sufficient to result in loss of one or two D atoms from the carbon atom. The less exoergic charge transfer reaction of O+ forms nascent parent ions in the excited A ˜ state, and internal conversion to the ground state only results in ejection of single D atom. Selected isotopomers of methanol were employed to identify reaction products, demonstrating that deuterium atom loss from nascent parent ions occurs by C-D bond cleavage. Comparison of the kinetic energy distributions for charge transfer to form CD3OD+ and CD2OD+ by D atom loss with the known dynamics for hydride abstraction from a carbon atom provides strong evidence that the D loss products are formed by dissociative charge transfer rather than hydride (deuteride) transfer. Isotopic labeling also demonstrates that chemical reaction in the N+ + CD3OD system to form NO+ + CD4 does not occur in the energy range of these experiments, contrary to earlier speculation in the literature.

  6. Characterization of Tubing from Advanced ODS alloy (FCRD-NFA1)

    SciTech Connect

    Maloy, Stuart Andrew; Aydogan, Eda; Anderoglu, Osman; Lavender, Curt; Anderson, Iver; Rieken, Joel; Lewandowski, John; Hoelzer, Dave; Odette, George R.

    2016-09-20

    Fabrication methods are being developed and tested for producing fuel clad tubing of the advanced ODS 14YWT and FCRD-NFA1 ferritic alloys. Three fabrication methods were based on plastically deforming a machined thick-wall tube sample of the ODS alloys by pilgering, hydrostatic extrusion or drawing to decrease the outer diameter and wall thickness and increase the length of the final tube. The fourth fabrication method consisted of the additive manufacturing approach involving solid-state spray deposition (SSSD) of ball milled and annealed powder of 14YWT for producing thin-wall tubes. Of the four fabrication methods, two methods were successful at producing tubing for further characterization: production of tubing by high-velocity oxy-fuel spray forming and production of tubing using high-temperature hydrostatic extrusion. The characterization described shows through neutron diffraction the texture produced during extrusion while maintaining the beneficial oxide dispersion. In this research, the parameters for innovative thermal spray deposition and hot extrusion processing methods have been developed to produce the final nanostructured ferritic alloy (NFA) tubes having approximately 0.5 mm wall thickness. Effect of different processing routes on texture and grain boundary characteristics has been investigated. It was found that hydrostatic extrusion results in combination of plane strain and shear deformations which generate rolling textures of α- and γ-fibers on {001}<110> and {111}<110> together with a shear texture of ζ-fiber on {011}<211> and {011}<011>. On the other hand, multi-step plane strain deformation in cross directions leads to a strong rolling textures of θ- and ε-fiber on {001}<110> together with weak γ-fiber on {111}<112>. Even though the amount of the equivalent strain is similar, shear deformation leads to much lower texture indexes compared to the plane strain deformations. Moreover, while 50% of hot rolling brings about a large number of

  7. Advanced TEM characterization of oxide nanoparticles in ODS Fe–12Cr–5Al alloys

    SciTech Connect

    Unocic, Kinga A; Hoelzer, David T; Pint, Bruce A

    2016-01-01

    For oxide nanoparticles present in three oxide-dispersion-strengthened (ODS) Fe–12Cr–5Al alloys containing additions of (1) Y2O3 (125Y), (2) Y2O3 + ZrO2 (125YZ), and (3) Y2O3 + HfO2 (125YH), were investigated using transmission and scanning transmission electron microscopy. Furthermore, in all three alloys nano-sized (<3.5 nm) oxide particles distributed uniformly throughout the microstructure were characterized using advanced electron microscopy techniques. In the 125Y alloy, mainly Al2O3 and yttrium–aluminum garnet (YAG) phases (Y3Al5O12) were present, while in the 125YZ alloy, additional Zr(C,N) precipitates were identified. The 125YH alloy had the most complex precipitation sequence whereby in addition to the YAG and Al2O3 phases, Hf(C,N), Y2Hf2O7, and HfO2 precipitates were also found. The presence of HfO2 was mainly due to the incomplete incorporation of HfO2 powder during mechanical alloying of the 125YH alloy. The alloy having the highest total number density of the oxides, the smallest grain size, and the highest Vickers hardness was the 125YZ alloy indicating, that Y2O3 + ZrO2 additions had the strongest effect on grain size and tensile properties. Finally, high-temperature mechanical testing will be addressed in the near future, while irradiation studies are underway to investigate the irradiation resistance of these new ODS FeCrAl alloys.

  8. Relaxation pathways of the OD stretch fundamental of HOD in liquid H2O

    NASA Astrophysics Data System (ADS)

    Miguel, Beatriz; Zúñiga, José; Requena, Alberto; Bastida, Adolfo

    2016-12-01

    The molecular dynamics with quantum transitions method is used to study the vibrational relaxation of the OD stretching mode of HOD dissolved in liquid H2O water at 303 K. All the vibrational modes of the solute and solvent molecules that participate in the relaxation process are described by quantum mechanics, while the rotational and translational degrees of freedom are treated classically. A modification of the water intramolecular SPC/E (Simple Point Charge/Extended) force field providing vibrational frequencies in solution closer to the experimental values is proposed to analyze the influence of the vibrational energy gaps on the relaxation channels. The relaxation times obtained are in satisfactory agreement with experimental values. The energy transfer during the relaxation process alters significantly the H-bond network around the HOD molecule. The analysis of the vibrational transitions during the relaxation process reveals a complex mechanism which involves the participation of both intra- and intermolecular channels and provides a compromise for the different interpretations of the experimental data reported for this system in recent years.

  9. High temperature Oxidation of ODS alloy with zirconia dispersions synthesized using Arc Plasma Sintering

    NASA Astrophysics Data System (ADS)

    Bandriyana; Sujatno, A.; Salam, R.; Sugeng, B.; Dimyati, A.

    2017-02-01

    Microstructure formation and oxidation behaviour of the Oxide Dispersion Strengthened (ODS) steels for application as structure material in Nuclear Power Plant was investigated. A mixture composed of Fe and 12 wt. % Cr powder with addition of 0.5 and 1 wt.% ZrO2 particles was milled and isostatic pressed to form a sample coin. The coin was then consolidated in the Arc Plasma Sintering (APS) for 4 minutes. The samples were subjected to the high temperature oxidation test in the Magnetic Suspension Balance (MSB). The oxidation test was carried out at 700°C for 6 hours to evaluate the oxide growth in the early stage of it formation by extraction the mass gain curve. The Scanning Electron Microscope (SEM) imaging and X-ray Diffraction Spectroscopy (EDX) elemental mapping were performed to study the microstructure change and compositional distribution. SEM and EDX observation revealed the time dependent development of the Fe-Cr-phases during consolidation. The oxidation rate behaviour of the samples followed the parabolic rate characteristic for inward oxidation process driven by oxygen inward diffusion through the oxide scale with the maximum weight gain around of 60 g/m2. The oxidation resistance was strongly affected by the formation of the oxide protective layer on the surface. In so far, addition of zirconia particles has played no significant role to the oxidation behaviour.

  10. Study of the deformation mechanisms in a Fe-14% Cr ODS alloy

    NASA Astrophysics Data System (ADS)

    Praud, M.; Mompiou, F.; Malaplate, J.; Caillard, D.; Garnier, J.; Steckmeyer, A.; Fournier, B.

    2012-09-01

    In this present work, the plasticity of a rod bar of a 14% Cr ferritic ODS steel is examined through a multiscale approach based on both macroscopic and microscopic results. This bar was elaborated at CEA by powder metallurgy and consolidated by hot extrusion. The microstructure of the material has been characterized. First, the tensile behavior of this material is studied in a wide range of temperatures. Thereafter, through in situ Transmission Electron Microscopy (TEM) straining experiments, dislocation/dislocation and dislocation/precipitates interactions are observed. The collapse of the tensile properties noticed from 400 °C can be explained by a change in the deformation mechanism. At lower temperatures, the hardening seems to be due to the precipitates, dislocations are pinned on oxides. At higher temperatures, the hardening role of the precipitates is still observed, but the dislocations seem to move in a more steady way, thermal activation of dislocations sources is observed and leads to formation of cavities at the grain boundaries.

  11. Structural and chemical evolution in neutron irradiated and helium-injected ferritic ODS PM2000 alloy

    NASA Astrophysics Data System (ADS)

    Jung, Hee Joon; Edwards, Dan J.; Kurtz, Richard J.; Yamamoto, Takuya; Wu, Yuan; Odette, G. Robert

    2017-02-01

    An investigation of the influence of helium on damage evolution under neutron irradiation of an 11 at% Al, 19 at% Cr ODS ferritic PM2000 alloy was carried out in the High Flux Isotope Reactor (HFIR) using a novel in situ helium injection (ISHI) technique. Helium was injected into adjacent TEM discs from thermal neutron 58Ni(nth,γ) 59Ni(nth,α) reactions in a thin NiAl layer. The PM2000 undergoes concurrent displacement damage from the high-energy neutrons. The ISHI technique allows direct comparisons of regions with and without high concentrations of helium since only the side coated with the NiAl experiences helium injection. The corresponding microstructural and microchemical evolutions were characterized using both conventional and scanning transmission electron microscopy techniques. The evolutions observed include formation of dislocation loops and associated helium bubbles, precipitation of a variety of phases, amorphization of the Al2YO3 oxides (which also variously contained internal voids), and several manifestations of solute segregation. Notably, high concentrations of helium had a significant effect on many of these diverse phenomena. These results on PM2000 are compared and contrasted to the evolution of so-called nanostructured ferritic alloys (NFA).

  12. Unusual respiratory capacity and nitrogen metabolism in a Parcubacterium (OD1) of the Candidate Phyla Radiation

    PubMed Central

    Castelle, Cindy J.; Brown, Christopher T.; Thomas, Brian C.; Williams, Kenneth H.; Banfield, Jillian F.

    2017-01-01

    The Candidate Phyla Radiation (CPR) is a large group of bacteria, the scale of which approaches that of all other bacteria. CPR organisms are inferred to depend on other community members for many basic cellular building blocks and all appear to be obligate anaerobes. To date, there has been no evidence for any significant respiratory capacity in an organism from this radiation. Here we report a curated draft genome for ‘Candidatus Parcunitrobacter nitroensis’ a member of the Parcubacteria (OD1) superphylum of the CPR. The genome encodes versatile energy pathways, including fermentative and respiratory capacities, nitrogen and fatty acid metabolism, as well as the first complete electron transport chain described for a member of the CPR. The sequences of all of these enzymes are highly divergent from sequences found in other organisms, suggesting that these capacities were not recently acquired from non-CPR organisms. Although the wide respiration-based repertoire points to a different lifestyle compared to other CPR bacteria, we predict similar obligate dependence on other organisms or the microbial community. The results substantially expand the known metabolic potential of CPR bacteria, although sequence comparisons indicate that these capacities are very rare in members of this radiation. PMID:28067254

  13. High-cycle fatigue properties of the ODS-alloy MA 6000 at 850 C

    SciTech Connect

    Hoffelner, W.; Singer, R.F.

    1985-03-01

    The high cycle fatigue (HCF) and cyclic crack growth rate (CCGR) properties of the dispersion strengthened ODS-alloy MA 6000 were investigated with smooth bars and with fracture mechanics samples at 850 C. The material was very coarse-grained with the grains elongated in the rolling direction. The fatigue limit of samples cut parallel to the grain elongation direction (p-samples) was almost a factor of 2 higher than the one of samples cut transverse to the elongation direction (t-samples). Inclusions were found to be responsible for crack initiation. For p-samples a reasonable agreement between particle size, fatigue limit, and crack growth behavior was found. For t-type samples such an agreement also exists, provided differences in the crack growth behavior of short cracks and long cracks are taken into consideration. The low fatigue strength of t-samples could be linked with low Young's modulus in this direction. The crack propagation rate of long cracks is lower in t-samples than in p-samples due to crack branching along the grain boundaries. HCF-strength of MA 6000 is high compared to conventional cast alloys mainly because of reduced size of crack nucleation sites and higher fatigue threshold stress intensity range, as a result of higher Young's modulus. 15 references.

  14. Oxidation behavior of three commercial ODS alloys at 1200{degrees}C

    SciTech Connect

    Turker, M.; Hughes, T.A.

    1995-12-01

    The isothermal-oxidation behavior of three oxide-dispersion-strengthened (ODS) alloys, viz., MA 956, ODM 751, and PM 2000, has been examined in air at 1200{degrees}C for exposure times up to 4800 hr. During exposure all the alloys formed an external scale of alpha alumina ({alpha}-Al{sub 2}O{sub 3}). The growth rate of alumina on MA 956 was significantly faster than that formed on ODM 751 resulting in an oxide layer which was about twice as thick after 4800 hr. The oxide-grain morphology on MA 956 was essentially equiaxed containing irregularly shaped, titanium-rich particles, whereas the oxide formed on ODM 751 was slightly finer, distinctly columnar and contained elongated yttrium-rich particles. Spalling of the oxide layer occurred after approximately 2400 hr on MA 956, whereas only slight spalling occurred on ODM 751 even after the longest exposure time. Experiments revealed that the initial surface roughness of PM 2000 can contribute significantly to spalling by enabling the growth of highly convoluted scale layers which are mechanically unstable under compressive stresses (buckling). Internal porosity is also observed in all three alloys after exposure. The pores were generally spherical with small Ti-, Al-, Y-rich particles distributed over their internal surfaces. The amount of porosity increases to a maximum and then slowly decreases.

  15. Relaxation pathways of the OD stretch fundamental of HOD in liquid H2O.

    PubMed

    Miguel, Beatriz; Zúñiga, José; Requena, Alberto; Bastida, Adolfo

    2016-12-28

    The molecular dynamics with quantum transitions method is used to study the vibrational relaxation of the OD stretching mode of HOD dissolved in liquid H2O water at 303 K. All the vibrational modes of the solute and solvent molecules that participate in the relaxation process are described by quantum mechanics, while the rotational and translational degrees of freedom are treated classically. A modification of the water intramolecular SPC/E (Simple Point Charge/Extended) force field providing vibrational frequencies in solution closer to the experimental values is proposed to analyze the influence of the vibrational energy gaps on the relaxation channels. The relaxation times obtained are in satisfactory agreement with experimental values. The energy transfer during the relaxation process alters significantly the H-bond network around the HOD molecule. The analysis of the vibrational transitions during the relaxation process reveals a complex mechanism which involves the participation of both intra- and intermolecular channels and provides a compromise for the different interpretations of the experimental data reported for this system in recent years.

  16. Magnetic Structure and Spin Waves in Co2(OD)3Cl

    NASA Astrophysics Data System (ADS)

    Dissanayake, Sachith; Ji, S.; Chan, C.; Ng, T. K.; Lee, J.; Qiu, Y.; Rule, K. C.; Lake, B.; Green, M.; Zheng, X. G.; Lee, S.-H.

    2012-02-01

    We have examined the magnetic structure of Co2(OD)3Cl with magnetic Co^2+ (3d^7; s= 3/2) ions using neutron powder diffraction data. Magnetic structure that yields the best refinement factor is an ``umbrella''-type antiferromagnetic structure with ab-components of magnetic moments in the kagome plane forming a q=0 120^o structure and the moments are canted out of the plane by ˜ 40^o. The magnetic moments in the triangular plane are aligned ferromagnetically along the c-axis. We have performed linear spin wave calculations considering the nearest neighbor interactions J within the kagome plane and JF between the kagome and the triangular plane. The effects of JF/J and the canting angle to the spin wave dispersion was studied thoroughly, to find out an effective spin hamiltonian that explains our inelastic neutron scattering data with two prominent excitation modes centered at 3 meV and 19 meV. Single ion-type anisotropy was also included in the spin hamiltonian to study its effect to the spin wave excitation.

  17. Deuterium ordering found in new ferroelectric compound Co2(OD)3Cl

    NASA Astrophysics Data System (ADS)

    Meng, Dong-Dong; Zheng, Xu-Guang; Liu, Xiao-Dong; Xu, Xing-Liang; Guo, Qi-Xin

    2015-07-01

    A detailed temperature-dependent Raman spectroscopic study revealed a new type of deuterium-order ferroelectrics in a geometrically frustrated magnet Co2(OD)3Cl at Tɛ = 229 K. Significant changes in the parameters of the Raman vibration modes were observed near Tɛ, suggesting a strong phonon-charge coupling. Additional asymmetric phonon bands appeared below around Tɛ, which are consistently interpreted by phonon folding processes due to a small local structural change resulting from the ordering of deuterium. The wavenumber and intensity changes of the Raman-active modes, as well as the normalized intensities of the additional bands, all follow a power-law fit Δω, ΔI, I ∝ (1 - T/TC)2β, wherein TC = 230 K ˜ Tɛ and β = 0.35(2), clearly demonstrating an ordering process below Tɛ. The critical exponent is reminiscent of a second order transition. Our study presents a rare and new type of multiferroic material with ferroelectricity arising from the deuterium ordering in geometrically frustrated magnets.

  18. Effect of microstructure on low cycle fatigue properties of ODS steels

    NASA Astrophysics Data System (ADS)

    Kubena, Ivo; Fournier, Benjamin; Kruml, Tomas

    2012-05-01

    Low cycle fatigue properties at room temperature, 650 °C and 750 °C of three high chromium steels (9%Cr ferritic-martensitic and two 14%Cr ferritic steels) strengthened by oxide dispersion were studied and compared. Cyclic softening/hardening curves, cyclic deformation curves, S-N curves and Coffin-Manson curves are presented together with microstructural observations. Differences in cyclic response, stress level and fatigue life are attributed to differences in the matrix microstructure. The oxide particles stabilize the cyclic response, even if cyclic softening is detected for some experimental conditions. The strength of these steels is discussed in terms of strengthening mechanisms such as grain size effect, particle-dislocations interaction and dislocation density. Comparing three different ODS steels offers an opportunity to tests the contribution of individual mechanisms to the cyclic strength. The reduction of fatigue life in one of the ferritic steels is explained by the presence of large grains, facilitating the fatigue crack nucleation and the early growth.

  19. Mechanical alloying of ODS tungsten heavy alloys and microstructure development of intermetallic compounds

    NASA Astrophysics Data System (ADS)

    Chen, Chun-Liang; Huang, Chun-Lin

    2013-09-01

    Oxide dispersion strengthened tungsten heavy alloys have been used in a wide variety of industrial and military applications due to their high density, strength and stiffness. These alloys have been produced by mechanical alloying, which can provide uniform distribution of nano-oxide particles and an extremely fine grain structure, resulting in the reduction of the sintering temperature. However, the high-energy ball-milling process could introduce iron contamination from the vial and milling media during the procedure. In this study, the W-Ni-Y2O3 alloy was investigated as a function of milling time. The results show that the increase of the Fe/Ni ratio has a significant influence on the microstructural development and material properties. The XRD data reveal considerable solid solubility extension in these powders. The tungsten carbide and iron rich intermetallic compounds were formed after long milling times, which can change the relative density and hardness of the alloy. It is essential that we understand the role of intermetallic phases in the ODS tungsten heavy alloy which determine the material properties and the control of microstructural development.

  20. Anomalous H+ and D+ conductance in H2O-D2O mixtures

    NASA Astrophysics Data System (ADS)

    Weingärtner, H.; Chatzidimttriou-Dreismann, C. A.

    1990-08-01

    A KNOWLEDGE of proton-transfer dynamics and hydrogen-bonding in water and aqueous solutions is necessary for the understanding of many important chemical and biological processes. For example, quantum effects related to proton transfer (or tunnelling) in H+(H2O)n clusters of liquid water (where n = 1,2,· · ·) are known to have a dominant role in the proton conductance mechanism1,2 and are responsible for the high conductances of H+ and OH- in water. A new quantum theoretical approach to this process has been presented3, which is based on the hypothesis that there are quantum correlations4-8 between each H+ and the protons of the surrounding water molecules, leading to the formation of coherent dissipative structures3,8. From further investigations, one of us predicted that an anomalous decrease of H+ conductance in H2O-D2O mixtures would take place9. Having thought of an experiment to test these predictions9 we now report the experimental results and conclude that an anomalous decrease in proton conductance does indeed occur.

  1. Unusual respiratory capacity and nitrogen metabolism in a Parcubacterium (OD1) of the Candidate Phyla Radiation

    DOE PAGES

    Castelle, Cindy J.; Brown, Christopher T.; Thomas, Brian C.; ...

    2017-01-09

    The Candidate Phyla Radiation (CPR) is a large group of bacteria, the scale of which approaches that of all other bacteria. CPR organisms are inferred to depend on other community members for many basic cellular building blocks and all appear to be obligate anaerobes. To date, there has been no evidence for any significant respiratory capacity in an organism from this radiation. Here we report a curated draft genome for Candidatus Parcunitrobacter nitroensis' a member of the Parcubacteria (OD1) superphylum of the CPR. The genome encodes versatile energy pathways, including fermentative and respiratory capacities, nitrogen and fatty acid metabolism, asmore » well as the first complete electron transport chain described for a member of the CPR. The sequences of all of these enzymes are highly divergent from sequences found in other organisms, suggesting that these capacities were not recently acquired from non-CPR organisms. Although the wide respiration-based repertoire points to a different lifestyle compared to other CPR bacteria, we predict similar obligate dependence on other organisms or the microbial community. The results substantially expand the known metabolic potential of CPR bacteria, although sequence comparisons indicate that these capacities are very rare in members of this radiation.« less

  2. Spectrally narrowed lasing of a self-injection KrF excimer laser

    NASA Astrophysics Data System (ADS)

    Shimada, Yasuhiro; Wani, Koichi; Miki, Tadaaki; Kawahara, Hidehito; Mimasu, Mutsumi; Ogata, Yoshiro

    1990-08-01

    Spectrally nantwed lasing of a KrF excimer laser has teen ahieved by a self-injection technique using abeam splitter for power extraction aixi intravity etalons for spectral-narrowing. The laser cavity is divithi into an amplifying branch aix! a spectralnarrowing branch. The spectral bandwidth was narrowed to <3pm FWHM with air-sed etalons placed in the spectral-narrowing branch. A laser propagation model was intrOdUced for describing the laser intensity traveling in the laser cavity. The calculated intensityincident onthe intracavityetalons wassmaller thanthat in theconventional Fabry-Perotcavity withplane-parallel mirrors.

  3. Temporal trends and spatial variations of ozone-depleting substances (ODS) in the Pearl River Delta (PRD) region, southern China

    NASA Astrophysics Data System (ADS)

    Zhang, Yanli; Wang, Xinming; Blake, Donald; Simpson, Isobel

    2014-05-01

    Long-term observation of mixing ratios of ozone-depleting substances (ODS) in ambient air can help to assess the implementation of the Montreal Protocol and Its Amendments in regional and national scales. Here we present our measurement of ODS such as CFCs, HCFCs, halons and other halocarbons in ambient air since 2000 in the Pearl River Delta (PRD) region, one of the most densely populated and highly industrialized regions that was supposed to be a hotspot for ODS emission in China. These halocarbons in the PRD region were found to have 5-348% enhancements when compared to their global background levels. CFC-12 and CFC-11 in the region, for example, were 37-56% and 12-43%, respectively, above their global background levels. CFC replacement compounds showed even larger enhancements. In average mixing ratios of HCFC-22, HCFC-141b, and HCFC-142b were 89%, 87%, and 86% above their background levels of 148 ppt, 12.1 ppt, and 12.1 ppt in the year of 2000, respectively; and 72%, 125%, and 52% over their background levels of 205 ppt, 20.2 ppt, and 20.0 ppt in the year of 2009, respectively. During 2000-2009, CFCs in the PRD region showed decline trends with the decreasing rates of -3.0, -5.9, and -9.4 ppt/yr for CFC-12, CFC-11, and CFC-113, respectively; these rates were faster than that at the global background sites, which were -0.91, -2.12, and -0.69 ppt/yr, respectively. The CFCs substitutes HCFC-22, HCFC-141b, and HCFC-142b, however, showed increasing trends with the increasing rates of 8.0, 2.6, and 0.9 ppt/yr, respectively. HFC-134a, a refrigerant used for mobile air conditioning, showed rapid increase with a rate of 15 ppt/yr from 2000 to 2009 in the region. As for other halocarbons, methyl chloroform and carbon tetrachloride decreased with rates of 21 and 1 ppt/yr during the period. The mixing ratios of methyl chloride in the region showed unusual rapid increase at a rate of 64 ppt/yr when compared to its increasing rate of 1.3 ppt/yr at the global background

  4. Synchrotron-based double imaging photoelectron/photoion coincidence spectroscopy of radicals produced in a flow tube: OH and OD

    DOE PAGES

    Garcia, Gustavo A.; Tang, Xiaofeng; Gil, Jean -Francois; ...

    2015-04-23

    In this study, we present a microwave discharge flow tube coupled with a double imaging electron/ion coincidence device and vacuum ultraviolet (VUV) synchrotron radiation. The system has been applied to the study of the photoelectron spectroscopy of the well-known radicals OH and OD. The coincidence imaging scheme provides a high selectivity and yields the spectra of the pure radicals, removing the ever-present contributions from excess reactants, background, or secondary products, and therefore obviating the need for a prior knowledge of all possible byproducts. The photoelectron spectra encompassing the X3Σ– ground state of the OH+ and OD+ cations have been extractedmore » and the vibrational constants compared satisfactorily to existing literature values. Future advantages of this approach include measurement of high resolution VUV spectroscopy of radicals, their absolute photoionization cross section, and species/isomer identification in chemical reactions as a function of time.« less

  5. Synchrotron-based double imaging photoelectron/photoion coincidence spectroscopy of radicals produced in a flow tube: OH and OD

    SciTech Connect

    Garcia, Gustavo A.; Tang, Xiaofeng; Gil, Jean -Francois; Nahon, Laurent; Ward, Michael; Batut, Sebastien; Fittschen, Christa; Taatjes, Craig A.; Osborn, David L.; Loison, Jean -Christophe

    2015-04-23

    In this study, we present a microwave discharge flow tube coupled with a double imaging electron/ion coincidence device and vacuum ultraviolet (VUV) synchrotron radiation. The system has been applied to the study of the photoelectron spectroscopy of the well-known radicals OH and OD. The coincidence imaging scheme provides a high selectivity and yields the spectra of the pure radicals, removing the ever-present contributions from excess reactants, background, or secondary products, and therefore obviating the need for a prior knowledge of all possible byproducts. The photoelectron spectra encompassing the X3Σ ground state of the OH+ and OD+ cations have been extracted and the vibrational constants compared satisfactorily to existing literature values. Future advantages of this approach include measurement of high resolution VUV spectroscopy of radicals, their absolute photoionization cross section, and species/isomer identification in chemical reactions as a function of time.

  6. Synchrotron-based double imaging photoelectron/photoion coincidence spectroscopy of radicals produced in a flow tube: OH and OD

    SciTech Connect

    Garcia, Gustavo A.; Tang, Xiaofeng; Gil, Jean-François; Nahon, Laurent; Ward, Michael; Batut, Sebastien; Fittschen, Christa; Taatjes, Craig A.; Osborn, David L.; Loison, Jean-Christophe

    2015-04-28

    We present a microwave discharge flow tube coupled with a double imaging electron/ion coincidence device and vacuum ultraviolet (VUV) synchrotron radiation. The system has been applied to the study of the photoelectron spectroscopy of the well-known radicals OH and OD. The coincidence imaging scheme provides a high selectivity and yields the spectra of the pure radicals, removing the ever-present contributions from excess reactants, background, or secondary products, and therefore obviating the need for a prior knowledge of all possible byproducts. The photoelectron spectra encompassing the X{sup 3}Σ{sup −} ground state of the OH{sup +} and OD{sup +} cations have been extracted and the vibrational constants compared satisfactorily to existing literature values. Future advantages of this approach include measurement of high resolution VUV spectroscopy of radicals, their absolute photoionization cross section, and species/isomer identification in chemical reactions as a function of time.

  7. A photoionization study of OH and OD from 680A to 950A: An analysis of the Rydberg series

    NASA Technical Reports Server (NTRS)

    Cutler, J. N.; He, Z. X.; Samson, J. A. R.

    1994-01-01

    The photoionization spectra of OH(+) and OD(+) have been reported from 680 to 950 A (18.23 to 13.05 eV) at a wavelength resolution of 0.07 A. Through interpretation of both spectra, the Rydberg series and their higher vibrational members have been reported for three of the excited ionic states, a(sup 1)Delta, A(sup 3)Pi(i), and b(sup 1) Sigma(sup +). A vibrational progression has also been observed in both OH(+) and OD(+) which is apparently related to a fourth excited ionic state, c(sup 1)Pi. Finally, the dissociative ionization limits, corrected to 0 K,for H2O AND D2O have been measured to be 18.11+/-0.01 and 18.21+/-0.01 eV, respectively, and shown to be in good agreement with previously reported results.

  8. The H2O/D2O isotope effect in crystalline lanthanide sulfates at photo-, radio-, and triboluminescence

    NASA Astrophysics Data System (ADS)

    Sharipov, G. L.; Tukhbatullin, A. A.; Mescheryakova, E. S.

    2016-02-01

    We comparatively studied the H2O/D2O isotope effect of lanthanide sulfate crystallohydrates on photo-, radio-, and triboluminescence and lifetimes of the excited Ln3+ ions. Replacing H2O by D2O leads to an increase in the luminescence intensity whereas this process does not affect the maxima positions in photo-, radio-, and triboluminescence spectra. This isotope effect agrees with the known concepts of changes in luminescence quantum yields of the Ln3+ ions being the main emitters. The bands of OH and OD radicals arise in triboluminescence spectra of lanthanide sulfate crystallohydrates (with H2O or D2O) registered in argon atmosphere in UV region. This supports the proposition that water destruction occurs at the degradation of the crystallohydrates.

  9. Microchip Lasers

    DTIC Science & Technology

    2016-10-31

    physics that underlies their performance, typical operating parameters for the devices, and several of their applications . Keywords Composite-cavity...laser, Diode -pumped laser, Laser, Microchip laser, Miniature laser, Monolithic laser, Passively Q-switched laser, Q-switched laser, Saturable...cavity mirrors are deposited directly on the gain medium and the laser is pumped with a diode laser, either directly, as shown in Fig. 1, or via an

  10. Microstructural study of an ODS stainless steel obtained by Hot Uni-axial Pressing

    NASA Astrophysics Data System (ADS)

    Sornin, D.; Grosdidier, T.; Malaplate, J.; Tiba, I.; Bonnaillie, P.; Allain-Bonasso, N.; Nunes, D.

    2013-08-01

    This study focuses on the consolidation of an ODS Fe-14Cr-1W-0.3Ti-0.3Y2O3 alloy obtained by powder metallurgy. The powder was sintered for 1 h at 1100 °C in a soft steel can and compacted by Hot Uni-axial Pressing (HUP) under 900 MPa within less than 5 s before air cooling. The HUPped material microstructure is prospected to determine relative density as well as microstructure and nano-precipitation. The HUP, which mimics the early stage of hot extrusion (HE), produces a fully dense metallurgical state. The HUPped microstructure is shown to be rather similar to the one obtained by HIPping for equivalent dwell time at high temperature. In both cases heterogeneous grain size microstructure was obtained. It is shown that the bigger grains come from static recrystallization occurring during the dwell time in furnace. Compared to HIP, the effect of the HUP is mainly to introduce intra-granular misorientations within these large recrystallized grains. During Hot Unidirectional Pressing the initially loose powder is fully consolidated. The relative density is rather similar to the HE and HIP process. Even with a uni-axial loading the HUPed material is homogeneous and does not presents any gradients of hardness. The obtained microstructure for the HUPed shows a bimodal grain size distribution and precipitates strings at grain boundaries. This material can be compared to HIP of similar composition grades [10]. Large grains are issued from an incomplete static recrystallization. Precipitation of nano-clusters is very similar for HUPed and HE materials. Nanometer scale precipitates are observed both within the large and small grains. One of the effects of the HUP compared to pure heat treatment is that the large grains that recrystallized during the early stages of the heat treatment present significant internal crystallographic misorientations. This is due to the plastic strain generated by the rapid compaction during HUP consolidation process.

  11. Microstructural characterization of a new mechanically alloyed Ni-base ODS superalloy powder

    SciTech Connect

    Seyyed Aghamiri, S.M.; Shahverdi, H.R.; Ukai, S.; Oono, N.; Taya, K.; Miura, S.; Hayashi, S.; Okuda, T.

    2015-02-15

    The microstructure of a new Ni-base oxide dispersion strengthened superalloy powder was studied for high temperature gas turbine applications after the mechanical alloying process. In this study, an atomized powder with a composition similar to the CMSX-10 superalloy was mechanically alloyed with yttria and Hf powders. The mechanically alloyed powder included only the supersaturated solid solution γ phase without γ′ and yttria provided by severe plastic deformation, while after the 3-step aging, the γ′ phase was precipitated due to the partitioning of Al and Ta to the γ′ and Co, Cr, Re, W, and Mo to the γ phase. Mechanical alloying modified the morphology of γ′ to the new coherent γ–γ′ nanoscale lamellar structure to minimize the elastic strain energy of the precipitation, which yielded a low lattice misfit of 0.16% at high temperature. The γ′ lamellae aligned preferentially along the elastically soft [100] direction. Also, the precipitated oxide particles were refined in the γ phase by adding Hf from large incoherent YAlO{sub 3} to fine semi-coherent Y{sub 2}Hf{sub 2}O{sub 7} oxide particles with the average size of 7 nm and low interparticle spacing of 76 nm. - Highlights: • A new Ni-base ODS superalloy powder was produced by mechanical alloying. • The nanoscale γ–γ′ lamellar structure was precipitated after the aging treatment. • Fine semi-coherent Y{sub 2}Hf{sub 2}O{sub 7} oxide particles were precipitated by addition of Hf.

  12. Influence of hot rolling and high speed hydrostatic extrusion on the microstructure and mechanical properties of an ODS RAF steel

    NASA Astrophysics Data System (ADS)

    Oksiuta, Z.; Lewandowska, M.; Kurzydlowski, K. J.; Baluc, N.

    2011-02-01

    An argon gas atomized, pre-alloyed Fe-14Cr-2W-0.3Ti (wt.%) reduced activation ferritic (RAF) steel powder was mechanically alloyed with 0.3wt.% Y 2O 3 nano-particles in an attritor ball mill and consolidated by hot isostatic pressing at 1150 °C under a pressure of 200 MPa for 3 h. In the aim to improve its mechanical properties the ODS steel was then submitted to a thermo-mechanical treatment (TMT): hot rolling (HR) at 850 °C or high speed hydrostatic extrusion (HSHE) at 900 °C, followed by heat treatment (HT). Transmission electron microscopy (TEM) observations of the ODS alloys after TMT and heat treatment revealed the presence of elongated grains in the longitudinal direction, with an average width of 8 μm and an average length of 75 μm, and equiaxed grains, a few microns in diameter, in the transverse direction. Two populations of oxide particles were observed by TEM: large Ti-Al-O particles, up to 250 nm in diameter, usually located at the grain boundaries and small Y-Ti-O nanoclusters, about 2.5 nm in diameter, uniformly distributed in the matrix. Charpy impact tests revealed that the HSHE material exhibits a larger upper shelf energy (5.8 J) than the HR material (2.9 J). The ductile-to-brittle transition temperature of both alloys is relatively high, in the range of 55-72 °C. Tensile mechanical properties of both ODS alloys were found satisfactory over the full range of investigated temperatures (23-750 °C). The HSHE material exhibits better tensile strength and ductility than the HR material. These results indicate that HSHE can be considered as a promising TMT method for improving the mechanical properties of ODS RAF steels.

  13. Dynamics of the reactions of O(1D) with CD3OH and CH3OD studied with time-resolved Fourier-transform IR spectroscopy

    NASA Astrophysics Data System (ADS)

    Huang, Chong-Kai; Xu, Zhen-Feng; Nakajima, Masakazu; Nguyen, Hue M. T.; Lin, M. C.; Tsuchiya, Soji; Lee, Yuan-Pern

    2012-10-01

    We investigated the reactivity of O(1D) towards two types of hydrogen atoms in CH3OH. The reaction was initiated on irradiation of a flowing mixture of O3 and CD3OH or CH3OD at 248 nm. Relative vibration-rotational populations of OH and OD (1 ≤ v ≤ 4) states were determined from their infrared emission recorded with a step-scan time-resolved Fourier-transform spectrometer. In O(1D) + CD3OH, the rotational distribution of OD is nearly Boltzmann, whereas that of OH is bimodal; the product ratio [OH]/[OD] is 1.56 ± 0.36. In O(1D) + CH3OD, the rotational distribution of OH is nearly Boltzmann, whereas that of OD is bimodal; the product ratio [OH]/[OD] is 0.59 ± 0.14. Quantum-chemical calculations of the potential energy and microcanonical rate coefficients of various channels indicate that the abstraction channels are unimportant and O(1D) inserts into the C-H and O-H bonds of CH3OH to form HOCH2OH and CH3OOH, respectively. The observed three channels of OH are consistent with those produced via decomposition of the newly formed OH or the original OH moiety in HOCH2OH or decomposition of CH3OOH. The former decomposition channel of HOCH2OH produces vibrationally more excited OH because of incomplete intramolecular vibrational relaxation, and decomposition of CH3COOH produces OH with greater rotational excitation, likely due to a large torque angle during dissociation. The predicted [OH]/[OD] ratios are 1.31 and 0.61 for O(1D) + CD3OH and CH3OD, respectively, at collision energy of 26 kJ mol-1, in satisfactory agreement with the experimental results. These predicted product ratios vary weakly with collision energy.

  14. Microstructure of HIPed and SPSed 9Cr-ODS steel and its effect on helium bubble formation

    NASA Astrophysics Data System (ADS)

    Lu, Chenyang; Lu, Zheng; Xie, Rui; Liu, Chunming; Wang, Lumin

    2016-06-01

    Two 9Cr-ODS steels with the same nominal composition were consolidated by hot isostatic pressing (HIP, named COS-1) and spark plasma sintering (SPS, named COS-2). Helium ions were implanted into COS-1, COS-2 and non-ODS Eurofer 97 steels up at 673 K. Microstructures before and after helium ion implantations were carefully characterized. The results show a bimodal grain size distribution in COS-2 and a more uniform grain size distribution in COS-1. Nanoscale clusters of GP-zone type Y-Ti-O and Y2Ti2O7 pyrochlore as well as large spinel Mn(Ti)Cr2O4 particles are all observed in the two ODS steels. The Y-Ti-enriched nano-oxides in COS-1 exhibit higher number density and smaller size than in COS-2. The Y-Ti-enriched nano-oxides in fine grains of COS-2 show higher number density and smaller size than that in coarse grains of COS-2. Nano-oxides effectively trap helium atoms and lead to the formation of high density and ultra-fine helium bubbles.

  15. Time-Resolved Frequency Comb Spectroscopy for Studying the Kinetics and Branching Ratio of OD+CO

    NASA Astrophysics Data System (ADS)

    Bui, Thinh Quoc; Bjork, Bryce J.; Heckl, Oliver H.; Changala, Bryan; Spaun, Ben; Okumura, Mitchio; Ye, Jun

    2016-06-01

    The chemical kinetics of the OH+CO reaction plays important roles in combustion and atmospheric processes. OH+CO has two product channels, H+CO_2 and the stabilized HOCO intermediate, with a branching ratio that is highly pressure dependent. Therefore, establishing an accurate kinetic model for this chemical system requires knowledge of the reaction rates and product yields, and the lifetimes of all molecules along a particular reaction pathway. We report the application of time-resolved frequency comb spectroscopy (TRFCS) in the mid-infrared (3.7 μm) spectral region to address the complex reaction kinetics of OD+CO at room temperature. We use the deuterated forms to avoid atmospheric water interference. This technique allows us to detect the lowest energy conformer trans-DOCO intermediate with high time-resolution and sensitivity while also permitting the direct determination of rotational state distributions of all relevant molecules. We simultaneously observe the time-dependent concentrations of trans-DOCO, OD, and D_2O which are used in conjunction with kinetics modeling to obtain the pressure- and collision partner-dependent branching ratio of OD+CO.

  16. Fe-Cr-Mo based ODS alloys via spark plasma sintering: A combinational characterization study by TEM and APT

    SciTech Connect

    Y. Q. Wu; K. N. Allahar; J. Burns; B. Jacques; I Charit; D. P. Butt; J. I. Cole

    2013-08-01

    Nanoscale oxides play an important role in oxide dispersion strengthened (ODS) alloys for improved high temperature creep resistance and enhanced radiation damage tolerance. In this study, transmission electron microscopy (TEM) and atom probe tomography (APT) were combined to investigate two novel Fe-16Cr-3Mo (wt.%) based ODS alloys. Spark plasma sintering (SPS) was used to consolidate the ODS alloys from powders that were milled with 0.5 wt.% Y2O3 powder only or with Y2O3 powder and 1 wt.% Ti. TEM characterization revealed that both alloys have a bimodal structure of nanometer-size (~ 100 – 500 nm) and micron-size grains with nanostructured oxide precipitates formed along and close to grain boundaries with diameters ranging from five to tens of nanometers. APT provides further quantitative analyses of the oxide precipitates, and also reveals Mo segregation at grain boundaries next to oxide precipitates. The alloys with and without Ti are compared based on their microstructures.

  17. Suppression effect of nano-sized oxide particles on helium irradiation hardening in F82H-ODS steel

    NASA Astrophysics Data System (ADS)

    Chen, S.; Wang, Y.; Tadaki, K.; Hashimoto, N.; Ohnuki, S.

    2014-12-01

    Helium implantation was performed to investigate irradiation hardening in ferritic/martensitic steels. Depth dependence of nano-hardness was obtained using a Berkovich nano-indenter, and then nano-hardness was extracted from Nix-Gao model. The correlation between irradiation hardening and the concentration 500-2000 appm of helium was plotted. Nano-hardness increases as a function of helium concentration. F82H-ODS with a higher nano-hardness provides a lower irradiation hardening than F82H-IEA. Cross-sectional transmission electron microscopy (XTEM) revealed that cavities with a uniform distribution were formed after helium implantation at 2000 appm helium concentration, showing a mean size of 1.1 nm with an average number density of 4.9 × 1023 m-3 in F82H-IEA and 1.3 nm with 7.4 × 1023 m-3 in F82H-ODS. Orowan model was applied to evaluate the hardening from dispersed cavities. The significant difference of hardening between calculation and nano-indentation result of F82H-ODS indicates that oxide particles may shield the hardening effect from cavities because of the complex multi-interaction.

  18. Influence of microstructure on impact properties of 9-18%Cr ODS steels for fusion/fission applications

    NASA Astrophysics Data System (ADS)

    Hadraba, H.; Fournier, B.; Stratil, L.; Malaplate, J.; Rouffié, A.-L.; Wident, P.; Ziolek, L.; Béchade, J.-L.

    2011-04-01

    The paper describes the influence of the microstructure (coming from the extrusion shape, the chemical composition and the thermo-mechanical treatments) of (9-18%)Cr-W-Ti-Y 2O 3 ODS steels on their impact fracture properties. The extrusion shape plays a major role on the impact properties, materials extruded as a rod present a higher upper shelf energy (USE) and a lower ductile to brittle transition temperature (DBTT) compared to materials extruded as plates. The DBTT for the non-recrystallized 14%Cr ferritic steels was shifted towards higher temperatures compared to the 9%Cr tempered ferritic-martensitic steel. Increasing the W and Ti content in 9%Cr tempered ferritic-martensitic ODS steel leads to a USE and a DBTT shifted towards higher energies and higher temperatures respectively. Increasing the yttria content leads to a drop of the impact energy and a shift of the DBTT of ferritic ODS steel towards higher temperatures. The present study highlights extensive splitting of the fracture surfaces and a dependency of the impact energy on the fracture plane orientation according to the microstructure anisotropy.

  19. Effect of heat treatment on microstructure and hardness of Eurofer 97, Eurofer ODS and T92 steels

    NASA Astrophysics Data System (ADS)

    Lu, Z.; Faulkner, R. G.; Riddle, N.; Martino, F. D.; Yang, K.

    2009-04-01

    Eurofer ODS steel is a potential candidate for fusion reactor application due to its excellent swelling resistance, low thermal expansion coefficient and high temperature properties. One of the main issues is that high fluence neutron irradiation induces a significant increase of ductile-to-brittle transition temperature (DBTT) at temperatures below 400 °C which restricts its application. The aim of this study is to explore the methods to lower the initial DBTT of Eurofer ODS steel by heat treatment optimization. Two heats of Eurofer ODS steels with different C contents are heat-treated at different normalizing temperatures, cooling rates and tempering conditions, and are compared with Eurofer 97 and T92 steels heat-treated with similar conditions. The microstructure is characterized by optical microscopy, FEG-TEM and OIM-EBSD techniques. The effect of normalization, cooling rate and temper on grain size, precipitation, grain boundary misorientation and hardness are investigated. The influences of these properties on DBTT are discussed.

  20. Triplet extinction coefficients of some laser dyes I

    SciTech Connect

    Pavlopoulos, T.G.; Golich, D.J.

    1988-07-15

    We measured the triplet extinction coefficients epsilon/sub T/ over the laser action spectral region of Rhodamine 6G; Rhodamine B; Rhodamine 110; Fluorol-7GA; Coumarin 540A; Coumarin 522; Coumarin 1; Coumarin 120; 4,4'-diphenyl stilbene; and 2,7-bis-(4-methoxy-phenyl)-9,9-dipropylfluorene. We employed the different lines from an argon ion cw laser for excitation. McClure's method was used to obtain the triplet extinction coefficients epsilon/sub T/. The method requires the measurement of triplet optical densities OD/sub T/ as a function of different cw laser excitation intensities (powers) I/sub ex/ . The importance of triplet-state losses on dye laser efficiency is reviewed. The laser action properties of the laser dyes we studied are briefly discussed as they relate to the measured epsilon/sub T/ values.

  1. Laser Technology.

    ERIC Educational Resources Information Center

    Gauger, Robert

    1993-01-01

    Describes lasers and indicates that learning about laser technology and creating laser technology activities are among the teacher enhancement processes needed to strengthen technology education. (JOW)

  2. Laser Technology.

    ERIC Educational Resources Information Center

    Gauger, Robert

    1993-01-01

    Describes lasers and indicates that learning about laser technology and creating laser technology activities are among the teacher enhancement processes needed to strengthen technology education. (JOW)

  3. Laser apparatus

    NASA Technical Reports Server (NTRS)

    Koepf, G. A. (Inventor)

    1979-01-01

    A laser apparatus having a pump laser device for producing pump laser energy upon being excited is disclosed. The pump laser device has a resonating cavity for oscillating and amplifying the pump laser energy. A source laser device is used for producing source laser energy upon being excited by the pump laser energy. The source laser device has a resonating cavity for oscillating and amplifying the source laser energy. The source laser's resonating cavity is coupled within a portion of the pump laser's resonating cavity.

  4. Accumulation and annealing of radiation defects under low-temperature electron and neutron irradiation of ODS steel and Fe-Cr alloys

    NASA Astrophysics Data System (ADS)

    Arbuzov, V. L.; Goshchitskii, B. N.; Sagaradze, V. V.; Danilov, S. E.; Kar'kin, A. E.

    2010-10-01

    The processes of accumulation and annealing of radiation defects at low-temperature (77 K) electron and neutron irradiation and their effect on the physicomechanical properties of Fe-Cr alloys and oxide dispersion strengthened (ODS) steel have been studied. It has been shown that the behavior of radiation defects in ODS steel and Fe-Cr alloys is qualitatively similar. Above 250 K, radiation-induced processes of the solid solution decomposition become conspicuous. These processes are much less pronounced in ODS steel because of specific features of its microstructure. Processes related to the overlapping of displacement cascades under neutron irradiation have been considered. It has been shown that, in this case, it is the increase in the size of vacancy clusters, rather than the growth of their concentration, that is prevailing. Possible mechanisms of the radiation hardening of the ODS steel and the Fe-13Cr alloy upon irradiation and subsequent annealing have been discussed.

  5. Evaluating the Good Ontology Design Guideline (GoodOD) with the ontology quality requirements and evaluation method and metrics (OQuaRE).

    PubMed

    Duque-Ramos, Astrid; Boeker, Martin; Jansen, Ludger; Schulz, Stefan; Iniesta, Miguela; Fernández-Breis, Jesualdo Tomás

    2014-01-01

    To (1) evaluate the GoodOD guideline for ontology development by applying the OQuaRE evaluation method and metrics to the ontology artefacts that were produced by students in a randomized controlled trial, and (2) informally compare the OQuaRE evaluation method with gold standard and competency questions based evaluation methods, respectively. In the last decades many methods for ontology construction and ontology evaluation have been proposed. However, none of them has become a standard and there is no empirical evidence of comparative evaluation of such methods. This paper brings together GoodOD and OQuaRE. GoodOD is a guideline for developing robust ontologies. It was previously evaluated in a randomized controlled trial employing metrics based on gold standard ontologies and competency questions as outcome parameters. OQuaRE is a method for ontology quality evaluation which adapts the SQuaRE standard for software product quality to ontologies and has been successfully used for evaluating the quality of ontologies. In this paper, we evaluate the effect of training in ontology construction based on the GoodOD guideline within the OQuaRE quality evaluation framework and compare the results with those obtained for the previous studies based on the same data. Our results show a significant effect of the GoodOD training over developed ontologies by topics: (a) a highly significant effect was detected in three topics from the analysis of the ontologies of untrained and trained students; (b) both positive and negative training effects with respect to the gold standard were found for five topics. The GoodOD guideline had a significant effect over the quality of the ontologies developed. Our results show that GoodOD ontologies can be effectively evaluated using OQuaRE and that OQuaRE is able to provide additional useful information about the quality of the GoodOD ontologies.

  6. Evaluating the Good Ontology Design Guideline (GoodOD) with the Ontology Quality Requirements and Evaluation Method and Metrics (OQuaRE)

    PubMed Central

    Duque-Ramos, Astrid; Boeker, Martin; Jansen, Ludger; Schulz, Stefan; Iniesta, Miguela; Fernández-Breis, Jesualdo Tomás

    2014-01-01

    Objective To (1) evaluate the GoodOD guideline for ontology development by applying the OQuaRE evaluation method and metrics to the ontology artefacts that were produced by students in a randomized controlled trial, and (2) informally compare the OQuaRE evaluation method with gold standard and competency questions based evaluation methods, respectively. Background In the last decades many methods for ontology construction and ontology evaluation have been proposed. However, none of them has become a standard and there is no empirical evidence of comparative evaluation of such methods. This paper brings together GoodOD and OQuaRE. GoodOD is a guideline for developing robust ontologies. It was previously evaluated in a randomized controlled trial employing metrics based on gold standard ontologies and competency questions as outcome parameters. OQuaRE is a method for ontology quality evaluation which adapts the SQuaRE standard for software product quality to ontologies and has been successfully used for evaluating the quality of ontologies. Methods In this paper, we evaluate the effect of training in ontology construction based on the GoodOD guideline within the OQuaRE quality evaluation framework and compare the results with those obtained for the previous studies based on the same data. Results Our results show a significant effect of the GoodOD training over developed ontologies by topics: (a) a highly significant effect was detected in three topics from the analysis of the ontologies of untrained and trained students; (b) both positive and negative training effects with respect to the gold standard were found for five topics. Conclusion The GoodOD guideline had a significant effect over the quality of the ontologies developed. Our results show that GoodOD ontologies can be effectively evaluated using OQuaRE and that OQuaRE is able to provide additional useful information about the quality of the GoodOD ontologies. PMID:25148262

  7. Oxidation behavior of ferritic-martensitic and ODS steels in supercritical water

    NASA Astrophysics Data System (ADS)

    Bischoff, Jeremy

    Ferritic-martensitic and ODS alloys are primary candidates for application as cladding and structural material in Generation IV nuclear power plants, especially the supercritical water reactor. One of the main in-service degradation mechanisms for these alloys is uniform corrosion, thus this project focuses on understanding the oxidation behavior of these alloys in the supercritical water (SCW) environment. This understanding is acquired through the analysis of the oxide microstructure using microbeam synchrotron radiation diffraction and fluorescence associated with electron microscopy (both SEM and TEM). The microbeam synchrotron radiation diffraction and fluorescence technique provides unique microstructural data of the oxide. This technique simultaneously probes elemental and phase information step by step with a sub-micron spatial resolution throughout the oxide layers. Thus we were able to locate specific phases, such as Cr2O3, at specific locations in the oxide layer, mainly the interfaces. The electron microscopy complemented this analysis by imaging the oxide layers, to yield detailed information on the oxide morphology. All the alloys studied exhibited the same three-layer structure with an outer layer containing only Fe3O4, an inner layer containing a mixture of Fe3O4 and FeCr2O 4, and a diffusion layer containing a mixture of chromium-rich precipitates (Cr2O3 and FeCr2O4) and metal grains. By analyzing samples with various exposure times, we were able to follow the evolution of the oxide microstructure with exposure time. To obtain the corroded samples, several corrosion experiments were performed: some in supercritical water (at 500°C and 600°C) and one experiment in 500°C steam. The test in steam was undertaken to obtain more data points in the kinetic curves, because we thought the corrosion in steam and supercritical water at the same temperature would result in similar kinetics. This turned out not to be the case and the samples in supercritical

  8. Measurement of oxygen saturation in small retinal vessels with adaptive optics confocal scanning laser ophthalmoscope.

    PubMed

    Li, Hao; Lu, Jing; Shi, Guohua; Zhang, Yudong

    2011-11-01

    We have used an adaptive optics confocal scanning laser ophthalmoscope to assess oxygen saturation in small retinal vessels. Images of the vessels with a diameter smaller than 50 μm are recorded at oxygen sensitive and isosbestic wavelengths (680 and 796 nm, respectively). The vessel optical densities (ODs) are determined by a computer algorithm. Then, OD ratios (ODRs), which are inversely proportional to oxygen saturation, are calculated. The results show that arterial ODRs are significantly smaller than venous ODRs, indicating that oxygen saturation in the artery is higher than that in the vein. To the best of our knowledge, this is the first noninvasive measurement of oxygen saturation in small retinal vessels.

  9. Dissociative photoionization mechanism of methanol isotopologues (CH3OH, CD3OH, CH3OD and CD3OD) by iPEPICO: energetics, statistical and non-statistical kinetics and isotope effects.

    PubMed

    Borkar, Sampada; Sztáray, Bálint; Bodi, Andras

    2011-07-28

    The dissociative photoionization of energy selected methanol isotopologue (CH(3)OH, CD(3)OH, CH(3)OD and CD(3)OD) cations was investigated using imaging Photoelectron Photoion Coincidence (iPEPICO) spectroscopy. The first dissociation is an H/D-atom loss from the carbon, also confirmed by partial deuteration. Somewhat above 12 eV, a parallel H(2)-loss channel weakly asserts itself. At photon energies above 15 eV, in a consecutive hydrogen molecule loss to the first H-atom loss, the formation of CHO(+)/CDO(+) dominates as opposed to COH(+)/COD(+) formation. We see little evidence for H-atom scrambling in these processes. In the photon energy range corresponding to the B[combining tilde] and C[combining tilde] ion states, a hydroxyl radical loss appears yielding CH(3)(+)/CD(3)(+). Based on the branching ratios, statistical considerations and ab initio calculations, this process is confirmed to take place on the first electronically excited Ã(2)A' ion state. Uncharacteristically, internal conversion is outcompeted by unimolecular dissociation due to the apparently weak Renner-Teller-like coupling between the X[combining tilde] and the à ion states. The experimental 0 K appearance energies of the ions CH(2)OH(+), CD(2)OH(+), CH(2)OD(+) and CD(2)OD(+) are measured to be 11.646 ± 0.003 eV, 11.739 ± 0.003 eV, 11.642 ± 0.003 eV and 11.737 ± 0.003 eV, respectively. The E(0)(CH(2)OH(+)) = 11.6454 ± 0.0017 eV was obtained based on the independently measured isotopologue results and calculated zero point effects. The 0 K heat of formation of CH(2)OH(+), protonated formaldehyde, was determined to be 717.7 ± 0.7 kJ mol(-1). This yields a 0 K heat of formation of CH(2)OH of -11.1 ± 0.9 kJ mol(-1) and an experimental 298 K proton affinity of formaldehyde of 711.6 ± 0.8 kJ mol(-1). The reverse barrier to homonuclear H(2)-loss from CH(3)OH(+) is determined to be 36 kJ mol(-1), whereas for heteronuclear H(2)-loss from CH(2)OH(+) it is found to be 210 kJ mol(-1).

  10. Cyclic oxidation of coated Oxide Dispersion Strengthened (ODS) alloys in high velocity gas streams at 1100 deg C

    NASA Technical Reports Server (NTRS)

    Gedwill, M. A.

    1978-01-01

    Several overlay coatings on ODS NiCrAl's were tested in Mach 1 and Mach 0.3 burner rigs to examine oxidation and thermal fatigue performance. The coatings were applied by various methods. Based on weight change, macroscopic, and metallographic observations in Mach 1 tests Nascoat 70 on TD-NiCrAl exhibited the best oxidation resistance. In Mach 0.3 tests PWA 267 and ATD-1, about equally, were the best coatings on YD-NiCrAl (Nascoat 70 was not tested in Mach 0.3 rigs).

  11. Mechanical and Microstructure Study of Nickel-Based ODS Alloys Processed by Mechano-Chemical Bonding and Ball Milling

    NASA Astrophysics Data System (ADS)

    Amare, Belachew N.

    Due to the need to increase the efficiency of modern power plants, land-based gas turbines are designed to operate at high temperature creating harsh environments for structural materials. The elevated turbine inlet temperature directly affects the materials at the hottest sections, which includes combustion chamber, blades, and vanes. Therefore, the hottest sections should satisfy a number of material requirements such as high creep strength, ductility at low temperature, high temperature oxidation and corrosion resistance. Such requirements are nowadays satisfied by implementing superalloys coated by high temperature thermal barrier coating (TBC) systems to protect from high operating temperature required to obtain an increased efficiency. Oxide dispersive strengthened (ODS) alloys are being considered due to their high temperature creep strength, good oxidation and corrosion resistance for high temperature applications in advanced power plants. These alloys operating at high temperature are subjected to different loading systems such as thermal, mechanical, and thermo-mechanical combined loads at operation. Thus, it is critical to study the high temperature mechanical and microstructure properties of such alloys for their structural integrity. The primary objective of this research work is to investigate the mechanical and microstructure properties of nickel-based ODS alloys produced by combined mechano-chemical bonding (MCB) and ball milling subjected to high temperature oxidation, which are expected to be applied for high temperature turbine coating with micro-channel cooling system. Stiffness response and microstructure evaluation of such alloy systems was studied along with their oxidation mechanism and structural integrity through thermal cyclic exposure. Another objective is to analyze the heat transfer of ODS alloy coatings with micro-channel cooling system using finite element analysis (FEA) to determine their feasibility as a stand-alone structural

  12. Use of the 16O(d, α 0) 14N nuclear reaction in the analysis of oxide films

    NASA Astrophysics Data System (ADS)

    Simpson, J. C. B.; Groves, J. M. C.; Earwaker, L. G.

    1985-06-01

    The use of the 16O(d, α 0) 14N nuclear reaction to obtain oxygen concentration profiles in surface oxide layers, up to 4000 Å thick, has been studied using incident deuterons of 900 keV and 1.08 MeV and comparisons made of the oxygen sensitivities and depth resolutions. Samples investigated include a Ta 2O 5 on tantalum standard, thermally grown silicon oxide films on silicon and two types of chromium conversion coatings on zinc electroplated panels. A nuclear reaction simulation code has been employed to reveal surface compositions from the energy spectra of the emitted alpha particles.

  13. The Optical Depth Sensor (ODS) in the DREAMS package onboard the Exomars Entry Descent and Landing Demonstrator Module

    NASA Astrophysics Data System (ADS)

    Rannou, P.; Pommereau, J. P.; Perreux, M.; Cours, T.; Montmessin, F.; Sarkissian, A.; Maria, J. L.

    2011-10-01

    The optical depth sensor (ODS) was developped to retrieve the optical depth of the dust layer and to characterize the high altitude clouds on Mars. It was developped initially for the mission MARS 96, and also included in the payload of several mission. The sensor was developped and used for a field experiment in Africa in order to validate the concept and test the performance. In this work we present main principle of the retrieval, the instrumental concept and the result of the tests performed during the 2004-2005 winter field experiment. It is now recommended for the payload of the EDM on Mars 2016.

  14. Long-term thermal stability of nanoclusters in ODS-Eurofer steel: An atom probe tomography study

    NASA Astrophysics Data System (ADS)

    Zilnyk, K. D.; Pradeep, K. G.; Choi, P.; Sandim, H. R. Z.; Raabe, D.

    2017-08-01

    Oxide-dispersion strengthened materials are important candidates for several high-temperature structural applications in advanced nuclear power plants. Most of the desirable mechanical properties presented by these materials are due to the dispersion of stable nanoparticles in the matrix. Samples of ODS-Eurofer steel were annealed for 4320 h (6 months) at 800 °C. The material was characterized using atom probe tomography in both conditions (prior and after heat treatment). The particles number density, size distribution, and chemical compositions were determined. No significant changes were observed between the two conditions indicating a high thermal stability of the Y-rich nanoparticles at 800 °C.

  15. Phase Stability under Irradiation of Precipitates and Solid Solutions in Model ALloys and in ODS Alloys Relevant for Gen IV

    SciTech Connect

    Arthur T. Motta; Robert C. Birtcher

    2007-10-17

    The overall objective of this program is to investigate the irradiation-altered phase stability of oxide precipitates in ODS steels and of model alloy solid solutions of associated systems. This information can be used to determine whether the favorable mechanical propertiies of these steels are maintained under irradiation, thus addressing one of the main materials research issues for this class of steels as identified by the GenIV working groups. The research program will also create fundamental understanding of the irradiation precipitation/dissolution problem by studying a "model" system in which the variables can be controlled and their effects understood individually.

  16. Acute Keratoconus-Like Hydrops after Laser In Situ Keratomileusis

    PubMed Central

    Meyer, Carsten H.; Mennel, Stefan; Schmidt, Jörg C.

    2009-01-01

    Purpose. To demonstrate keratoconus-like hydrops after laser in situ keratomileusis (LASIK) by optical coherence tomography (OCT). Patient and Methods. A 21-year-old man received uneventful bilateral LASIK. On slit lamp examination or corneal topography there were no signs of fruste keratoconus. The preoperative corneal thickness was 587-μm OD and the calculated ablation for two treatments was 114-μm. Uneventful LASIK with an optical zone of 7 mm and an ablation of 89-μm OD, and an ablation of 73-μm OS was performed. Three years postoperatively, he complained about progressive myopia and impaired vision OD. His VA was hand motion OD and 20/20 OS. Results. OCT and light microscopy revealed an anterior corneal steepening and acute keratoconus-like excessive edematous swelling. Conclusion. The cornea is mechanically weakened after LASIK by the lamellar cut and tissue subtraction. Although the advocated minimal residual stromal bed thickness is 250-μm, it may not be adequate to prevent progressive keratoconus-like hydrops in the selected cases. PMID:20339447

  17. A Real-Time Orbit Determination Method for Smooth Transition from Optical Tracking to Laser Ranging of Debris

    PubMed Central

    Li, Bin; Sang, Jizhang; Zhang, Zhongping

    2016-01-01

    A critical requirement to achieve high efficiency of debris laser tracking is to have sufficiently accurate orbit predictions (OP) in both the pointing direction (better than 20 arc seconds) and distance from the tracking station to the debris objects, with the former more important than the latter because of the narrow laser beam. When the two line element (TLE) is used to provide the orbit predictions, the resultant pointing errors are usually on the order of tens to hundreds of arc seconds. In practice, therefore, angular observations of debris objects are first collected using an optical tracking sensor, and then used to guide the laser beam pointing to the objects. The manual guidance may cause interrupts to the laser tracking, and consequently loss of valuable laser tracking data. This paper presents a real-time orbit determination (OD) and prediction method to realize smooth and efficient debris laser tracking. The method uses TLE-computed positions and angles over a short-arc of less than 2 min as observations in an OD process where simplified force models are considered. After the OD convergence, the OP is performed from the last observation epoch to the end of the tracking pass. Simulation and real tracking data processing results show that the pointing prediction errors are usually less than 10″, and the distance errors less than 100 m, therefore, the prediction accuracy is sufficient for the blind laser tracking. PMID:27347958

  18. Post-Irradiation Fracture Toughness of Unalloyed Molybdenum, ODS molybdenum, and TZM molybdenum following irradiation at 244C to 507C

    SciTech Connect

    Cockeram, Brian V; Byun, Thak Sang; Leonard, Keith J; Snead, Lance Lewis

    2013-01-01

    Commercially available unalloyed molybdenum (Low Carbon Arc Cast (LCAC)), Oxide Dispersion Strengthened (ODS) molybdenum, and TZM molybdenum were neutron irradiated at temperatures of nominally 244 C, 407 C, and 509 C to neutron fluences between 1.0 to 4.6x1025 n/m2 (E>0.1 MeV). Post-irradiation fracture toughness testing was performed. All alloys exhibited a Ductile to Brittle Transition Temperature that was defined to occur at 30 4 MPa-m1/2. The highest post-irradiated fracture toughness values (26-107 MPa-m1/2) and lowest DBTT (100-150 C) was observed for ODS molybdenum in the L-T orientation. The finer grain size for ODS molybdenum results in fine laminates that improve the ductile laminate toughening. The results for ODS molybdenum are anisotropic with lower post-irradiated toughness values (20-30 MPa-m1/2) and higher DBTT (450-600 C) in the T-L orientation. The results for T-L ODS molybdenum are consistent or slightly better than those for LCAC molybdenum (21-71 MPa-m1/2 and 450-800 C DBTT). The fracture toughness values measured for LCAC and T-L ODS molybdenum at temperatures below the DBTT were determined to be 8-18 MPa-m1/2. Lower non-irradiated fracture toughness values were measured for TZM molybdenum that are attributed to the large carbide precipitates serving as preferential fracture initiation sites. The role of microstructure and grain size on post-irradiated fracture toughness was evaluated by comparing the results for LCAC molybdenum and ODS molybdenum.

  19. Laser-Stimulated Surface Processes and Heterogeneous Catalysis.

    DTIC Science & Technology

    1980-11-01

    A07-AC94 337 ROCHESTER UNIV NY DEPT OF CI4EMISTRY F/* 7/5 LASER-STINULATED SURFACE PROCESSES AND HETEROGENEOUS CATALYSIS . (Ul UN, NOV 80 J LIN N00014...Contra" W014-80-C-OD472 Task No. NR 056-749 __ TECHNICAL REPORT NO. 8 I Laser-Stimulated Surface Processes) *.and Heterogeneous Catalysis .) by / J...Repor HETEROGENEOUS CATALYSIS InterimTechnical_______ 6. PERFORMING ORG. REPORT NUMBER 7. AUTHOR(*) S. CONTRACT OR GRANT NUMSER(.) Jui-teng Lin N00014

  20. Modulation of human Nav1.7 channel gating by synthetic α-scorpion toxin OD1 and its analogs.

    PubMed

    Motin, Leonid; Durek, Thomas; Adams, David J

    2016-01-01

    Nine different voltage-gated sodium channel isoforms are responsible for inducing and propagating action potentials in the mammalian nervous system. The Nav1.7 channel isoform plays an important role in conducting nociceptive signals. Specific mutations of this isoform may impair gating behavior of the channel resulting in several pain syndromes. In addition to channel mutations, similar or opposite changes in gating may be produced by spider and scorpion toxins binding to different parts of the voltage-gated sodium channel. In the present study, we analyzed the effects of the α-scorpion toxin OD1 and 2 synthetic toxin analogs on the gating properties of the Nav1.7 sodium channel. All toxins potently inhibited channel inactivation, however, both toxin analogs showed substantially increased potency by more than one order of magnitude when compared with that of wild-type OD1. The decay phase of the whole-cell Na(+) current was substantially slower in the presence of toxins than in their absence. Single-channel recordings in the presence of the toxins revealed that Na(+) current inactivation slowed due to prolonged flickering of the channel between open and closed states. Our findings support the voltage-sensor trapping model of α-scorpion toxin action, in which the toxin prevents a conformational change in the domain IV voltage sensor that normally leads to fast channel inactivation.

  1. Impact of the use of the ferritic/martensitic ODS steels cladding on the fuel reprocessing PUREX process

    NASA Astrophysics Data System (ADS)

    Gwinner, B.; Auroy, M.; Mas, D.; Saint-Jevin, A.; Pasquier-Tilliette, S.

    2012-09-01

    Some ferritic/martensitic oxide dispersed strengthened (F/M ODS) steels are presently developed at CEA for the fuel cladding of the next generation of sodium fast nuclear reactors. The objective of this work is to study if this change of cladding could have any consequences on the spent fuel reprocessing PUREX process. During the fuel dissolution stage the cladding can actually be corroded by nitric acid. But some process specifications impose not to exceed a limit concentration of the corrosion products such as iron and chromium in the dissolution medium. For that purpose the corrosion behavior of these F/M ODS steels is studied in hot and concentrated nitric acid. The influence of some metallurgical parameters such as the chromium content, the elaboration process and the presence of the yttrium oxides is first discussed. The influence of environmental parameters such as the nitric acid concentration, the temperature and the presence of oxidizing species coming from the fuel is then analyzed. The corrosion rate is characterized by mass loss measurements and electrochemical tests. Analyses of the corroded surface are carried out by X-ray photoelectron spectroscopy.

  2. Formation of nano-size oxide particles and δ-ferrite at elevated temperature in 9Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Kim, Sawoong; Ohtsuka, Satoshi; Kaito, Takeji; Yamashita, Shinichiro; Inoue, Masaki; Asayama, Tai; Shobu, Takahisa

    2011-10-01

    Excellent high-temperature strength and resistance to radiation damage of 9Cr Oxide Dispersion Strengthened (9Cr-ODS) martensitic steel have been realized by nano-size Y-Ti-O complex oxide particles dispersed in the matrix and a dual phase structure consisting of α'-martensite and δ-ferrite. These are produced by mechanically alloying Fe-Cr-Ti powders with Y 2O 3 followed by a hot-consolidation process. Therefore, the hot-consolidation process is the issue to be clarified for the formation of nano-size oxide particle and δ-ferrite. The temperature dependence of the formation and development of nano-size oxide particles and δ-ferrite using mechanically alloyed 9Cr-ODS raw powder were investigated applying X-ray Diffraction and Small Angle X-ray Scattering measurement at SPring-8 and by Electron Probe Micro Analysis. In situ heating measurement techniques with XRD and SAXS enabled real-time observation of phase transformations and allowed correlation between formation of nano-size oxide particle and δ-ferrite.

  3. Modulation of human Nav1.7 channel gating by synthetic α-scorpion toxin OD1 and its analogs

    PubMed Central

    Motin, Leonid; Durek, Thomas; Adams, David J.

    2016-01-01

    ABSTRACT Nine different voltage-gated sodium channel isoforms are responsible for inducing and propagating action potentials in the mammalian nervous system. The Nav1.7 channel isoform plays an important role in conducting nociceptive signals. Specific mutations of this isoform may impair gating behavior of the channel resulting in several pain syndromes. In addition to channel mutations, similar or opposite changes in gating may be produced by spider and scorpion toxins binding to different parts of the voltage-gated sodium channel. In the present study, we analyzed the effects of the α-scorpion toxin OD1 and 2 synthetic toxin analogs on the gating properties of the Nav1.7 sodium channel. All toxins potently inhibited channel inactivation, however, both toxin analogs showed substantially increased potency by more than one order of magnitude when compared with that of wild-type OD1. The decay phase of the whole-cell Na+ current was substantially slower in the presence of toxins than in their absence. Single-channel recordings in the presence of the toxins revealed that Na+ current inactivation slowed due to prolonged flickering of the channel between open and closed states. Our findings support the voltage-sensor trapping model of α-scorpion toxin action, in which the toxin prevents a conformational change in the domain IV voltage sensor that normally leads to fast channel inactivation. PMID:26646206

  4. Low energy crossed beam studies of OD+ and D2O+ with C2H4: covalent and electrostatic complexes

    NASA Astrophysics Data System (ADS)

    Liu, Li; Li, Yue; Cai, Xiaohui; Richards, Elizabeth S.; Farrar, James M.

    2007-09-01

    Density functional theory (DFT) calculations are used in conjunction with low-energy crossed beam studies of the ion-molecule reactions of D2O+ and OD+ with C2H4 to probe collision dynamics, particularly the role that electrostatic and covalent intermediates play. In the D+-transfer reaction initiated with D2O+, an electrostatic complex formed when the transferred species approaches the perpendicular bisector of the C=C bond plays an important role. Observation of C2H4D+ products with excitation in the ν10 stretching mode, in which the bridging D-atom moves along the perpendicular bisector, provides support for this complex. In the OD+ reaction, evidence for the occurrence of reaction on the ground singlet surface following internal conversion comes from the observation of a transient complex living ~100 fs. The DFT calculations show that the rate-limiting step corresponds to ring-opening and H/D exchange initiated in an ethylene oxide species with D+ bound to the oxygen atom. Computed lifetimes are in agreement with experiment. This study provides an example of how high-resolution crossed beam studies in conjunction with quantum chemical calculations, can provide a detailed understanding of collision dynamics in systems of moderate complexity. New experimental developments, including the application of velocity space imaging methods, as well as the production of beams of free radicals, will lead to a greater understanding of energy and angular momentum disposal in systems of chemical relevance.

  5. High temperature deformation mechanism of 15CrODS ferritic steels at cold-rolled and recrystallized conditions

    NASA Astrophysics Data System (ADS)

    Sugino, Yoshito; Ukai, Shigeharu; Oono, Naoko; Hayashi, Shigenari; Kaito, Takeji; Ohtsuka, Satoshi; Masuda, Hiroshi; Taniguchi, Satoshi; Sato, Eiichi

    2015-11-01

    The ODS ferritic steels realize potentially higher operating temperature due to structural stability by the dispersed nano-size oxide particles. The deformation process and mechanism of 15CrODS ferritic steels were investigated at 1073 K and 1173 K for the cold-rolled and recrystallized conditions. Tensile and creep tests were conducted at the stress in parallel (LD) and perpendicular (TD) directions to the grain boundaries. Strain rate varied from 10-1 to 10-9 s-1. For the LD specimens, deformation in the cold rolled and recrystallized conditions is reinforced by finely dispersed oxide particles. The dominant deformation process for the recrystallized TD specimen is controlled through the grain boundary sliding and stress accommodation via diffusional creep at temperature of 1173 K and lower strain rate less than 10-4 s-1. The grain boundary sliding couldn't be rate-controlling process at 1073 K for the as-cold rolled TD specimen, where a dynamic recovery of the dislocation produced by cold-rolling is related to the deformation process.

  6. QCT dynamics study of OH/OD + GeH4 reactions. The problem of water bending excitation.

    PubMed

    Espinosa-Garcia, J; Corchado, J C

    2017-01-04

    Using a full-dimensional analytical potential energy surface describing the OH/OD + GeH4 hydrogen abstraction reactions (J. Espinosa-Garcia, C. Rangel and J. C. Corchado, Phys. Chem. Chem. Phys., 2016, 18, 16941), quasi-classical trajectory calculations were performed at 298 K to simulate the scarce experimental data at this temperature. This system presents wells in the entrance and exit channels, influencing product angular distribution, which is practically isotropic. Moreover, isotopic effects were not observed. It was found that the GeH3 co-product presents little internal energy (11% of the total available energy), although not negligible, and that the water product receives the major part of the available energy, mainly in the newly formed OH bond, while the initial OH/OD reactant bond acts as a spectator mode. These results reproduce the experimental evidence, the larger discrepancy being in the water bending vibrational distribution, which is broader in the experiment. Several factors were analyzed to account for this discrepancy, and it was concluded that the zero-point energy violation per mode is the main, but not the only, cause.

  7. Texture analysis of oxide dispersion strengthened (ODS) Fe alloys by X-ray and neutron diffraction

    NASA Astrophysics Data System (ADS)

    Béchade, J. L.; Mathon, M. H.; Branger, V.; Réglé, H.; Alamo, A.

    2002-07-01

    The ferritic ODS alloys studied were obtained by mechanical alloying. This strengthening method is very attractive, in particular for nuclear applications. In order to ensure the alloy a good compromise between mechanical resistance and ductility at high temperatures, it is necessary to control the microstructure and in particular the evolution during the recrystallization. First, a preliminary study, performed by X ray diffraction and optical microscopy, shows several grain growth mechanisms ; in particular, the “abnormal” grain growth mechanism which conducts to a large grain size [1], [2]. After annealing (3600s at 1470^{circ}C), the 30% cold-worked (swaging) alloys exhibit an heterogeneous microstructure with a large grains size ( 200 to 500 μm) in the heart and near the surface of the material when the intermediate zone is inhabited by small grains ( 1 μm). Fora higher cold-work level (60%), large size grains are only present in the periphery of the material. On account of the large grain size and strong heterogeneity of the microstructure, texture analysis using laboratory x-ray beam in not well adapted and so we have decided to use neutron beam. The neutron diffraction texture analysis has been performed at the Laboratoire Léon Brillouin on the 6T1 diffractometer on 2 different rods of the alloy (corresponding to the reduction ratios of 30% and 60%). Specific samples have been machined to characterise separately the zones with a different microstructure. After deformation, the alloys exhibit a typical α-fibre texture \\{ hkl \\} <1l0> whatever the area of the sample and the reduction ratio. After recrystallization, a very inhomogeneous texture is evidenced through the thickness of the sample, in particular for the rod deformed with a reduction ratio of 30% : in the heart and in the periphery of the rod, a “single-crystal” type texture is observed; the a fibre remains for the intermediate diameter of the rod. For the rod cold rolled with a

  8. Correlation of microstructure and low cycle fatigue properties for 13.5Cr1.1W0.3Ti ODS steel

    NASA Astrophysics Data System (ADS)

    He, P.; Klimenkov, M.; Möslang, A.; Lindau, R.; Seifert, H. J.

    2014-12-01

    Reduced activation oxide dispersion strengthened (ODS) steels are prospective structural materials for the blanket system and first wall components in Tokamak-type fusion reactors. Under the pulsed operation, these components will be predominantly subjected to cyclic thermal-mechanical loading which leads to inevitable fatigue damage. In this work, strain controlled isothermal fatigue tests were conducted for 13.5Cr1.1W0.3Ti ODS steel at 550 °C. The total strain range varied from 0.54% to 0.9%. After thermomechanical processing, 13.5CrWTi-ODS steel exhibits a remarkable lifetime extension with a factor of 10-20 for strain ranges Δε ⩽ 0.7%. 13.5Cr ODS steel shows no cyclic softening at all during the whole testing process irrespective of the strain range. TEM observations reveal ultrastable grain structure and constant dislocation densities around 1014 m-2, independent of the number of cycles or the applied strain amplitude. The presence of the stabilized ultrafine Y-Ti-O dispersoids enhances the microstructural stability and therefore leads to outstanding fatigue resistance for 13.5Cr1.1W0.3Ti-ODS steel.

  9. Energy-filtered TEM imaging and EELS study of ODS particles and argon-filled cavities in ferritic-martensitic steels.

    PubMed

    Klimiankou, M; Lindau, R; Möslang, A

    2005-01-01

    Oxide-dispersion-strengthened (ODS) ferritic-martensitic steels with yttrium oxide (Y(2)O(3)) have been produced by mechanical alloying and hot isostatic pressing for use as advanced material in fusion power reactors. Argon gas, usually widely used as inert gas during mechanical alloying, was surprisingly detected in the nanodispersion-strengthened materials. Energy-filtered transmission electron microscopy (EFTEM) and electron energy loss spectroscopy (EELS) led to the following results: (i) chemical composition of ODS particles, (ii) voids with typical diameters of 1-6 nm are formed in the matrix, (iii) these voids are filled with Ar gas, and (iv) the high-density nanosized ODS particles serve as trapping centers for the Ar bubbles. The Ar L(3,2) energy loss edge at 245 eV as well as the absorption features of the ODS particle elements were identified in the EELS spectrum. The energy resolution in the EEL spectrum of about 1.0 eV allows to identify the electronic structure of the ODS particles.

  10. The OD/OH Isotope Ratio in Comets 8P/Tuttle and C/2012 F6 (Lemmon)

    NASA Astrophysics Data System (ADS)

    Rousselot, Philippe; Jehin, Emmanuel; Hutsemekers, Damien; Manfroid, Jean; Decock, Alice; Bockelee-Morvan, Dominique

    2016-10-01

    The determination of isotopic ratios in solar system objects is an important source of information about their origin, especially for comets. Among these ratios the D/H is of particular importance because of its sensitivity to fractionation processes and physical environment, and the abundance of hydrogen in the solar system. The main molecule used to derive this ratio in comets is water. So far, apart water, only HCN has permitted to derive D/H ratio and not only upper limits.Most of the existing determinations of D/H in water molecules have been obtained by spectroscopic observations of water lines in the sub-mm or near infrared range [1,2]. So far only one measurement has been based on OD/OH emission lines radicals in the near-UV [3] and another one on the Lyman-alpha D emission [4]. In situ measurements have also been obtained in comets 1P/Halley and 67P/Churyumov-Gerasimenko using mass spectrometer [5,6,7,8].In this work we have used the OH and OD ultraviolet bands at 310 nm observed with the ESO 8-m Very Large Telescope feeding the Ultraviolet-Visual Echelle Spectrograph (UVES) for measuring the D/H ratio in comets 8P/Tuttle and C/2012 F6 (Lemmon). The OH and OD being the photodissociation products of H2O and HDO such observations allow to derive D/H ratio for water molecules. This work constitutes an independant determination of the D/H ratios already published for these comets and based on observations performed in the sub-mm and near infrared range of H2O and HDO lines. We present our modeling, data analysis and numerical values obtained for this ratio.[1] D. Bockelée-Morvan et al., 2015, SSR 197, 47-83 [2] N. Biver et al., 2016, A&A 589, id A78, 11p [3] D. Hutsemékers et al., 2008, A&A 490, L31 [4] H.A. Weaver et al., 2008, LPI Contributions 1405, 8216 [5] H. Balsiger, K. Altwegg, J. Geiss, 1995, JGR 100, 5827 [6] P. Eberhardt et al., 1995, A&A 302, 301 [7] R.H. Brown et al., 2012, PSS 60, 166 [8] K. Alwegg et al., 2015, Science 347, article id. 1261952

  11. Selective laser sintering of MA956 oxide dispersion strengthened steel

    NASA Astrophysics Data System (ADS)

    Hunt, Ryan M.; Kramer, Kevin J.; El-Dasher, Bassem

    2015-09-01

    Oxide Dispersion Strengthened (ODS) steels' qualities of radiation damage resistance and high strength at high temperature make them promising nuclear structural materials. However, the dispersed yttria that gives ODS steel its beneficial qualities are generally compromised during joining processes, making fabrication difficult and expensive. The selective laser sintering process offers a potential path through this barrier by which net-shape parts can feasibly be built via additive manufacturing without fully melting the structure. Rastering a 400 W laser over a 110 μm MA956 ODS steel powder bed, we additively built parts with varying build conditions. Although density was achieved to within 97% of the wrought MA956, ultimate tensile strengths achieved only 65% of the wrought strength. Spectroscopy analysis points to the agglomeration of the yttria nano-particles as a possible explanation for the loss in strength. Further study might benefit from exploration of other parameters such as thinner powder build layers which would require less energy input to achieve sintering while minimizing time above the melting temperature.

  12. Hot rolling and annealing effects on the microstructure and mechanical properties of ODS austenitic steel fabricated by electron beam selective melting

    NASA Astrophysics Data System (ADS)

    Gao, Rui; Ge, Wen-jun; Miao, Shu; Zhang, Tao; Wang, Xian-ping; Fang, Qian-feng

    2016-03-01

    The grain morphology, nano-oxide particles and mechanical properties of oxide dispersion strengthened (ODS)-316L austenitic steel synthesized by electron beam selective melting (EBSM) technique with different post-working processes, were explored in this study. The ODS-316L austenitic steel with superfine nano-sized oxide particles of 30-40 nm exhibits good tensile strength (412 MPa) and large total elongation (about 51%) due to the pinning effect of uniform distributed oxide particles on dislocations. After hot rolling, the specimen exhibits a higher tensile strength of 482 MPa, but the elongation decreases to 31.8% owing to the introduction of high-density dislocations. The subsequent heat treatment eliminates the grain defects induced by hot rolling and increases the randomly orientated grains, which further improves the strength and ductility of EBSM ODS-316L steel.

  13. OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels.

    PubMed

    Jalali, Amir; Bosmans, Frank; Amininasab, Mehriar; Clynen, Elke; Cuypers, Eva; Zaremirakabadi, Abbas; Sarbolouki, Mohammad-Nabi; Schoofs, Liliane; Vatanpour, Hossein; Tytgat, Jan

    2005-08-01

    In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Na(v)1.2/beta1, Na(v)1.5/beta1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC50 = 80+/-14 nM) while Na(v)1.2/beta1 still was not affected at concentrations up to 5 microM. Na(v)1.5/beta1 was influenced at micromolar concentrations.

  14. Stabilization of alkane radical-cations, their transport and capture under low temperature irradiation of solutions. Study by the OD ESR technique

    NASA Astrophysics Data System (ADS)

    Tadjikov, B. M.; Melekhov, V. I.; Anisimov, O. A.; Molin, Yu. N.

    The spectra of stabilized solvent holes were obtained by the method of optically detected ESR (OD ESR) in glassy matrices at 77 K. Using this technique we obtained the spectra for radical-cations of cis-decalin, squalene, 2-methylpentane, 3-methylpentane, 3,3-dimethylpentane, 3-methylheptane and 2,3-dimethylbutane. For all matrices except that of squalene, an hf-structure in the OD ESR spectra belonging to the radical-cations of matrices used is detected. Thus an unpaired electron is shown to be localized mainly on one molecule. The efficiency of hole transfer to acceptors with a lower ionization potential is studied in squalene and cis-decalin. It increases with difference in ionization Δ > 0.3 eV. The data on positive charge transfer provided by the OD ESR technique in the present paper, testify in favour of the long range single step tunneling.

  15. Triplet-extinction coefficients of some laser dyes. 1

    SciTech Connect

    Pavlopoulos, T.G.; Golich, D.J.

    1989-03-01

    For flashlamp-pumped dye lasers, the negative effect of triplet-state losses on laser action efficiency is well known. Oscilloscope traces of laser pulses showed that laser action diminishes much sooner than the flashlamp excitation pulse. This effect was attributed to the buildup of triplet-state dye molecules during the excitation from the flashlamp pulse. Triplet-extinction coefficients epsilon(T) were measured over the laser-action spectral region of Rhodamine 6G; Rhodamine B; Rhodamine 110; Fluorol-7GA; Coumarin 540A; Coumarin 522; Coumarin 1; Coumarin 120; 4,4'-diphenyl stilbene; and 2,7-bis(4-methoxy-phenyl)-9,9-dipropylfluorene. The different lines from an argon-ion cw laser were employed for excitation. McClure's method was used to obtain the triplet extinction coefficients Epsilon(T). The method requires the measurement of triplet optical densities OD(T) as a function of different cw laser-excitation intensities (powers) I(ex). The importance of triplet-state losses on dye-laser efficiency is reviewed. The laser action properties of the laser dyes studied are briefly discussed as they relate to the measured epsilon=(T) values.

  16. Bilateral Symmetry before and Six Months after Aberration-Free™ Correction with the SCHWIND AMARIS TotalTech Laser: Clinical Outcomes

    PubMed Central

    Arbelaez, Maria Clara; Vidal, Camila; Arba-Mosquera, Samuel

    2010-01-01

    Purpose To compare the preoperative and postoperative bilateral symmetry between OD and OS eyes that have undergone femto-LASIK using the Ziemer LDV femtosecond laser system, the SCHWIND AMARIS Excimer Laser and the Aberrationfree™ profiles implemented in the SCHWIND Custom Ablation Manager software. Methods A total of 25 LASIK patients were bilaterally evaluated at the six-month follow-up visit. In all cases standard examinations, pre- and postoperative analysis with corneal wavefront topography (OPTIKON Scout) were performed. Aberration-free™ aspheric treatments were devised using the Custom Ablation Manager software and ablations were performed by means of the SCHWIND AMARIS flying-spot excimer laser system (both SCHWIND eyetech- solutions). In all cases LASIK flaps were created using an LDV femtosecond laser (Ziemer Group). The OD/OS bilateral symmetry was evaluated in terms of corneal wavefront aberration. Results Preoperatively, 11 Zernike terms showed significant bilateral (OS-vs.-OD) symmetry, and only 6 Zernike terms were significantly different. Overall, 23 out of the 25 patients showed significant bilateral symmetry, and only 2 out of 25 patients showed significant differences. None of the aberration metrics changed from pre- to postoperative values by a clinically relevant amount. At the 6-month postoperative visit, 12 Zernike terms showed significant symmetry, and 8 terms were significantly different. Overall, 22 out of 25 patients showed significant bilateral symmetry (OS vs. OD), and only 3 out of 25 patients showed significant differences. Also, this postoperative examination revealed that 6 Zernike terms lost significant OS-vs.-OD symmetry, but 4 Zernike terms gained significant symmetry. Finally, 4 patients lost significant bilaterality, and 2 patients gained significant bilaterality: bilateral symmetry between eyes was better maintained in those patients with a clear preoperative bilateral symmetry. Conclusions Aberration-Free Treatments with

  17. Microstructural characterization of oxide dispersion strengthened (ODS) Fe-12Cr-0.5Y2O3 alloy

    NASA Astrophysics Data System (ADS)

    Shamsudin, Farha Mizana; Radiman, Shahidan; Abdullah, Yusof; Hamid, Nasri A.

    2016-11-01

    Oxide dispersion strengthened (ODS) ferritic alloy containing 12wt% Cr and 0.5wt% Y2O3 was prepared by mechanical alloying (MA) method and then compacted into bulk shape. Field emission scanning electron microscopy (FESEM) was performed to characterize the microstructure of milled alloy powder. The fragments and nanoclusters of Y2O3 were observed in this alloy powder. FESEM-EDS mapping on the milled alloy powder reveal the uniformity of the element distribution achieved by the alloy. The Y element is finely dispersed into the alloy matrix and the O element is observed indicating the presence of oxides throughout the alloy sample. The compacted alloy was then heat treated at 1050°C and analyzed by field emission scanning electron microscope (FESEM). The formations of nano-scale Y2O3 were observed after the heat treatment process of alloy indicating the dispersion and incorporation of Y2O3 nanoparticles into the alloy matrix.

  18. The Optical Depth Sensor (ODS) in the DREAMS package onboard the Exomars Entry Descent and Landing Demonstrator Module

    NASA Astrophysics Data System (ADS)

    Rannou, P.; Pommereau, J.-P.; Sarkissian, A.; Foujols, T.

    2012-09-01

    The optical depth sensor (ODS) is designed to retrieve the optical depth of the dust layer and to characterize the high altitude clouds on Mars. It was developped initially for the mission MARS 96, and also was included in the payload of several other missions. The sensor was finally built and used for a field experiment in Africa in order to validate the concept and test the performance. In this work we present main principle of the retrieval, the instrumental concept and the result of the tests performed during the 2004-2005 winter field experiment. It is now included in the package DREAM, which is part of the payload of the EDM on Mars 2016 and associated to two terrestrial campaigns, in tropical environment (Brasil) and in the arctic environment.

  19. Use of neutron and X-ray diffraction to study the precipitation mechanisms of oxides in ODS materials

    NASA Astrophysics Data System (ADS)

    Toualbi, L.; Ratti, M.; André, G.; Onimus, F.; de Carlan, Y.

    2011-10-01

    It is usually accepted that the formation of nano-clusters inside Oxide Dispersion Strengthened (ODS) materials is due to the dissolution of the yttrium oxide during the mechanical alloying and to the precipitation of the nano-oxides during the consolidation process. A study was conducted to follow the dissolution and the re-precipitation of the phases after mechanical alloying and different heat treatments. A Fe-9Cr powder was milled during different milling times with 10 wt.% of yttria and/or titanium in a planetary mill. Using neutron and X-ray diffractions and the Rietveld method, the dissolution and re-precipitation of yttria was investigated. Even with a content of 10 wt.%, the yttria particles disappear during milling to form a structure which can be described as Fe crystallites coexisting with amorphous domains composed of Y and O atoms. After annealing Y and O atoms re-precipitate into the matrix to form yttria crystallites.

  20. Short Communication on "Coarsening of Y-rich oxide particles in 9%Cr-ODS Eurofer steel annealed at 1350 °C"

    NASA Astrophysics Data System (ADS)

    Sandim, M. J. R.; Souza Filho, I. R.; Bredda, E. H.; Kostka, A.; Raabe, D.; Sandim, H. R. Z.

    2017-02-01

    Oxide-dispersion strengthened (ODS) Eurofer steel is targeted for structural applications in future fusion nuclear reactors. Samples were cold rolled down to 80% reduction in thickness and annealed at 1350 °C up to 8 h. The microstructural characterization was performed using Vickers microhardness testing, electron backscatter diffraction, scanning and scanning transmission electron microscopies. Experimental results provide evidence of coarsening of the Y-rich oxide particles in ODS-Eurofer steel annealed at 1350 °C within delta ferrite phase field.

  1. Laser principles.

    PubMed

    Bogdan Allemann, Inja; Kaufman, Joely

    2011-01-01

    Since the construction of the first laser in the 1960s, the role that lasers play in various medical specialities, including dermatology, has steadily increased. However, within the last 2 decades, the technological advances and the use of lasers in the field of dermatology have virtually exploded. Many treatments have only become possible with the use of lasers. Especially in aesthetic medicine, lasers are an essential tool in the treatment armamentarium. Due to better research and understanding of the physics of light and skin, there is now a wide and increasing array of different lasers and devices to choose from. The proper laser selection for each indication and treatment requires a profound understanding of laser physics and the basic laser principles. Understanding these principles will allow the laser operator to obtain better results and help avoid complications. This chapter will give an in-depth overview of the physical principles relevant in cutaneous laser surgery. Copyright © 2011 S. Karger AG, Basel.

  2. Characteristic results and prospects of the 13Cr-1W-0.3Ti-0.3Y 2O 3 ODS steel

    NASA Astrophysics Data System (ADS)

    Eiselt, Ch. Ch.; Klimenkov, M.; Lindau, R.; Möslang, A.

    2009-04-01

    For specific blanket and divertor applications in future fusion power reactors a replacement of presently considered reduced activation ferritic martensitic (RAFM) steels as structural material by suitable oxide dispersion strengthened (ODS) ferritic martensitic steels would allow a substantial increase of the operating temperature from ˜550 °C to about 650 °C. Temperatures above 700 °C in the He cooled modular divertor concept necessitates the use of ferritic (RAF) ODS steels, which are not limited by a phase transition. Therefore a 13Cr-1W-0.3Ti-0.3Y 2O 3 ferritic ODS steel is being developed, using an Attritor with varying milling parameters. Afterwards the mechanically alloyed powders were encapsulated, sealed and consolidated in a hot isostatic press device. In this work, the effects of several parameter variations on the microstructure of the produced ferritic ODS-alloys, analysed by optical microscopy (OM) and high resolution TEM, as well as results of conducted mechanical tests are presented.

  3. Producing a Climate-Quality Database of Global Upper Ocean Profile Temperatures - The IQuOD (International Quality-controlled Ocean Database) Project.

    NASA Astrophysics Data System (ADS)

    Sprintall, J.; Cowley, R.; Palmer, M. D.; Domingues, C. M.; Suzuki, T.; Ishii, M.; Boyer, T.; Goni, G. J.; Gouretski, V. V.; Macdonald, A. M.; Thresher, A.; Good, S. A.; Diggs, S. C.

    2016-02-01

    Historical ocean temperature profile observations provide a critical element for a host of ocean and climate research activities. These include providing initial conditions for seasonal-to-decadal prediction systems, evaluating past variations in sea level and Earth's energy imbalance, ocean state estimation for studying variability and change, and climate model evaluation and development. The International Quality controlled Ocean Database (IQuOD) initiative represents a community effort to create the most globally complete temperature profile dataset, with (intelligent) metadata and assigned uncertainties. With an internationally coordinated effort organized by oceanographers, with data and ocean instrumentation expertise, and in close consultation with end users (e.g., climate modelers), the IQuOD initiative will assess and maximize the potential of an irreplaceable collection of ocean temperature observations (tens of millions of profiles collected at a cost of tens of billions of dollars, since 1772) to fulfil the demand for a climate-quality global database that can be used with greater confidence in a vast range of climate change related research and services of societal benefit. Progress towards version 1 of the IQuOD database, ongoing and future work will be presented. More information on IQuOD is available at www.iquod.org.

  4. Multicentre study of effects of Org OD 14 on endometrium, vaginal cytology and cervical mucus in post-menopausal and oophorectomized women.

    PubMed

    Punnonen, R; Liukko, P; Cortes-Prieto, J; Eydam, F; Milojevic, S; Trévoux, R; Chryssikopoulos, E; Franchi, F; Luisi, M; Kicovic, P M

    1984-04-01

    A multicentre study covering 69 post-menopausal or oophorectomized women was performed to determine whether Org OD 14 [7 alpha, 17 alpha)-17-hydroxy-7-methyl-19-norpregn-5(10)-en-20-yn-3-one) administered orally in a daily dose of 2.5 mg for 90 consecutive days induces endometrial proliferation. The treatment with Org OD 14 was continued in combination with 1 mg/day of lynestrenol from day 91 for 10 days to ascertain whether secretory transformation of the endometrium and subsequent withdrawal bleeding would occur. Endometrial biopsies were obtained before treatment and on day 91. The effects of Org OD 14 on vaginal mucosa and cervical mucus were also evaluated. Org OD 14 did not display any effect on the endometrium in 56 of the study subjects (83.5%). Weak stimulation (initial proliferation) was seen in 11 of the subjects (16.4%) and withdrawal bleeding occurred in only 5 of these after cessation of the combined treatment with lynestrenol. However, moderate 'oestrogenic' effects on vaginal mucosa and cervical mucus were induced in all study subjects.

  5. Laser clock

    SciTech Connect

    Facklam, R.L.

    1983-05-26

    A laser clock includes a linear laser in one embodiment of the clock and a ring laser gyro in the other embodiment. The linear laser is frequency stabilized and utilizes a single active medium in the form of a low pressure gas, such as He-Ne, with a Doppler broadened gain curve. The ring laser gyro is a four frequency laser with a Faraday rotor. Detector and electronic circuitry associated with the laser of each embodiment detects a beat frequency and convert it to a clock signal.

  6. Atmospheric Chemistry of Tetrahydrofuran, 2-Methyltetrahydrofuran, and 2,5-Dimethyltetrahydrofuran: Kinetics of Reactions with Chlorine Atoms, OD Radicals, and Ozone.

    PubMed

    Andersen, Christina; Nielsen, Ole John; Østerstrøm, Freja F; Ausmeel, Stina; Nilsson, Elna J K; Sulbaek Andersen, Mads P

    2016-09-22

    FTIR smog chamber techniques were used to study the kinetics of the gas-phase reactions of Cl atoms, OD radicals, and O3 with the five-membered ring-structured compounds tetrahydrofuran (C4H8O, THF), 2-methyltetrahydrofuran (CH3C4H7O, 2-MTHF), 2,5-dimethyltetrahydrofuran ((CH3)2C4H5O, 2,5-DMTHF), and furan (C4H4O). The rate coefficients determined using relative rate methods were kTHF+Cl = (1.96 ± 0.24) × 10(-10), kTHF+OD = (1.81 ± 0.27) × 10(-11), kTHF+O3 = (6.41 ± 2.90) × 10(-21), k2-MTHF+Cl = (2.65 ± 0.43) × 10(-10), k2-MTHF+OD = (2.41 ± 0.51) × 10(-11), k2-MTHF+O3 = (1.87 ± 0.82) × 10(-20), k2,5-DMTHF+OD = (4.56 ± 0.68) × 10(-11), k2,5-DMTHF+Cl = (2.84 ± 0.34) × 10(-10), k2,5-DMTHF+O3 = (4.58 ± 2.18), kfuran+Cl = (2.39 ± 0.27) × 10(-10), and kfuran+O3 = (2.60 ± 0.31) × 10(-18) molecules cm(-3) s(-1). Rate coefficients of the reactions with ozone were also determined using the absolute rate method under pseudo-first-order conditions. OD radicals, in place of OH radicals, were produced from CD3ONO to avoid spectral overlap of isopropyl and methyl nitrite with the reactants. The kinetics of OD radical reactions are expected to resemble the kinetics of OH radical reactions, and the rate coefficients of the reactions with OD radicals were used to calculate the atmospheric lifetimes with respect to reactions with OH radicals. The lifetimes of THF, 2-MTHF, and 2,5-DMTHF are approximately 15, 12, and 6 h, respectively.

  7. Dual and Triple Ion-Beam Irradiations of Fe, Fe(Cr) and Fe(Cr)-ODS Final Report: IAEA SMoRE CRP

    SciTech Connect

    Fluss, M J; Hsiung, L L; Marian, J

    2011-11-20

    Structures of nanoparticles in Fe-16Cr-4.5Al-0.3Ti-2W-0.37Y2O3 (K3) and Fe-20Cr-4.5Al-0.34Ti-0.5Y2O3 (MA956) oxide dispersion strengthened (ODS) ferritic steels produced by mechanical alloying (MA) and followed by hot extrusion have been studied using high-resolution transmission electron microscopy (HRTEM) techniques to gain insight about the formation mechanism of nanoparticles in MA/ODS steels. The observations of Y-Al-O complex-oxide nanoparticles in both ODS steels imply that decomposition of Y2O3 in association with internal oxidation of Al occurred during mechanical alloying. While the majority of oxide nanoparticles formed in both steels is Y4Al2O9, a few oxide particles of YAlO3 are also occasionally observed. These results reveal that Ti (0.3 wt %) plays an insignificant role in forming oxide nanoparticles in the presence of Al (4.5 wt %). HRTEM observations of crystalline nanoparticles larger than {approx}2 nm and amorphous or disordered cluster domains smaller than {approx}2 nm provide an insight into the formation mechanism of oxide nanoparticle in MA/ODS steels, which we believe from our observations involves a solid-state amorphous precursor followed by recrystallization. Dual ion-beam irradiations using He{sup +} + Fe{sup +8} ions were employed to gain more detailed insight about the role of nanoparticles in suppressing radiation-induced swelling. This is elaborated through TEM examinations of cavity distributions in ion-irradiated Fe-14Cr and K3-ODS ferritic steels. HRTEM observations of helium-filled cavities (helium bubbles) preferably trapped at nanoscale oxide particles and clusters in ion-irradiated K3-ODS are presented. Finally, we describe the results from triple ion-beam irradiations using H{sup +} + He{sup +} + Fe{sup +8} ions to emulate fusion first wall radiation effects. Preliminary work is reported that confirms the existence of significant hydrogen synergistic effects described earlier by Tanaka et al., for Fe(Cr) and by Wakai et al

  8. Blue Laser.

    DTIC Science & Technology

    1985-12-01

    HOLLOW CATHODE LASER FABRICATION 13 4. EXPERIENCE WITH THE BLUE LASER 18 4.1 Operational and Processing Experience 18 4.2 Performance Testing 20 5...34 -. - . •. SECTION 3 BLUE HOLLOW CATHODE LASER FABRICATION This section presents an overview of the steps taken in creating a HCL. There is...to the laser assembly. These steps can actually be considered as the final steps in laser fabrication because some of them involve adding various

  9. Fragmentation of doubly-protonated peptide ion populations labeled by H/D exchange with CD3OD

    NASA Astrophysics Data System (ADS)

    Herrmann, Kristin A.; Kuppannan, Krishna; Wysocki, Vicki H.

    2006-03-01

    Doubly-protonated bradykinin (RPPGFSPFR) and an angiotensin III analogue (RVYIFPF) were subjected to hydrogen/deuterium (H/D) exchange with CD3OD in a Fourier transform ion cyclotron resonance (FT-ICR) mass spectrometer. A bimodal distribution of deuterium incorporation was present for bradykinin after H/D exchange for 90 s at a CD3OD pressure of 4 × 10-7 Torr, indicating the existence of at least two distinct populations. Bradykinin ion populations corresponding to 0-2 and 5-11 deuteriums (i.e., D0, D1, D2, D5, D6, D7, D8, D9, D10, and D11) were each monoisotopically selected and fragmented via sustained off-resonance irradiation (SORI) collision-induced dissociation (CID). The D0-D2 ion populations, which correspond to the slower exchanging population, consistently require lower SORI amplitude to achieve a similar precursor ion survival yield as the faster-reacting (D5-D11) populations. These results demonstrate that conformation/protonation motif has an effect on fragmentation efficiency for bradykinin. Also, the partitioning of the deuterium atoms into fragment ions suggests that the C-terminal arginine residue exchanges more rapidly than the N-terminal arginine. Total deuterium incorporation in the b1/y8 and b2/y7 ion pairs matches very closely the theoretical values for all ion populations studied, indicating that the ions of a complementary pair are likely formed during the same fragmentation event, or that no scrambling occurs upon SORI. Deuterium incorporation into the y1/a8 pseudo-ion pair does not closely match the expected theoretical values. The other peptide, doubly-protonated RVYIFPF, has a trimodal distribution of deuterium incorporation upon H/D exchange with CD3OD at a pressure of 1 × 10-7 Torr for 600 s, indicating at least three distinct ion populations. After 90 s of H/D exchange where at least two distinct populations are detected, the D0-D7 ion populations were monoisotopically selected and fragmented via SORI-CID over a range of SORI

  10. Raman Laser Spectrometer internal Optical Head current status: opto-mechanical redesign to minimize the excitation laser trace

    NASA Astrophysics Data System (ADS)

    Sanz, Miguel; Ramos, Gonzalo; Moral, Andoni; Pérez, Carlos; Belenguer, Tomás; del Rosario Canchal, María; Zuluaga, Pablo; Rodriguez, Jose Antonio; Santiago, Amaia; Rull, Fernando; Instituto Nacional de Técnica Aeroespacial (INTA), Universidad de Valladolid (UVa), Ingeniería de Sistemas para la Defesa de España S.A. (ISDEFE)

    2016-10-01

    Raman Laser Spectrometer (RLS) is the Pasteur Payload instruments of the ExoMars mission, within the ESA's Aurora Exploration Programme, that will perform for the first time in an out planetary mission Raman spectroscopy. RLS is composed by SPU (Spectrometer Unit), iOH (Internal Optical Head), and ICEU (Instrument Control and Excitation Unit). iOH focuses the excitation laser on the samples (excitation path), and collects the Raman emission from the sample (collection path, composed on collimation system and filtering system). The original design presented a high laser trace reaching to the detector, and although a certain level of laser trace was required for calibration purposes, the high level degrades the Signal to Noise Ratio confounding some Raman peaks.The investigation revealing that the laser trace was not properly filtered as well as the iOH opto-mechanical redesign are reported on. After the study of the Long Pass Filters Optical Density (OD) as a function of the filtering stage to the detector distance, a new set of filters (Notch filters) was decided to be evaluated. Finally, and in order to minimize the laser trace, a new collection path design (mainly consisting on that the collimation and filtering stages are now separated in two barrels, and on the kind of filters to be used) was required. Distance between filters and collimation stage first lens was increased, increasing the OD. With this new design and using two Notch filters, the laser trace was reduced to assumable values, as can be observed in the functional test comparison also reported on this paper.

  11. High-rate and low-cost production of very large flat optical debris shields for the French Megajoule laser project

    NASA Astrophysics Data System (ADS)

    Garret, Thierry; Chabassier, Genevieve; Roussel, Andre

    1997-12-01

    Sfim ODS is involved in the French Megajoule Project managed by the Commissariat a l'Energie Atomique. It is a high power UV-laser using 240 square beams (410 mm X 410 mm). Sfim ODS achieved a technical and economical analysis concerning the production of flat-parallel debris-shields in silica (430 X 430 X 6 mm, transmitted wavefront: (lambda) /2, 2 500 shields/year) using large and specific dual-side fine- grinding and polishing machines. This analysis was supported by trials using half-scale windows (same stiffness equals> thickness equals 1.7 mm) showing the ability to reach the specifications with low production costs.

  12. High-rate and low-cost production of very large flat optical debris shields for the French high-power UV laser project

    NASA Astrophysics Data System (ADS)

    Garret, Thierry; Chabassier, Genevieve; Roussel, Andre

    1996-08-01

    SFIM ODS is involved in the French MEGAJOULE Project managed by the Commissariat a l'Energie Atomique. It is a high power UV-laser using 240 square beams. SFIM ODS achieved a technical and economical analysis concerning the production of flat-parallel debris-shields in silica using large and specific dual-side fine-grinding and polishing machines. This analysis was supported by trials using half-scale windows showing the ability to reach the specifications with low production costs.

  13. Characterization of HR coatings for the megajoule laser transport mirrors

    SciTech Connect

    Fornier, A.; Cordillot, C.; Bernardino, D.; Lam, O.; Roussel, A.

    1997-12-01

    One of the concerns with the Megajoule Laser design is the laser-induced damage threshold of the transport mirrors. Earlier studies have shown that the main constraint on the laser damage threshold comes from nodules at the mirror surface. It is therefore important to restrict the number of such nodules. SFIM-ODS, in close collaboration with CEL-V, has initiated a special study to characterize these nodules as precisely as possible. The objective of the study is twofold: (1) to determine the origin of the nodules and subsequently to adapt the mirror fabrication process in order to limit their formation, (2) to analyze their shapes and dimensions in order to ascertain which nodules are critical for laser-induced damage. To understand the origin of the nodules and their effect on the laser damage threshold, the mirrors are characterized using various methods, (3) absorption and scatter mapping: does the presence of nodules result in specific absorption patterns? (4) surface analysis by atomic force microscopy: to characterize nodule shape and dimensions, (5) Focused Ion Beam (FIB) cutting of nodules: to locate the seed initiating the nodule (on the substrate or in the stack), and to characterize the seed shape and composition (contamination, material spatter during evaporation, etc.), and (6) laser damage threshold measurements: to determine the laser damage threshold of the mirror and study the behavior of nodules under laser irradiation depending on their dimensions and shape.

  14. Morphology-dependent optical anisotropies in the n -type polymer P(NDI2OD-T2)

    NASA Astrophysics Data System (ADS)

    Brown, Steven J.; Schlitz, Ruth A.; Chabinyc, Michael L.; Schuller, Jon A.

    2016-10-01

    Organic semiconductors tend to self-assemble into highly ordered and oriented morphologies with anisotropic optical properties. Studying these optical anisotropies provides insight into processing-dependent structural properties and informs the photonic design of organic photovoltaic and light-emitting devices. Here we measure the anisotropic optical properties of spin-cast films of the n -type polymer P(NDI2OD-T2) using momentum-resolved absorption and emission spectroscopies. We quantify differences in the optical anisotropies of films deposited with distinct face-on and edge-on morphologies. In particular, we infer a substantially larger out-of-plane tilt angle of the optical transition dipole moment in high temperature annealed, edge-on films. Measurements of spectral differences between in-plane and out-of-plane dipoles, further indicate regions of disordered polymers in low temperature annealed face-on films that are otherwise obscured in traditional x-ray and optical characterization techniques. The methods and analysis developed in this work provide a way to identify and quantify subtle optical and structural anisotropies in organic semiconductors that are important for understanding and designing highly efficient thin film devices.

  15. Development of next generation tempered and ODS reduced activation ferritic/martensitic steels for fusion energy applications

    NASA Astrophysics Data System (ADS)

    Zinkle, S. J.; Boutard, J. L.; Hoelzer, D. T.; Kimura, A.; Lindau, R.; Odette, G. R.; Rieth, M.; Tan, L.; Tanigawa, H.

    2017-09-01

    Reduced activation ferritic/martensitic steels are currently the most technologically mature option for the structural material of proposed fusion energy reactors. Advanced next-generation higher performance steels offer the opportunity for improvements in fusion reactor operational lifetime and reliability, superior neutron radiation damage resistance, higher thermodynamic efficiency, and reduced construction costs. The two main strategies for developing improved steels for fusion energy applications are based on (1) an evolutionary pathway using computational thermodynamics modelling and modified thermomechanical treatments (TMT) to produce higher performance reduced activation ferritic/martensitic (RAFM) steels and (2) a higher risk, potentially higher payoff approach based on powder metallurgy techniques to produce very high strength oxide dispersion strengthened (ODS) steels capable of operation to very high temperatures and with potentially very high resistance to fusion neutron-induced property degradation. The current development status of these next-generation high performance steels is summarized, and research and development challenges for the successful development of these materials are outlined. Material properties including temperature-dependent uniaxial yield strengths, tensile elongations, high-temperature thermal creep, Charpy impact ductile to brittle transient temperature (DBTT) and fracture toughness behaviour, and neutron irradiation-induced low-temperature hardening and embrittlement and intermediate-temperature volumetric void swelling (including effects associated with fusion-relevant helium and hydrogen generation) are described for research heats of the new steels.

  16. Spatio-Temporal Characteristics of Resident Trip Based on Poi and OD Data of Float CAR in Beijing

    NASA Astrophysics Data System (ADS)

    Mou, N.; Li, J.; Zhang, L.; Liu, W.; Xu, Y.

    2017-09-01

    Due to the influence of the urban inherent regional functional distribution, the daily activities of the residents presented some spatio-temporal patterns (periodic patterns, gathering patterns, etc.). In order to further understand the spatial and temporal characteristics of urban residents, this paper research takes the taxi trajectory data of Beijing as a sample data and studies the spatio-temporal characteristics of the residents' activities on the weekdays. At first, according to the characteristics of the taxi trajectory data distributed along the road network, it takes the Voronoi generated by the road nodes as the research unit. This paper proposes a hybrid clustering method - based on grid density, which is used to cluster the OD (origin and destination) data of taxi at different times. Then combining with the POI data of Beijing, this research calculated the density of the POI data in the clustering results, and analyzed the relationship between the activities of residents in different periods and the functional types of the region. The final results showed that the residents were mainly commuting on weekdays. And it found that the distribution of travel density showed a concentric circle of the characteristics, focusing on residential areas and work areas. The results of cluster analysis and POI analysis showed that the residents' travel had experienced the process of "spatial relative dispersion - spatial aggregation - spatial relative dispersion" in one day.

  17. Atmospherically Related Studies of O(D-1) and O2 (b'Sigma(sub g, sup +)

    NASA Technical Reports Server (NTRS)

    Slanger, Tom G.

    1998-01-01

    For the third year of the grant, we propose to investigate the (beta)'(Sigma)(sub g, sup +). Our earlier value of 0.77 +/- 0.23, which has been used for a long time, should be updated, and the error limits reduced. Current measurements in J. Barker's group at the University of Michigan have assigned a value closer to 0.9, and we will conduct a new evaluation. The goals of this project are to investigate various aspects of the photochemistry of O('D) and O2(beta)'(Sigma)(sub g, sup +) that are of relevance to the photochemistry and energy balance of the terrestrial atmosphere. Over the last six months, we have obtained new sky spectra data files from the Keck telescope via Don Osterbrock at UC Santa Cruz, and now 120 hours of data have been accumulated. Thus, we have been able to make large signal/noise improvements of the O2(b'(Sigma)(sub g, sup +) - X(sup 3)(Sigma)(Sub g, sup -) Atmospheric Band data that we are collecting.

  18. Annealing effects on the microstructure and mechanical properties of hot-rolled 14Cr-ODS steel

    NASA Astrophysics Data System (ADS)

    Gao, R.; Zhang, T.; Ding, H. L.; Jiang, Y.; Wang, X. P.; Fang, Q. F.; Liu, C. S.

    2015-10-01

    The oxide dispersion strengthened ferritic steels with nominal composition (weight percent) of Fe-14Cr-2W-0.5Ti-0.06Si-0.2V-0.1Mn-0.05Ta-0.03C-0.3Y2O3 were fabricated by sol-gel method, mechanical alloying, and hot isostatic pressing techniques. The evolution of microstructure and mechanical properties of the hot-rolled specimens with heat treatment was investigated. Tensile strength and hardness of hot-rolled ODS steel are significantly enhanced due to the formation of mechanical twins and high density dislocations. Uniformly dispersed oxide particles (10-40 nm) and fine-grained structure (200-400 nm) are responsible for the superior mechanical properties of the hot-rolled specimen annealed between 650 °C and 850 °C. With further increasing annealing temperature, the grain size of the hot-rolled specimens increases while the size of oxide particles decreases, which leads to lower strength and hardness but better ductility. The tensile strength and total elongation of samples in the rolling direction are higher than those in the transverse direction after the same treatments owing to the grain anisotropy induced by the large mechanical deformation.

  19. Development of an HPLC Method with an ODS Column to Determine Low Levels of Aspartame Diastereomers in Aspartame.

    PubMed

    Ohtsuki, Takashi; Nakamura, Ryoichiro; Kubo, Satoru; Otabe, Akira; Oobayashi, Yoko; Suzuki, Shoko; Yoshida, Mika; Yoshida, Mitsuya; Tatebe, Chiye; Sato, Kyoko; Akiyama, Hiroshi

    2016-01-01

    α-L-Aspartyl-D-phenylalanine methyl ester (L, D-APM) and α-D-aspartyl-L-phenylalanine methyl ester (D, L-APM) are diastereomers of aspartame (N-L-α-Aspartyl-L-phenylalanine-1-methyl ester, L, L-APM). The Joint FAO/WHO Expert Committee on Food Additives has set 0.04 wt% as the maximum permitted level of the sum of L, D-APM and D, L-APM in commercially available L, L-APM. In this study, we developed and validated a simple high-performance liquid chromatography (HPLC) method using an ODS column to determine L, D-APM and D, L-APM in L, L-APM. The limits of detection and quantification, respectively, of L, D-APM and D, L-APM were found to be 0.0012 wt% and 0.004 wt%. This method gave excellent accuracy, repeatability, and reproducibility in a recovery test performed on five different days. Moreover, the method was successfully applied to the determination of these diastereomers in commercial L, L-APM samples. Thus, the developed method is a simple, useful, and practical tool for determining L, D-APM and D, L-APM levels in L, L-APM.

  20. Development of an HPLC Method with an ODS Column to Determine Low Levels of Aspartame Diastereomers in Aspartame

    PubMed Central

    Ohtsuki, Takashi; Nakamura, Ryoichiro; Kubo, Satoru; Otabe, Akira; Oobayashi, Yoko; Suzuki, Shoko; Yoshida, Mika; Yoshida, Mitsuya; Tatebe, Chiye; Sato, Kyoko; Akiyama, Hiroshi

    2016-01-01

    α-L-Aspartyl-D-phenylalanine methyl ester (L, D-APM) and α-D-aspartyl-L-phenylalanine methyl ester (D, L-APM) are diastereomers of aspartame (N-L-α-Aspartyl-L-phenylalanine-1-methyl ester, L, L-APM). The Joint FAO/WHO Expert Committee on Food Additives has set 0.04 wt% as the maximum permitted level of the sum of L, D-APM and D, L-APM in commercially available L, L-APM. In this study, we developed and validated a simple high-performance liquid chromatography (HPLC) method using an ODS column to determine L, D-APM and D, L-APM in L, L-APM. The limits of detection and quantification, respectively, of L, D-APM and D, L-APM were found to be 0.0012 wt% and 0.004 wt%. This method gave excellent accuracy, repeatability, and reproducibility in a recovery test performed on five different days. Moreover, the method was successfully applied to the determination of these diastereomers in commercial L, L-APM samples. Thus, the developed method is a simple, useful, and practical tool for determining L, D-APM and D, L-APM levels in L, L-APM. PMID:27015640

  1. Interfacial Width Measurements of Dielectric/P(NDI2OD-T2) Using Resonant Soft X-ray Reflectivity

    NASA Astrophysics Data System (ADS)

    Yan, Hongping; Gu, Ziran; Gann, Eliot; Collins, Brian; Swaraj, Sufal; Wang, Cheng; Schuettfort, Torben; McNeill, Chris; Ade, Harald

    2011-03-01

    Interfaces between a conjugated polymer and a dielectric play a critical role in organic thin-film transistors, yet it's difficult to measure. Resonant Soft X-ray Reflectivity (R-SoXR) is a unique and relatively simple method to investigate such interfaces. By tuning the soft X-ray energies, we are able to selectively and quantitatively characterize the interfacial width and thicknesses of the films. In an effort to relate performance to interface structure, we have used R-SoXR to investigate polystyrene (PS) or poly(methyl methacrylate) (PMMA) as the top layer and poly{[N,N9-bis(2-octyldodecyl)-naphtha-lene-1,4,5,8-bis(dicarboximide)-2,6-diyl]-alt-5, 59-(2,29-bithiophene)} (P(NDI2OD-T2)) as bottom layer supported on a Si substrate. We found that the device with PS as dielectric has a higher threshold voltage, which correlates to the increased interfacial trapping due to increased interfacial roughness. The extension of R-SoXR to the energy of fluorine K absorption edge is also demonstrated. NSF DMR-0906457, DOE DE-FG02-98ER45737.

  2. {sup 252}Cf-source-correlated transmission measurements for uranyl fluoride deposit in a 24-in.-OD process pipe

    SciTech Connect

    Uckan, T.; Mihalczo, J.T.; Valentine, T.E.; Mullens, J.A.; Wyatt, M.S.; Hannon, T.F.

    1998-06-01

    Characterization of a hydrated uranyl fluoride (UO{sub 2}F{sub 2}{center_dot}nH{sub 2}O) deposit in a 17-ft-long, 24-in.-OD process pipe at the former Oak Ridge Gaseous Diffusion Plant was successfully performed by using {sup 252}Cf-source-correlated time-of-flight (TOF) transmission measurements. These measurements of neutrons and gamma rays through the pipe from an external {sup 2521}Cf fission source were used to measure the deposit profile and its distribution along the pipe, the hydration (or H/U), and the total uranium mass. The measurements were performed with a source in an ionization chamber on one side of the pipe and detectors on the other. Scanning the pipe vertically and horizontally produced a spatial and time-dependent radiograph of the deposit in which transmitted gamma rays and neutrons were separated in time. The cross-correlation function between the source and the detector was measured with the Nuclear Weapons Identification System. After correcting for pipe effects, the deposit thickness was determined from the transmitted neutrons and H/U from the gamma rays. Results were consistent with a later intrusive observation of the shape and the color of the deposit; i.e., the deposit was annular and was on the top of the pipe at some locations, demonstrating the usefulness of this method for deposit characterization.

  3. Development of next generation tempered and ODS reduced activation ferritic/martensitic steels for fusion energy applications

    DOE PAGES

    Zinkle, S. J.; Boutard, J. L.; Hoelzer, D. T.; ...

    2017-06-09

    Reduced activation ferritic/martensitic steels are currently the most technologically mature option for the structural material of proposed fusion energy reactors. Advanced next-generation higher performance steels offer the opportunity for improvements in fusion reactor operational lifetime and reliability, superior neutron radiation damage resistance, higher thermodynamic efficiency, and reduced construction costs. The two main strategies for developing improved steels for fusion energy applications are based on (1) an evolutionary pathway using computational thermodynamics modelling and modified thermomechanical treatments (TMT) to produce higher performance reduced activation ferritic/martensitic (RAFM) steels and (2) a higher risk, potentially higher payoff approach based on powder metallurgy techniquesmore » to produce very high strength oxide dispersion strengthened (ODS) steels capable of operation to very high temperatures and with potentially very high resistance to fusion neutron-induced property degradation. The current development status of these next-generation high performance steels is summarized, and research and development challenges for the successful development of these materials are outlined. In conclusion, material properties including temperature-dependent uniaxial yield strengths, tensile elongations, high-temperature thermal creep, Charpy impact ductile to brittle transient temperature (DBTT) and fracture toughness behaviour, and neutron irradiation-induced low-temperature hardening and embrittlement and intermediate-temperature volumetric void swelling (including effects associated with fusion-relevant helium and hydrogen generation) are described for research heats of the new steels.« less

  4. Laser Analyzer

    NASA Technical Reports Server (NTRS)

    1993-01-01

    Dopant level analysis is important to the laser system designer because it allows him to model the laser's performance. It also allows the end user to determine what went wrong when a laser fails to perform as expected. Under a Small Business Innovation Research (SBIR) contract, Scientific Materials Corporation has developed a process for producing uniform laser rods in which the amount of water trapped in the crystal during growth is reduced. This research led to the formation of a subsidiary company, Montana Analytical Services, which conducts analysis of laser rods for dopant ion concentrations. This is a significant advance in laser technology.

  5. Lasers of All Sizes

    NASA Astrophysics Data System (ADS)

    Balcou, Philippe; Forget, Sébastien Robert-Philip, Isabelle

    2015-10-01

    * Introduction * The Laser in All Its Forms * Gas lasers * Dye lasers * Solid-state lasers * Lasers for Every Taste * The rise of lasers * Lasers of all sizes * The colors of the rainbow... and beyond * Shorter and shorter lasers * Increasingly powerful lasers * Lasers: A Universal Tool? * Cutting, welding, and cleaning * Communicating * Treating illnesses * Measuring * Supplying energy? * Entertaining * Understanding * Conclusion

  6. Near infrared (NIR) laser mediated surface activation of graphene oxide nanoflakes for efficient antibacterial, antifungal and wound healing treatment.

    PubMed

    Shahnawaz Khan, M; Abdelhamid, Hani Nasser; Wu, Hui-Fen

    2015-03-01

    Photothermal treatment of graphene oxide (GO) for antibacterial, antifungal and controlling the wound infection treatment using near infrared laser (NIR, Nd-YAG (λ=1064 nm) were reported. Various pathogenic bacteria (Pseudomonas aeruginosa, Staphylococcus aureus) and fungi (Saccharomyces cerevisiae and Candida utilis) were investigated. The cytotoxicity was measured using the proteomic analysis by matrix assisted laser desorption/ionization mass spectrometry (MALDI-MS), optical density (OD600), standard microdilution procedures, transmission electron microscopy (TEM) and epifluorescence microscopy. The laser mediated the surface activation of GO offer high efficiency for antifungal and antibacterial. Wide broad cells with various instruments approved that graphene oxide is promising material for nanomedicine in the near future.

  7. The Laser-driven Flyer System for Space Debris Hypervelocity Impact Simulations

    NASA Astrophysics Data System (ADS)

    Gong, Zizheng; Dai, Fu; Yang, Jiyun; Hou, Mingqiang; Zheng, Jiandong; Tong, Jingyu; Pang, Hewei

    2009-06-01

    The Laser-driven flyer (LDF) technique is showing promiseful in simulating micro meteoroids and orbital debris (M/OD) hypervelocity impacting effects. LDF system with a single pulses from a Q-switched Nd: glass laser, of 15 ns duration and up to 20J energy, launched the aluminum films of 5 μm thickness up to 8.3km/s velocity was developed in Beijing Institute of Spacecrafts Environment Engineering(BISEE), CAST. The quantitative relationships between the flyer velocity and the laser energy, the width of laser pulse, the diameter of laser focal spot, and the flyer thickness were analyzed, according to Lawrence-Gurney model, and compared with the experimental results. Some experimental aspects in our efforts on the space debris Hypervelocity impacts on the outer surfaces functional material, such as the thermal control material, window glass, and OSR etc., are reviewed. Though still developing, the Laser-driven flyer technique has been demonstrated promise in simulating micro M/OD hypervelocity impacting effects.

  8. Structural damage detection and estimation using a scanning laser vibrometer

    NASA Astrophysics Data System (ADS)

    Pai, Perngjin F.; Lee, Seung-Yoon; Schulz, Mark J.

    2001-07-01

    This paper presents a model-independent boundary effect evaluation (BEE) method for pinpointing crack locations and estimating crack sizes using only operational deflection shapes (ODSs) measured by a scanning laser vibrometer. An ODS consists of central and boundary solutions. Central solutions are periodic functions, and boundary solutions are exponentially decaying functions due to boundary constraints. The BEE method uses a sliding-window curve-fitting technique to extract boundary solutions from an experimental ODS. Because cracks introduce localized small boundaries to a structure, boundary solutions exist around cracks as well as structural boundaries. Since crack-induced boundary solutions show characteristics different from those of actual boundaries, cracks can be easily located. A local strain energy method is derived for estimating crack sizes. In the method, the crack-induced strain energy extracted from an ODS is compared with the one calculated using fracture mechanics to estimate the crack size. To verify the capability and accuracy of this BEE method, experiments are performed on six 22' X 1' X 0.25' 2024-T4 aluminum beams each having a through-the-width Mode I crack at its midpoint. These cracks are slots having a width of 0.039' and depths of 0.0625' (25% of the beam thickness), 0.05' (20%), 0.0375' (15%), 0.025' (10%), 0.0125' (5%), and 0.005' (2%), respectively. Results show that this BEE method is capable of locating and estimating small cracks.

  9. Laser microphone

    DOEpatents

    Veligdan, James T.

    2000-11-14

    A microphone for detecting sound pressure waves includes a laser resonator having a laser gain material aligned coaxially between a pair of first and second mirrors for producing a laser beam. A reference cell is disposed between the laser material and one of the mirrors for transmitting a reference portion of the laser beam between the mirrors. A sensing cell is disposed between the laser material and one of the mirrors, and is laterally displaced from the reference cell for transmitting a signal portion of the laser beam, with the sensing cell being open for receiving the sound waves. A photodetector is disposed in optical communication with the first mirror for receiving the laser beam, and produces an acoustic signal therefrom for the sound waves.

  10. A Miniaturized, 1.9F Integrated Optical Fiber and Stone Basket for Use in Thulium Fiber Laser Lithotripsy.

    PubMed

    Wilson, Christopher R; Hutchens, Thomas C; Hardy, Luke A; Irby, Pierce B; Fried, Nathaniel M

    2015-10-01

    The thulium fiber laser (TFL) is being explored as an alternative laser lithotripter to the standard holmium:yttrium-aluminum-garnet laser. The more uniform beam profile of the TFL enables higher power transmission through smaller fibers. In this study, a 100-μm core, 140-μm outer-diameter (OD) silica fiber with 5-mm length hollow steel tip was integrated with 1.3F (0.433-mm OD) nitinol wire basket to form a 1.9F (0.633-mm OD) device. TFL energy of 30 mJ, 500 μs pulse duration, and 500 Hz pulse rate was delivered to human uric acid stones, ex vivo. Stone ablation rates measured 1.5 ± 0.2 mg/s, comparable to 1.7 ± 0.3 mg/s using bare fiber tips separately with stone basket. With further development, this device may minimize stone retropulsion, allowing more efficient TFL lithotripsy at higher pulse rates. It may also provide increased flexibility, higher saline irrigation rates through the ureteroscope working channel, reduce fiber degradation compared with separate fiber and basket manipulation, and reduce laser-induced nitinol wire damage.

  11. INTERACTION OF LASER RADIATION WITH MATTER. LASER PLASMA: Propagation of an optical discharge through optical fibres upon interference of modes

    NASA Astrophysics Data System (ADS)

    Bufetov, I. A.; Frolov, A. A.; Shubin, A. V.; Likhachev, M. E.; Lavrishchev, S. V.; Dianov, E. M.

    2008-05-01

    The propagation of an optical discharge (OD) through optical fibres upon interference of LP01 and LP02 modes is studied. Under these conditions after the OD propagation through the fibre, the formation of an axially-symmetric group sequence of voids with a spatial period equal to that of mode interference (200—500 μm depending on the parameters of the fibre) is observed. The groups of voids are formed near the sections of the fibre with a minimal diameter of the intensity distribution of laser radiation. Large spaces between voids in the fibre have allowed us to measure accurately the difference Δn of refractive indices of the fibre core and cladding and distribution of dopants in different cross sections of the fibre after the OD propagation. A substantial increase in Δn (up to ten times) is observed. Approximately half this increase is caused by compression and densification of the fibre material after the propagation of the optical discharge.

  12. Laser sampling

    NASA Astrophysics Data System (ADS)

    Gorbatenko, A. A.; Revina, E. I.

    2015-10-01

    The review is devoted to the major advances in laser sampling. The advantages and drawbacks of the technique are considered. Specific features of combinations of laser sampling with various instrumental analytical methods, primarily inductively coupled plasma mass spectrometry, are discussed. Examples of practical implementation of hybrid methods involving laser sampling as well as corresponding analytical characteristics are presented. The bibliography includes 78 references.

  13. Laser ignition

    DOEpatents

    Early, James W.; Lester, Charles S.

    2004-01-13

    Sequenced pulses of light from an excitation laser with at least two resonator cavities with separate output couplers are directed through a light modulator and a first polarzing analyzer. A portion of the light not rejected by the first polarizing analyzer is transported through a first optical fiber into a first ignitor laser rod in an ignitor laser. Another portion of the light is rejected by the first polarizing analyzer and directed through a halfwave plate into a second polarization analyzer. A first portion of the output of the second polarization analyzer passes through the second polarization analyzer to a second, oscillator, laser rod in the ignitor laser. A second portion of the output of the second polarization analyzer is redirected by the second polarization analyzer to a second optical fiber which delays the beam before the beam is combined with output of the first ignitor laser rod. Output of the second laser rod in the ignitor laser is directed into the first ignitor laser rod which was energized by light passing through the first polarizing analyzer. Combined output of the first ignitor laser rod and output of the second optical fiber is focused into a combustible fuel where the first short duration, high peak power pulse from the ignitor laser ignites the fuel and the second long duration, low peak power pulse directly from the excitation laser sustains the combustion.

  14. X-Ray Laser Program Final Report for FY91

    DTIC Science & Technology

    1992-09-16

    Form 298 (ftv. 2-8S9 Preeci2 od by ANSI Std1 23- 11 290-102 CONTENTS EXECUTIVE PROGRAM SUMMARY ........................................... iv 1...radiative transfer model which can be employed in analysis of laser plasmas. Since the velocity of light is 0.3 Um / fsec , in many of the ultrashort pulse...diodes.13 A 12- frame , time-resolving, x-ray pinhole camera is used to monitor the implosion quality of the Na pinches. The K-shell emission between 9

  15. Ultrasonic study of solid-phase amorphization and polyamorphism in an H2O-D2O (1: 1) solid solution

    NASA Astrophysics Data System (ADS)

    Gromnitskaya, E. L.; Lyapin, A. G.; Stalgorova, O. V.; Danilov, I. V.; Brazhkin, V. V.

    2013-02-01

    The elastic moduli and volume of H2O-D2O (1: 1) isotopically mixed ice (solid solution) have been studied at the solid-phase amorphization of normal 1 h ice under compression at a temperature of 77 K and at the transition from high-density amorphous ice to low-density amorphous ice with subsequent successive crystallization to cubic (1 c) and hexagonal (1 h) ice at isobaric (0.05 GPa) heating. Comparison of the results with the respective data for H2O and D2O ices indicates that the observed concentration (in the isotopic composition) dependences of the elastic moduli and their derivatives for different phases of ice at isotopic hydrogen substitution in the H2O, H2O-D2O (1: 1), and D2O chain can be both monotonic and significantly nonmonotonic.

  16. Effect of microstructural anisotropy on fracture toughness of hot rolled 13Cr ODS steel - The role of primary and secondary cracking

    NASA Astrophysics Data System (ADS)

    Das, A.; Viehrig, H. W.; Bergner, F.; Heintze, C.; Altstadt, E.; Hoffmann, J.

    2017-08-01

    ODS steels have been known to exhibit anisotropic fracture behaviour and form secondary cracks. In this work, the factors responsible for the anisotropic fracture behaviour have been investigated using scanning electron microscopy and electron backscatter microscopy. Fracture toughness of hot rolled 13Cr ODS steel was determined using unloading compliance method for L-T and T-L orientations at various temperatures. L-T orientation had higher fracture toughness than T-L orientation and also contained more pronounced secondary cracking. Secondary cracks appeared at lower loads than primary cracks in both orientations. Primary crack propagation was found to be preferentially through fine grains in a bimodal microstructure. Grains were aligned and elongated the most towards rolling direction followed by T and S directions resulting in fracture anisotropy. Crystallographic texture and preferential alignment of Ti enriched particles parallel to rolling direction also contributed towards fracture anisotropy.

  17. Strong magnetic-dielectric-lattice coupling in transition metal hydroxyhalides and ferroelectric response in rhombohedral Co2(OD)3X (X=Cl, Br)

    NASA Astrophysics Data System (ADS)

    Zheng, X. G.; Fujihala, M.; Kitajima, S.; Maki, M.; Kato, K.; Takata, M.; Xu, C. N.

    2013-05-01

    Hydroxyl salts of the type M2(OH)3X, and M(OH)X, where M represents a transition metal ion and X represents a halogen ion, widely exist as minerals and were recently reported to be geometrically frustrated magnets. Here, we report the finding of ferroelectric response in them. First, we observed strong magnetic-lattice-dielectric couplings in all of them as witnessed during their magnetic transitions at low temperatures. Secondly, we identified apparent ferroelectric responses in the deuterated hydroxyl salts of high crystal symmetries, i.e., rhombohedral Co2(OD)3Cl and Co2(OD)3Br, at high temperatures of 220-230 K through an isotope effect. The present work shows that multiferroicity may be a potentially universal phenomenon in magnetic hydroxyl salts. Meanwhile, it provides the first link between magnetic geometric frustration and hydrogen-bonded soft-mode ferroelectrics.

  18. Observation of the Q(3/2) Λ-doublet transitions for X2Π3/2 OD in helium nanodroplets

    NASA Astrophysics Data System (ADS)

    Raston, Paul L.; Liang, Tao; Douberly, Gary E.

    2014-01-01

    The deuteroxyl radical (OD) has been isolated in superfluid helium nanodroplets and characterised by infrared depletion spectroscopy. Two resolved Q(3/2) lines are observed, with a separation that is 4.88 (10) times larger than in the gas phase. This is similar to that previously reported for He-solvated OH (5.30 (2)), for which it was shown that the splitting could be reproduced by a model that assumes a small parity dependence of the rotor's effective moment of inertia [P.L. Raston, T. Liang, and G.E. Douberly, J. Phys. Chem. A (2013). DOI:10.1021/jp312335q]. With this model, the OD Λ-doublet splitting in liquid He is reproduced with Be and Bf rotational constants that differ by ≈0.24%.

  19. Fabrication of divertor mock-up with ODS-Cu and W by the improved brazing technique

    NASA Astrophysics Data System (ADS)

    Tokitani, M.; Hamaji, Y.; Hiraoka, Y.; Masuzaki, S.; Tamura, H.; Noto, H.; Tanaka, T.; Muroga, T.; Sagara, A.; FFHR Design Group

    2017-07-01

    Copper alloy has been considered as a divertor cooling tube or heat sink not only in the helical reactor FFHR-d1 but also in the tokamak DEMO reactor, because it has a high thermal conductivity. This work focused on applying an oxide dispersion strengthened copper alloy (ODS-Cu), GlidCop® (Cu-0.3 wt%Al2O3) as the divertor heat sink material of FFHR-d1. This alloy has superior high temperature yield strength exceeding 300 MPa at room temperature even after annealing up to ~1000 °C. The change in material properties of Pure-Cu, GlidCop® and CuCrZr by neutron irradiation are summarized in this paper. A primary dose limit is the radiation-induced hardening/softening (~0.2 dpa/1-2 dpa) which has a temperature dependence. According to such an evaluation, the GlidCop® can be selected as the current best candidate material in the commercial base of the divertor heat sink, and its temperature should be maintained as close as possible to 300 °C during operation. Bonding between the W armour and the GlidCop® heat sink was successfully performed by using an improved brazing technique with BNi-6 (Ni-11%P) filler material. The bonding strength was measured by a three-point bending test and reached up to approximately 200 MPa. Surprisingly, several specimens showed an obvious yield point. This means that the BNi-6 brazing (bonding) layer caused relaxation of the applied stress. The small-scale divertor mock-up of the W/BNi-6/GlidCop® was successfully fabricated by using the improved brazing technique. The heat loading test was carried out by the electron beam device ACT2 in NIFS. The mock-up showed an excellent heat removal capability for use in the FFHR-d1 divertor.

  20. H/D exchange in reactions of OH(-) with D2 and of OD(-) with H2 at low temperatures.

    PubMed

    Mulin, Dmytro; Roučka, Štěpán; Jusko, Pavol; Zymak, Illia; Plašil, Radek; Gerlich, Dieter; Wester, Roland; Glosík, Juraj

    2015-04-14

    Using a cryogenic linear 22-pole rf ion trap, rate coefficients for H/D exchange reactions of OH(-) with D2 (1) and OD(-) with H2 (2) have been measured at temperatures between 11 K and 300 K with normal hydrogen. Below 60 K, we obtained k1 = 5.5 × 10(-10) cm(3) s(-1) for the exoergic . Upon increasing the temperature above 60 K, the data decrease with a power law, k1(T) ∼T(-2.7), reaching ≈1 × 10(-10) cm(3) s(-1) at 200 K. This observation is tentatively explained with a decrease of the lifetime of the intermediate complex as well as with the assumption that scrambling of the three hydrogen atoms is restricted by the topology of the potential energy surface. The rate coefficient for the endoergic increases with temperature from 12 K up to 300 K, following the Arrhenius equation, k2 = 7.5 × 10(-11) exp(-92 K/T) cm(3) s(-1) over two orders of magnitude. The fitted activation energy, EA-Exp = 7.9 meV, is in perfect accordance with the endothermicity of 24.0 meV, if one accounts for the thermal population of the rotational states of both reactants. The low mean activation energy in comparison with the enthalpy change in the reaction is mainly due to the rotational energy of 14.7 meV contributed by ortho-H2 (J = 1). Nonetheless, one should not ignore the reactivity of pure para-H2 because, according to our model, it already reaches 43% of that of ortho-H2 at 100 K.

  1. Genetics of reproductive isolation in the Drosophila simulans clade: DNA marker-assisted mapping and characterization of a hybrid-male sterility gene, Odysseus (Ods).

    PubMed

    Perez, D E; Wu, C I; Johnson, N A; Wu, M L

    1993-05-01

    In this study, we address the question of whether there exist major genes that cause complete male sterility in the interspecific hybrids of Drosophila and, if they do, how these genes may be characterized at the molecular level. Our approach is to introgress small segments of the X chromosome from Drosophila mauritiana (or Drosophila sechellia) into Drosophila simulans by repeated backcrosses for more than 20 generations. The introgressions are monitored by both visible mutations and a series of DNA markers. We compare the extent of introgressions that cause male sterility with those that do not. If a major sterility factor exists, there should be a sharp boundary between these two classes of introgressions and their breakpoints should demarcate such a gene. Furthermore, if male sterility is the only major fitness effect associated with the introgression, recombination analysis should yield a pattern predicted by the classical three-point cross. Both the genetic and molecular analyses suggest the presence of a major sterility factor from D. mauritiana, which we named Odysseus (Ods), in the cytological interval of 16D. We thus formalize three criteria for inferring the existence of a major gene within an introgression: (1) complete penetrance of sterility, (2) complementarity in recombination analysis, and (3) physical demarcation. Introgressions of Ods from D. sechellia do not cause sterility. Twenty-two introgressions in our collection have breakpoints in this interval of about 500 kb, making it possible to delineate Ods more precisely for molecular identification. The recombination analysis also reveals the complexity of the introgressed segments--even relatively short ones may contain a second male sterility factor and partial viability genes and may also interfere with crossovers. The spermatogenic defects associated with Ods and/or a second factor were characterized by phase-contrast microscopy.

  2. CW laser pumped emerald laser

    SciTech Connect

    Shand, M.L.; Lai, S.T.

    1984-02-01

    A CW laser-pumped emerald laser is reported. A 34 percent output power slope efficiency is observed with longitudinal pumping by a krypton laser in a nearly concentric cavity. The laser has been tuned from 728.8 to 809.0 nm. Losses in emerald are larger than those of alexandrite determined in a similar cavity. The present data also indicate that the excited state absorption minimum is shifted from that of alexandrite. 13 references.

  3. Cutaneous lasers.

    PubMed

    Fedok, Fred G; Garritano, Frank; Portela, Antonio

    2013-02-01

    There has been a remarkable development and evolution of laser technology, leading to adaptation of lasers for medical use and the treatment of skin problems and disorders. Many treatments that required incisional surgery and other invasive methods are now preferentially treated with a laser. Although laser advances have resulted in the availability of some amazing tools, they require the clinical skill and judgment of the clinician for their optimal use. This article provides a clinically oriented overview of many of the lasers valuable in facial plastic surgery. Basic science, clinical adaptations, and patient management topics are covered. Copyright © 2013 Elsevier Inc. All rights reserved.

  4. Retrospective Study of Pegaspargase, Gemicitabine, Oxaliplatin and Dexamethasone (Peg-GemOD) as a First-Line Therapy for Advanced-Stage Extranodal NK/T Cell Lymphoma.

    PubMed

    Yao, Yi-Yun; Tang, Yong; Zhuang, Yan; Zou, Li-Fang; Dou, Hong-Ju; Wang, Lei; Zhu, Qi

    2017-03-01

    This study was conducted to retrospectively investigate the efficacy and safety of pegaspargase, gemicitabine, oxaliplatin and dexamethasone (Peg-GemOD) combination chemotherapy as a first-line therapy for advanced-stage extranodal NK/T cell lymphoma (ENKTL). Eighteen patients with newly diagnosed stage III/IV ENKTL were subjected to 3-6 cycles of Peg-GemOD chemotherapy. After 3 cycles of therapy, the overall response rate was 67 % (12/18) with a complete response rate of 28 % (5/18) and a partial response rate of 39 % (7/18). The median overall survival (OS) and progression-free survival (PFS) time were 10 and 8.5 months respectively. For those responders, the median OS and PFS time were significantly better than those of non-responders (median OS, 15 vs. 10 months; P = 0.001 and median PFS, 15 vs. 7 months; P = 0.001). Furthermore, patients with low plasma EBV-DNA levels after induction chemotherapy had a remarkably longer OS and PFS time. The toxicity of Peg-GemOD regimen was acceptable.

  5. Quantum-spin-liquid states in the two-dimensional kagome antiferromagnets ZnxCu4-x(OD)6Cl2.

    PubMed

    Lee, S-H; Kikuchi, H; Qiu, Y; Lake, B; Huang, Q; Habicht, K; Kiefer, K

    2007-11-01

    A three-dimensional system of interacting spins typically develops static long-range order when it is cooled. If the spins are quantum (S=1/2), however, novel quantum paramagnetic states may appear. The most highly sought state among them is the resonating-valence-bond state, in which every pair of neighbouring quantum spins forms an entangled spin singlet (valence bonds) and these singlets are quantum mechanically resonating among themselves. Here we provide an experimental indication for such quantum paramagnetic states existing in frustrated antiferromagnets, Zn(x)Cu(4-x)(OD)(6)Cl(2), where the S=1/2 magnetic Cu2+ moments form layers of a two-dimensional kagome lattice. We find that in Cu(4)(OD)(6)Cl(2), where distorted kagome planes are weakly coupled, a dispersionless excitation mode appears in the magnetic excitation spectrum below approximately 20 K, whose characteristics resemble those of quantum spin singlets in a solid state, known as a valence-bond solid, that breaks translational symmetry. Doping with non-magnetic Zn2+ ions reduces the distortion of the kagome lattice, and weakens the interplane coupling but also dilutes the magnetic occupancy of the kagome lattice. The valence-bond-solid state is suppressed, and for ZnCu(3)(OD)(6)Cl(2), where the kagome planes are undistorted and 90% occupied by the Cu2+ ions, the low-energy spin fluctuations become featureless.

  6. Effect of crack length-to-width ratio on crack resistance of high Cr-ODS steels at high temperature for fuel cladding application

    NASA Astrophysics Data System (ADS)

    Chaouadi, R.; Ramesh, M.; Gavrilov, S.

    2013-11-01

    Oxide dispersion strengthened (ODS) steels with high Cr-content are extensively investigated in Europe, Japan and United States by the nuclear materials community for application to both advanced fission reactors and fusion systems. In comparison to standard high Cr-steels, the expected operation temperature range can be extended to 650 °C or more because of their improved creep resistance. However, their crack resistance behavior in the high temperature range was less investigated.The aim of the present paper is to provide some insight on their fracture behavior at high temperature and different crack configurations, in particular shallow crack. Crack resistance measurements were performed on a 12%Cr-ODS steel using compact tension specimens at 650 °C considering both shallow and deep crack configurations. Finite element calculations were performed on a typical fuel cladding tube geometry to assess the performances in terms of crack resistance. It is found that the temperature gradient across the wall should be maintained low enough to avoid cracking. After irradiation in corrosive environment, the boundary conditions might be further affected limiting therefore the lifetime of ODS cladding.

  7. Particles control in selective laser melting in-situ oxide dispersion strengthened method

    NASA Astrophysics Data System (ADS)

    Zhou, Xin; An, Zhibin; Shen, Zhijian; Liu, Wei; Yao, Chenguang

    2017-01-01

    Stainless steel selective laser melting (SLM) can be considered as a new possible approach for in-situ formation of oxide dispersion strengthened (ODS) steels because of the dispersion of amorphous oxide nano-particles due to the trace amounts of laser chamber oxygen and in-situ internal oxidation of reactive elements. In this paper it is demonstrated that the particle sizes and distributions can be adjusted by choosing different chamber oxygen level through controlling the quantity of initial reactive cores and the available reactive solutes of each core.

  8. Laser device

    DOEpatents

    Scott, Jill R.; Tremblay, Paul L.

    2004-11-23

    A laser device includes a target position, an optical component separated a distance J from the target position, and a laser energy source separated a distance H from the optical component, distance H being greater than distance J. A laser source manipulation mechanism exhibits a mechanical resolution of positioning the laser source. The mechanical resolution is less than a spatial resolution of laser energy at the target position as directed through the optical component. A vertical and a lateral index that intersect at an origin can be defined for the optical component. The manipulation mechanism can auto align laser aim through the origin during laser source motion. The laser source manipulation mechanism can include a mechanical index. The mechanical index can include a pivot point for laser source lateral motion and a reference point for laser source vertical motion. The target position can be located within an adverse environment including at least one of a high magnetic field, a vacuum system, a high pressure system, and a hazardous zone. The laser source and an electro-mechanical part of the manipulation mechanism can be located outside the adverse environment. The manipulation mechanism can include a Peaucellier linkage.

  9. Laser device

    DOEpatents

    Scott, Jill R.; Tremblay, Paul L.

    2007-07-10

    A laser device includes a target position, an optical component separated a distance J from the target position, and a laser energy source separated a distance H from the optical component, distance H being greater than distance J. A laser source manipulation mechanism exhibits a mechanical resolution of positioning the laser source. The mechanical resolution is less than a spatial resolution of laser energy at the target position as directed through the optical component. A vertical and a lateral index that intersect at an origin can be defined for the optical component. The manipulation mechanism can auto align laser aim through the origin during laser source motion. The laser source manipulation mechanism can include a mechanical index. The mechanical index can include a pivot point for laser source lateral motion and a reference point for laser source vertical motion. The target position can be located within an adverse environment including at least one of a high magnetic field, a vacuum system, a high pressure system, and a hazardous zone. The laser source and an electro-mechanical part of the manipulation mechanism can be located outside the adverse environment. The manipulation mechanism can include a Peaucellier linkage.

  10. Laser ignition

    DOEpatents

    Early, James W.; Lester, Charles S.

    2003-01-01

    In the apparatus of the invention, a first excitation laser or other excitation light source is used in tandem with an ignitor laser to provide a compact, durable, engine deployable fuel ignition laser system. Reliable fuel ignition is provided over a wide range of fuel conditions by using a single remote excitation light source for one or more small lasers located proximate to one or more fuel combustion zones. In a third embodiment, alternating short and long pulses of light from the excitation light source are directed into the ignitor laser. Each of the embodiments of the invention can be multiplexed so as to provide laser light energy sequentially to more than one ignitor laser.

  11. The relaxation of OH (v=1) and OD (v=1) by H2O and D2O at temperatures from 251 to 390 K.

    PubMed

    McCabe, D C; Rajakumar, B; Marshall, P; Smith, I W M; Ravishankara, A R

    2006-10-21

    We report rate coefficients for the relaxation of OH(v=1) and OD(v=1) by H2O and D2O as a function of temperature between 251 and 390 K. All four rate coefficients exhibit a negative dependence on temperature. In Arrhenius form, the rate coefficients for relaxation (in units of 10(-12) cm3 molecule-1 s-1) can be expressed as: for OH(v=1)+H2O between 263 and 390 K: k=(2.4+/-0.9) exp((460+/-115)/T); for OH(v=1)+D2O between 256 and 371 K: k=(0.49+/-0.16) exp((610+/-90)/T); for OD(v=1)+H2O between 251 and 371 K: k=(0.92+/-0.16) exp((485+/-48)/T); for OD(v=1)+D2O between 253 and 366 K: k=(2.57+/-0.09) exp((342+/-10)/T). Rate coefficients at (297+/-1 K) are also reported for the relaxation of OH(v=2) by D2O and the relaxation of OD(v=2) by H2O and D2O. The results are discussed in terms of a mechanism involving the formation of hydrogen-bonded complexes in which intramolecular vibrational energy redistribution can occur at rates competitive with re-dissociation to the initial collision partners in their original vibrational states. New ab initio calculations on the H2O-HO system have been performed which, inter alia, yield vibrational frequencies for all four complexes: H2O-HO, D2O-HO, H2O-DO and D2O-DO. These data are then employed, adapting a formalism due to Troe (J. Troe, J. Chem. Phys., 1977, 66, 4758), in order to estimate the rates of intramolecular energy transfer from the OH (OD) vibration to other modes in the complexes in order to explain the measured relaxation rates-assuming that relaxation proceeds via the hydrogen-bonded complexes.

  12. Past research and fabrication conducted at SCK•CEN on ferritic ODS alloys used as cladding for FBR's fuel pins

    NASA Astrophysics Data System (ADS)

    De Bremaecker, Anne

    2012-09-01

    -destructive tests (ultrasonic and eddy currents) were also developed. In-pile creep in argon and in liquid sodium was deeply studied on pressurized segments irradiated up to 75 dpaNRT. Finally two fuel assemblies cladded with such ODS alloys were irradiated in Phenix to the max dose of 90 dpa. Creep deformation and swelling were limited but the irradiation-induced embrittlement became acute. The programme was stopped shortly after the Chernobyl disaster, before the embrittlement problem was solved.

  13. Laser Systems

    NASA Technical Reports Server (NTRS)

    1985-01-01

    Tunable diode lasers are employed as radiation sources in high resolution infrared spectroscopy to determine spectral characteristics of gaseous compounds. With other laser systems, they are produced by Spectra-Physics, and used to monitor chemical processes, monitor production of quantity halogen lamps, etc. The Laser Analytics Division of Spectra-Physics credits the system's reliability to a program funded by Langley in the 1970s. Company no longer U.S.-owned. 5/22/97

  14. Laser apparatus

    DOEpatents

    Lewis, Owen; Stogran, Edmund M.

    1980-01-01

    Laser apparatus is described wherein an active laser element, such as the disc of a face-pumped laser, is mounted in a housing such that the weight of the element is supported by glass spheres which fill a chamber defined in the housing between the walls of the housing and the edges of the laser element. The uniform support provided by the spheres enable the chamber and the pump side of the laser element to be sealed without affecting the alignment or other optical properties of the laser element. Cooling fluid may be circulated through the sealed region by way of the interstices between the spheres. The spheres, and if desired also the cooling fluid may contain material which absorbs radiation at the wavelength of parasitic emissions from the laser element. These parasitic emissions enter the spheres through the interface along the edge surface of the laser element and it is desirable that the index of refraction of the spheres and cooling fluid be near the index of refraction of the laser element. Thus support, cooling, and parasitic suppression functions are all accomplished through the use of the arrangement.

  15. Laser ignition

    DOEpatents

    Early, James W.; Lester, Charles S.

    2002-01-01

    In the apparatus of the invention, a first excitation laser or other excitation light source capable of producing alternating beams of light having different wavelengths is used in tandem with one or more ignitor lasers to provide a compact, durable, engine deployable fuel ignition laser system. Reliable fuel ignition is provided over a wide range of fuel conditions by using the single remote excitation light source for pumping one or more small lasers located proximate to one or more fuel combustion zones with alternating wavelengths of light.

  16. Biocavity Lasers

    SciTech Connect

    Gourley, P.L.; Gourley, M.F.

    2000-10-05

    Laser technology has advanced dramatically and is an integral part of today's healthcare delivery system. Lasers are used in the laboratory analysis of human blood samples and serve as surgical tools that kill, burn or cut tissue. Recent semiconductor microtechnology has reduced the size o f a laser to the size of a biological cell or even a virus particle. By integrating these ultra small lasers with biological systems, it is possible to create micro-electrical mechanical systems that may revolutionize health care delivery.

  17. Laser safety in design of near-infrared scanning LIDARs

    NASA Astrophysics Data System (ADS)

    Zhu, X.; Elgin, D.

    2015-05-01

    3D LIDARs (Light Detection and Ranging) with 1.5μm nanosecond pulse lasers have been increasingly used in different applications. The main reason for their popularity is that these LIDARs have high performance while at the same time can be made eye-safe. Because the laser hazard effect on eyes or skin at this wavelength region (<1.4μm) is mainly from the thermal effect accumulated from many individual pulses over a period of seconds, scanning can effectively reduce the laser beam hazard effect from the LIDARs. Neptec LIDARs have been used in docking to the International Space Station, military helicopter landing and industrial mining applications. We have incorporated the laser safety requirements in the LIDAR design and conducted laser safety analysis for different operational scenarios. While 1.5μm is normally said to be the eye-safe wavelength, in reality a high performance 3D LIDAR needs high pulse energy, small beam size and high pulse repetition frequency (PRF) to achieve long range, high resolution and high density images. The resulting radiant exposure of its stationary beam could be many times higher than the limit for a Class 1 laser device. Without carefully choosing laser and scanning parameters, including field-of-view, scan speed and pattern, a scanning LIDAR can't be eye- or skin-safe based only on its wavelength. This paper discusses the laser safety considerations in the design of eye-safe scanning LIDARs, including laser pulse energy, PRF, beam size and scanning parameters in two basic designs of scanning mechanisms, i.e. galvanometer based scanner and Risley prism based scanner. The laser safety is discussed in terms of device classification, nominal ocular hazard distance (NOHD) and safety glasses optical density (OD).

  18. Laser Physics and Laser Techniques.

    DTIC Science & Technology

    1980-02-01

    is probably better than will ever be needed. Publications that have appeared, or are in the final stages of preparation, covering the FHT algorithm...and the understanding of the energy storage and laser trigger requirements make pursuit of a two photon laser a much more probable success now than...of energy migration for the amlec- 1) In the haigh comipressibility eginic produced by the laser tilar excited states, obtained by studying the decay

  19. Multimegajoule laser design. [Glass lasers

    SciTech Connect

    Manes, K.R.; Ozarski, R.G.; Hagen, W.F.; Holzrichtr, J.F.

    1985-08-01

    New technologies make multimegajoule glass lasers economically feasible. We have devised new laser architectures using harmonic switchout, target-plane holographic injection, phase conjugation, continuous apodization, and higher amplifier efficiencies. Our plan for building a multimegajoule laser for a recurring cost under $300 million relies on the following manufacturing economies of scale: high-volume glass production, rapid harmonic-crystal growth, capacitor sizing and packing to increase energy capacity, and part standardization.

  20. Heterodyne laser spectroscopy system

    DOEpatents

    Wyeth, Richard W.; Paisner, Jeffrey A.; Story, Thomas

    1989-01-01

    A heterodyne laser spectroscopy system utilizes laser heterodyne techniques for purposes of laser isotope separation spectroscopy, vapor diagnostics, processing of precise laser frequency offsets from a reference frequency and the like, and provides spectral analysis of a laser beam.

  1. Heterodyne laser spectroscopy system

    DOEpatents

    Wyeth, Richard W.; Paisner, Jeffrey A.; Story, Thomas

    1990-01-01

    A heterodyne laser spectroscopy system utilizes laser heterodyne techniques for purposes of laser isotope separation spectroscopy, vapor diagnostics, processing of precise laser frequency offsets from a reference frequency, and provides spectral analysis of a laser beam.

  2. Co Laser.

    DTIC Science & Technology

    1976-01-01

    newsletter setvice covering the moj-t recent research findings in 25 areas of industrial, technological , and sociological interest— invaluable information...service will be backdated to furnish you microfiche of reports issued earlier. Because of contractual arrangements with several Special Technology ...pressure electrical CO laser and, thereby, to develop the technology for high pres- sure, scalable, electric CO lasers exhibiting properties of

  3. Experimental studies of the dissociative recombination processes for the dimethyl ether ions CD3OCD2+ and (CD3)2OD+

    NASA Astrophysics Data System (ADS)

    Hamberg, M.; Österdahl, F.; Thomas, R. D.; Zhaunerchyk, V.; Vigren, E.; Kaminska, M.; Af Ugglas, M.; Källberg, A.; Simonsson, A.; Paál, A.; Larsson, M.; Geppert, W. D.

    2010-05-01

    Aims: Determination of branching fractions, cross sections and thermal rate coefficients for the dissociative recombination of CD3OCD2+ (0-0.3 eV) and (CD3)2OD+ (0-0.2 eV) at the low relative kinetic energies encountered in the interstellar medium. Methods: The measurements were carried out using merged electron and ion beams at the CRYRING storage ring, Stockholm, Sweden. Results: For (CD3)2OD+ we have experimentally determined the branching fraction for ejection of a single hydrogen atom in the DR process to be maximally 7% whereas 49% of the reactions involve the break up of the COC chain into two heavy fragments and 44% ruptures both C-O bonds. The DR of CD3OCD2+ is dominated by fragmentation of the COC chain into two heavy fragments. The measured thermal rate constants and cross sections are k(T) = 1.7±0.5 × 10-6(T/300)-0.77±0.01 cm3 s-1, σ = 1.2±0.4 × 10-15(Ecm[eV])-1.27±0.01 cm2 and k(T) = 1.7±0.6 × 10-6(T/300)-0.70 ± 0.02 cm3 s-1, σ = 1.7±0.6 × 10-15(Ecm[eV])-1.20±0.02 cm2 for CD3OCD2+ and (CD3)2OD+, respectively.

  4. Simultaneous spectral and temporal analyses of kinetic energies in nonequilibrium systems: theory and application to vibrational relaxation of O-D stretch mode of HOD in water.

    PubMed

    Jeon, Jonggu; Lim, Joon Hyung; Kim, Seongheun; Kim, Heejae; Cho, Minhaeng

    2015-05-28

    A time series of kinetic energies (KE) from classical molecular dynamics (MD) simulation contains fundamental information on system dynamics. It can also be analyzed in the frequency domain through Fourier transformation (FT) of velocity correlation functions, providing energy content of different spectral regions. By limiting the FT time span, we have previously shown that spectral resolution of KE evolution is possible in the nonequilibrium situations [Jeon and Cho, J. Chem. Phys. 2011, 135, 214504]. In this paper, we refine the method by employing the concept of instantaneous power spectra, extending it to reflect an instantaneous time-correlation of velocities with those in the future as well as with those in the past, and present a new method to obtain the instantaneous spectral density of KE (iKESD). This approach enables the simultaneous spectral and temporal resolution of KE with unlimited time precision. We discuss the formal and novel properties of the new iKESD approaches and how to optimize computational methods and determine parameters for practical applications. The method is specifically applied to the nonequilibrium MD simulation of vibrational relaxation of the OD stretch mode in a hydrated HOD molecule by employing a hybrid quantum mechanical/molecular mechanical (QM/MM) potential. We directly compare the computational results with the OD band population relaxation time profiles extracted from the IR pump-probe measurements for 5% HOD in water. The calculated iKESD yields the OD bond relaxation time scale ∼30% larger than the experimental value, and this decay is largely frequency-independent if the classical anharmonicity is accounted for. From the integrated iKESD over intra- and intermolecular bands, the major energy transfer pathways were found to involve the HOD bending mode in the subps range, then the internal modes of the solvent until 5 ps after excitation, and eventually the solvent intermolecular modes. Also, strong hydrogen

  5. Effects of in vivo exposure to UV filters (4-MBC, OMC, BP-3, 4-HB, OC, OD-PABA) on endocrine signaling genes in the insect Chironomus riparius.

    PubMed

    Ozáez, Irene; Martínez-Guitarte, José Luis; Morcillo, Gloria

    2013-07-01

    There is increasing evidence indicating that several UV filters might have endocrine disruptive effects. Numerous studies have evaluated hormonal effects in vertebrates, mainly reporting estrogenic and androgenic activities in mammals and fishes. There is only limited knowledge about potential endocrine activity in invertebrate hormonal systems. In this work, the effects on endocrine signaling genes of six frequently used UV filters were investigated in Chironomus riparius, a reference organism in aquatic toxicology. The UV filters studied were: octyl-p-methoxycinnamate (OMC) also called 2-ethylhexyl-4-methoxycinnamate (EHMC); 4-methylbenzylidene camphor (4-MBC); benzophenone-3 (BP-3); 4-hidroxybenzophenone (4-HB); octocrylene (OC); and octyldimethyl-p-aminobenzoate (OD-PABA). After in vivo exposure at different dosages, expression levels of the genes coding for the ecdysone receptor (EcR), the ultraspiracle (usp, ortholog of the RXR) and the estrogen-related receptor (ERR) were quantified by Real Time PCR. The EcR gene was significantly upregulated by 4-MBC, OMC/EHMC and OD-PABA, with a dose-related response following 24h exposure. In contrast, the benzophenones, BP-3 and 4-HB, as well as OC did not alter this gene at the same exposure conditions. The transcription profiles of the usp and ERR genes were not significantly affected, except for BP-3 that inhibited the usp gene at the highest concentration. To our knowledge, this is the first experimental evidence in invertebrates of a direct effect of UV filters on endocrine-related genes, and is consistent with the known effects on vertebrate hormonal receptor genes. The capability of 4-MBC, OMC/EHMC and OD-PABA to stimulate the expression of the ecdysone receptor, a key transcription factor for the ecdysone-genomic response in arthropods, suggests the possibility of a broad and long-term effect on this hormonal pathway. These findings strengthen the need for further research about the ecotoxicological implications

  6. Preparation of magnetic ODS-PAN thin-films for microextraction of quetiapine and clozapine in plasma and urine samples followed by HPLC-UV detection.

    PubMed

    Li, Dan; Zou, Juan; Cai, Pei-Shan; Xiong, Chao-Mei; Ruan, Jin-Lan

    2016-06-05

    In this study, conventional thin-film microextraction (TFME) was endowed with magnetic by introducing superparamagnetic SiO2@Fe3O4 nanoparticles in thin-films. Novel magnetic octadecylsilane (ODS)-polyacrylonitrile (PAN) thin-films were prepared by spraying, and used for the microextraction of quetiapine and clozapine in plasma and urine samples, followed by the detection of HPLC-UV. The influencing factors on the extraction efficiency of magnetic ODS-PAN TFME, including pH, extraction time, desorption solvent, desorption time, and ion strength were investigated systematically. Under the optimal conditions, both analytes showed good linearity over ranges of 0.070-9.000μgmL(-1) and 0.012-9.000μgmL(-1) in plasma and urine samples, respectively, with correlation coefficients (R(2)) above 0.9990. Limits of detection (LODs) for quetiapine in plasma and urine samples were 0.013 and 0.003μgmL(-1), respectively. LODs for clozapine in plasma and urine samples were 0.015 and 0.003μgmL(-1), respectively. The relative standard deviations (RSDs) for quetiapine and clozapine were less than 9.23%. After the validation, the protocol was successfully applied for the determination of quetiapine and clozapine in patients' plasma and urine samples with satisfactory recoveries between 99-110%. The proposed magnetic ODS-PAN TFME was very simple, fast and easy to handle. It showed high potential as a powerful pretreatment technology for routine therapeutic drug monitoring (TDM) in plasma and urine samples.

  7. In-situ Fracture Studies and Modeling of the Toughening Mechanism Present in Wrought LCAC, TZM, and ODS Molybdenum Flat Products

    SciTech Connect

    Cockerman, B. V. and Chan, K. S.

    2007-07-01

    In-situ testing, ultrasonic C-scans, and metallography were used to show that a crack-divider delamination form of thin-sheet toughening occurs in wrought Low Carbon Arc Cast (LCAC) unalloyed molybdenum, Oxide Dispersion Strengthened (ODS) molybdenum, and TZM molybdenum at temperatures {ge} the Ductile to Brittle Transition Temperature (DBTT). Cracking along boundaries relieves mechanical constraint to free ligaments that may plastically stretch to produce toughening. Anisotropy in fracture toughness with lower values in the short-transverse direction is shown to produce the crack divider delaminations at the crack tip in the LT and TL orientations. The delamination zone increases with increasing stress-intensity to sizes significantly larger than the plastic zone, which leads to large increases in fracture toughness by the thin sheet toughening mechanism. Fracture in ODS Mo-alloys proceeds mainly along grain boundaries to produce small ligaments that exhibit ductility for both LT and TL orientations resulting in a lower DBTT and higher toughness values at lower temperatures than observed in LCAC and TZM. A combination of grain boundary fracture and cleavage is prevalent in LCAC molybdenum and TZM. The predominance for microcracking along grain boundaries to leave fine, ductile ligaments in ODS molybdenum can be attributed to a fine-grained microstructure with {approx} 1-2 {micro}m thickness of sheet-like grains. The presence of mixed grain boundary fracture and cleavage in LCAC and TZM can be attributed to a microstructure with a larger thickness of sheet-like grains (4-15 {micro}m).

  8. The rotational spectrum and dynamical structure of LiOH and LiOD: A combined laboratory and ab initio study

    NASA Astrophysics Data System (ADS)

    Higgins, Kelly J.; Freund, Samuel M.; Klemperer, William; Apponi, Aldo J.; Ziurys, Lucy M.

    2004-12-01

    Millimeter wave rotational spectroscopy and ab initio calculations are used to explore the potential energy surface of LiOH and LiOD with particular emphasis on the bending states and bending potential. New measurements extend the observed rotational lines to J=7←6 for LiOH and J=8←7 for LiOD for all bending vibrational states up to (0330). Rotation-vibration energy levels, geometric expectation values, and dipole moments are calculated using extensive high-level ab initio three-dimensional potential energy and dipole moment surfaces. Agreement between calculation and experiment is superb, with predicted Bv values typically within 0.3%, D values within 0.2%, ql values within 0.7%, and dipole moments within 0.9% of experiment. Shifts in Bv values with vibration and isotopic substitution are also well predicted. A combined theoretical and experimental structural analysis establishes the linear equilibrium structure with re(Li-O)=1.5776(4) Å and re(O-H)=0.949(2) Å. Predicted fundamental vibrational frequencies are v1=923.2, v2=318.3, and v3=3829.8 cm-1 for LiOH and v1=912.9, v2=245.8, and v3=2824.2 cm-1 for LiOD. The molecule is extremely nonrigid with respect to angular deformation; the calculated deviation from linearity for the vibrationally averaged structure is 19.0° in the (000) state and 41.9° in the (0330) state. The calculation not only predicts, in agreement with previous work [P. R. Bunker, P. Jensen, A. Karpfen, and H. Lischka, J. Mol. Spectrosc. 135, 89 (1989)], a change from a linear to a bent minimum energy configuration at elongated Li-O distances, but also a similar change from linear to bent at elongated O-H distances.

  9. The rotational spectrum and dynamical structure of LiOH and LiOD: a combined laboratory and ab initio study.

    PubMed

    Higgins, Kelly J; Freund, Samuel M; Klemperer, William; Apponi, Aldo J; Ziurys, Lucy M

    2004-12-15

    Millimeter wave rotational spectroscopy and ab initio calculations are used to explore the potential energy surface of LiOH and LiOD with particular emphasis on the bending states and bending potential. New measurements extend the observed rotational lines to J=7<--6 for LiOH and J=8<--7 for LiOD for all bending vibrational states up to (03(3)0). Rotation-vibration energy levels, geometric expectation values, and dipole moments are calculated using extensive high-level ab initio three-dimensional potential energy and dipole moment surfaces. Agreement between calculation and experiment is superb, with predicted Bv values typically within 0.3%, D values within 0.2%, ql values within 0.7%, and dipole moments within 0.9% of experiment. Shifts in Bv values with vibration and isotopic substitution are also well predicted. A combined theoretical and experimental structural analysis establishes the linear equilibrium structure with re(Li-O)=1.5776(4) A and re(O-H)=0.949(2) A. Predicted fundamental vibrational frequencies are v1=923.2, v2=318.3, and v3=3829.8 cm(-1) for LiOH and v1=912.9, v2=245.8, and v3=2824.2 cm(-1) for LiOD. The molecule is extremely nonrigid with respect to angular deformation; the calculated deviation from linearity for the vibrationally averaged structure is 19.0 degrees in the (000) state and 41.9 degrees in the (03(3)0) state. The calculation not only predicts, in agreement with previous work [P. R. Bunker, P. Jensen, A. Karpfen, and H. Lischka, J. Mol. Spectrosc. 135, 89 (1989)], a change from a linear to a bent minimum energy configuration at elongated Li-O distances, but also a similar change from linear to bent at elongated O-H distances.

  10. Laser device

    DOEpatents

    Scott, Jill R.; Tremblay, Paul L.

    2008-08-19

    A laser device includes a virtual source configured to aim laser energy that originates from a true source. The virtual source has a vertical rotational axis during vertical motion of the virtual source and the vertical axis passes through an exit point from which the laser energy emanates independent of virtual source position. The emanating laser energy is collinear with an orientation line. The laser device includes a virtual source manipulation mechanism that positions the virtual source. The manipulation mechanism has a center of lateral pivot approximately coincident with a lateral index and a center of vertical pivot approximately coincident with a vertical index. The vertical index and lateral index intersect at an index origin. The virtual source and manipulation mechanism auto align the orientation line through the index origin during virtual source motion.

  11. Members of candidate divisions OP11, OD1 and SR1 are widespread along the water column of the meromictic Lake Pavin (France).

    PubMed

    Borrel, Guillaume; Lehours, Anne-Catherine; Bardot, Corinne; Bailly, Xavier; Fonty, Gérard

    2010-07-01

    The vertical distribution of OP11, OD1 and SR1 divisions in the oxycline and in the anoxic water column of Lake Pavin, a freshwater permanently stratified mountain lake in France, was determined by temporal temperature gel gradient electrophoresis and 16S rRNA clone libraries. Gradual changes in the community structure were noted in relation to environmental variables along the oxidized/reduced environment. In addition, a separate effort to identify members of these lineages in the oxic mixolimnion identified sequences affiliated to SR1 and OP11 divisions, indicating that they are more widespread than previously expected.

  12. Fatigue properties of MA 6000E, a gamma-prime strengthened ODS alloy. [Oxide Dispersion Strengthened Ni-base alloy for gas turbine blade applications

    NASA Technical Reports Server (NTRS)

    Kim, Y. G.; Merrick, H. F.

    1980-01-01

    MA 6000E is a corrosion resistant, gamma-prime strengthened ODS alloy under development for advanced turbine blade applications. The high temperature, 1093 C, rupture strength is superior to conventional nickel-base alloys. This paper addresses the fatigue behavior of the alloy. Excellent properties are exhibited in low and high cycle fatigue and also thermal fatigue. This is attributed to a unique combination of microstructural features, i.e., a fine distribution of dispersed oxides and other nonmetallics, and the highly elongated grain structure which advantageously modify the deformation characteristics and crack initiation and propagation modes from that characteristic of conventional gamma-prime hardened superalloys.

  13. ENERGIC OD Geopan application using Virtual Hub: multi-temporal knowledge oriented information on built environment and riverbed changes to geologist community

    NASA Astrophysics Data System (ADS)

    Boldrini, E.; Brumana, R.; Previtali, M., Jr.; Mazzetti, P., Sr.; Cuca, B., Sr.; Barazzetti, L., Sr.; Camagni, R.; Santoro, M.

    2016-12-01

    The Built Environment (BE) is intended as the sum of natural and human activities in dynamic transformations in the past, in the present and in the future: it calls for more informed decisions to face the challenging threats (climate change, natural hazards, anthropic pressures) by exploiting resilience, sustainable intervention and tackling societal opportunities, as heritage valorization and tourism acknowledgment; thus, it asks for awareness rising among circular reflective society. In the framework of ENERGIC OD project (EU Network for Redistributing Geographic Information - Open Data), this paper describes the implementation of an application (GeoPAN Atl@s app) addressed to improve a circular multi-temporal knowledge oriented generation of information, able to integrate and take in account historic and current maps, as well as products of satellite image processing to understand on course and on coming phenomena and relating them with the ones occurred in the ancient and recent past in a diachronic approach. The app is focused on riverbeds-BE and knowledge generation for the detection of their changes by involving geologist community and providing to other user the retrieved information (architects and urban planner, tourists and citizen). Here is described the implementation of the app interfaced with the ENERGIC OD Virtual Hub component, based on a brokering framework for OD discovery and access, to assure interoperability and integration of different datasets, wide spread cartographic products with huge granularity (national, regional environmental Risk Maps, i.e. PAI, on site local data, i.e. UAV data, or results of Copernicus Programme satellite data processing, i.e. object-based and time series image analysis for riverbed monitoring using Sentinel2): different sources, scales and formats, including historical maps needing metadata generation, and SHP data used by the geologist in their daily activities for hydrogeological analysis, to be both usable as

  14. [The search for "od." Karl Ludwig Freiheer von Reichenbach (1788-1869) and Karl Wilhelm Mayrhofer (1806-1853), two joined against Justus von Liebig].

    PubMed

    Habacher, M

    1980-05-01

    The author describes the controversy between Justus von Liebig on one side and Reichenbach and Mayrhofer on the other side. It is a controversy about problems of science and medicine which are characteristic for the late 18th and the first half of the 19th century, when Mesmerism and similar ideas of occultic and comparative phenomenona were discussed and often refused as being "not scientific". Justus von Liebig and Karl Ludwig Freiherr von Reichenbach were both chemists, both interested in scientific progress and working in this field. They were friends in the years 1830 to 1848. But later on this friendship ended when Reichenbach--who in the mean time moved to Vienna--became more and more interested in phenomenons seen by sensitive persons concerning effects of light. Although Reichenbach himself was not able to recognize the phenomenons he was sure that other persons had this ability. He had the impression that there is a special force floating through the universe, and this force he called "od". Liebig, who was not able to follow this theory and rejected it has speculation, turned against Reichenbach in 1852-3. So the controversy began and their old friendship came to an end. Reichenbach's theory of the "od", characteristic for the time of the romanticism and leading back to Mesmerism was accepted and supported by the Austrian physician Dr. Karl Wilhelm Mayrhofer who had aroused his interest by describing similar phenomenos some of this patients had. The letters of both men, the chemist and the doctor, which are well preserved (Technical Museum of Vienna) and discussed here, give a good impression of Reichenbach's ideas concerning his theory of the "od" and his philosophical ideas. As Reichenbach tried to find a philosophy corresponding to his theory and as he meant to have found this in the philosophy of Friedrich Eduard Beneke his remarks in those letters give a good information about Beneke's discussion of Reichenbach's theory. Mayrhofer, on the other hand

  15. High throughput laser processing

    SciTech Connect

    Harley, Gabriel; Pass, Thomas; Cousins, Peter John; Viatella, John

    2016-12-27

    A solar cell is formed using a solar cell ablation system. The ablation system includes a single laser source and several laser scanners. The laser scanners include a master laser scanner, with the rest of the laser scanners being slaved to the master laser scanner. A laser beam from the laser source is split into several laser beams, with the laser beams being scanned onto corresponding wafers using the laser scanners in accordance with one or more patterns. The laser beams may be scanned on the wafers using the same or different power levels of the laser source.

  16. [Clinical application of pulsed laser-induced liquid jet: preliminary report in glioma surgery].

    PubMed

    Nakagawa, Atsuhiro; Kumabe, Toshihiro; Kanamori, Masayuki; Saito, Ryuta; Hirano, Takayuki; Takayama, Kazuyoshi; Tominaga, Teiji

    2008-11-01

    Both maximum resection of tumor and preservation of fine vessels are conflicting aims, but important factors to improve outcome in glioma surgery. Water jet dissection has been reported to dissect tissue while ensuring preservation of fine vessels. However, it was difficult to apply conventional water jet device in microsurgery due to the use of high pressure and continuous water a flow. To overcome these issues, we have developed pulsed holmium: yttrium-aluminum-garnet (YAG) laser-induced liquid jet (LILJ) for microsugical use and applied it in glioma surgery. LILJ was generated by irradiating pulsed Ho: YAG laser (3 Hz, pulse laser energy 233-300 mJ/pulse) within a stainless tube (outer diameter (OD): 1.26 mm inner diameter (ID): 0.90 mm) filled with cold (4 degrees C) lactated Ringer's solution. The laser beam was conducted through optical quartz fiber (core diameter: 400 microm). The jet generated was ejected from a stainless nozzle (OD: 1.06 mm, ID: 0.70 mm). To avoid splash and air bubbles within the surgical field, the nozzle was placed inside a stainless suction tube (OD: 3.06 mm, ID: 2.64 mm). LILJ was ejected randomly toward blood vessels and tissue simultaneously after removal of arachnoid membrane by microsurgical technique, and the quality of the dissection and the visual field were evaluated in 4 patients with supratentorial glioma. Restoration of small arteries (diameter: 100 to 200 microns) was accomplished. There was no significant occurrence of splash or air bubbles under the microscopic view. Present results showed that the pulsed LILJ system may safely be used for microsurgical procedures, and may be useful for glioma resection where preservation of fine vessels is required.

  17. Laser goniometer

    DOEpatents

    Fairer, George M.; Boernge, James M.; Harris, David W.; Campbell, DeWayne A.; Tuttle, Gene E.; McKeown, Mark H.; Beason, Steven C.

    1993-01-01

    The laser goniometer is an apparatus which permits an operator to sight along a geologic feature and orient a collimated lamer beam to match the attitude of the feature directly. The horizontal orientation (strike) and the angle from horizontal (dip), are detected by rotary incremental encoders attached to the laser goniometer which provide a digital readout of the azimuth and tilt of the collimated laser beam. A microprocessor then translates the square wave signal encoder outputs into an ASCII signal for use by data recording equipment.

  18. Laser propulsion

    NASA Technical Reports Server (NTRS)

    Rom, F. E.; Putre, H. A.

    1972-01-01

    The use of an earth-based high-power laser beam to provide energy for earth-launched rocket vehicle is investigated. The laser beam energy is absorbed in an opaque propellant gas and is converted to high-specific-impulse thrust by expanding the heated propellant to space by means of a nozzle. This laser propulsion scheme can produce specific impulses of several thousand seconds. Payload to gross-weight fractions about an order of magnitude higher than those for conventional chemical earth-launched vehicles appear possible. There is a potential for a significant reduction in cost per payload mass in earth orbit.

  19. Explosive laser

    DOEpatents

    Robinson, C.P.; Jensen, R.J.; Davis, W.C.; Sullivan, J.A.

    1975-09-01

    This patent relates to a laser system wherein reaction products from the detonation of a condensed explosive expand to form a gaseous medium with low translational temperature but high vibration population. Thermal pumping of the upper laser level and de-excitation of the lower laser level occur during the expansion, resulting in a population inversion. The expansion may be free or through a nozzle as in a gas-dynamic configuration. In one preferred embodiment, the explosive is such that its reaction products are CO$sub 2$ and other species that are beneficial or at least benign to CO$sub 2$ lasing. (auth)

  20. Latent tracks of swift heavy ions in Сr23C6 and Y-Ti-O nanoparticles in ODS alloys

    NASA Astrophysics Data System (ADS)

    Skuratov, V. A.; Sohatsky, A. S.; O'Connell, J. H.; Kornieieva, K.; Nikitina, A. A.; Uglov, V. V.; Neethling, J. H.; Ageev, V. S.

    2016-05-01

    The radiation stability of dielectric nanoparticles embedded into a metallic matrix is of considerable practical value due to the growing interest in oxide dispersion strengthened (ODS) steels as promising nuclear reactor materials. In this report the results of a TEM study of structural changes in Cr23C6 and Y-Ti-O nanoparticles in several ODS alloys irradiated with 1.2 MeV/amu Xe and 3.4 MeV/amu Bi ions is presented. It was found that swift heavy ion irradiation leads to the formation of amorphous latent tracks in both materials. The upper limit of the threshold electronic stopping power for track formation in carbides is estimated to be around 35 keV/nm. Multiple ion track overlapping leads to complete amorphization of carbide and Y-Ti oxide nanoparticles. Microstructural analysis have revealed a strong influence of the ferritic matrix on track morphology in Y2Ti2O7 nanoparticles in pre-thinned TEM targets after postradiation annealing and irradiation at elevated temperatures.

  1. "Candidatus Sonnebornia yantaiensis", a member of candidate division OD1, as intracellular bacteria of the ciliated protist Paramecium bursaria (Ciliophora, Oligohymenophorea).

    PubMed

    Gong, Jun; Qing, Yao; Guo, Xiaohong; Warren, Alan

    2014-02-01

    An intracellular bacterium was discovered in an isolate of Paramecium bursaria from a freshwater pond in Yantai, China. The bacteria were abundant and exclusively found in the cytoplasm of the host which, along with the green alga Chlorella, formed a three-partner consortium that could survive in pure water for at least one week. Cloning, sequencing and phylogenetic analysis of the bacterial 16S rRNA gene showed that the bacterium belonged to the uncultured candidate division OD1, which usually forms part of the rare biosphere. Transmission electron microscopy and fluorescence in situ hybridization (FISH) with specific probes showed that the bacteria were usually located close to the perialgal membranes of endosymbiotic Chlorella cells, and occasionally irregularly distributed throughout the host cytoplasm. The name "Candidatus Sonnebornia yantaiensis" gen. nov., sp. nov. is proposed for the new bacterium. A strongly supported monophyletic subclade, OD1-p, which included the new species, was recognized and this study highlights that protists can be important hosts for rare bacterial taxa. Copyright © 2013 Elsevier GmbH. All rights reserved.

  2. The Structure of High Pressure Ca(OD) 2II from Powder Neutron Diffraction: Relationship to the ZrO 2and EuI 2Structures

    NASA Astrophysics Data System (ADS)

    Leinenweber, Kurt; Partin, Dan E.; Schuelke, Udo; O'Keeffe, Michael; Von Dreele, Robert B.

    1997-09-01

    The "unquenchable" high pressure form of Ca(OD) 2[Ca(OH) 2II] has been synthesized at 9 GPa and 400°C and recovered to ambient pressure at cryogenic temperatures. The structure was determined from powder neutron diffraction data using the Rietveld technique. The symmetry is monoclinic P2 1/ cwith a=5.3979(4) Å, b=6.0931(4) Å, c=5.9852(4) Å, β=103.581(6)°, Z=4 at 1 atm and 11 K. Rwp=2.8%, Rp=1.9%, reduced χ2=6.6. for 117 variables. The calcium and oxygen substructure is intermediate between that in α-PbO 2and that in fluorite; it was previously described as isostructural with baddeleyite (ZrO 2), but it is more accurately described as isostructural with EuI 2. This structure is distinguished by the presence of a 3 6anion net parallel to (100). Only one of the two kinds of D atoms in the structure shows appreciable hydrogen bonding to O, with a second neighbor D … O distance of 1.91 Å, and an O-D … O angle of 153.2°; the other D atom has 3 second-neighbor oxygens near 2.6 Å away.

  3. Numerical determination of non-Langmuirian adsorption isotherms of ibuprofen enantiomers on Chiralcel OD column using ultraviolet-circular dichroism dual detector.

    PubMed

    Li, Hui; Jiang, Xiaoxiao; Xu, Wei; Chen, Yongtao; Yu, Weifang; Xu, Jin

    2016-02-26

    Competitive adsorption isotherm of ibuprofen enantiomers on Chiralcel OD stationary phase at 298K was determined by the application of inverse method. Transport dispersive (TD) chromatography model was used to describe mass balances of the enatiomers. Axial dispersion and mass transfer coefficients were estimated from a series of linear pulse experiments. It was found that the overloaded elution profile of total concentration of racemic ibuprofen cannot be satisfactorily fitted by substituting bi-Langmuir model, the most widely used isotherm model for enantiomers, into TD model and tuning the isotherm parameters. UV-CD dual detector setup was then applied to obtain the individual overloaded elution profiles of both enantiomers. The more informative experimental data revealed non-Langmuirian adsorption behavior of ibuprofen enantiomers on chiralcel OD stationary phase. Two analytical binary isotherm models, both accounting for adsorbate-adsorbate interactions and having the feature of inflection points, were then evaluated. A comparison between quadratic model and Moreau model showed that the former gives better fitting results. The six parameters involved in quadratic model were determined stepwisely. Three of them were first obtained by fitting overloaded elution profiles of S-ibuprofen. The other three were then acquired by fitting overloaded elution profiles of both enantiomers recorded by UV-CD dual detector for racemic ibuprofen. A further attempt was also made at reducing the number of quadratic model parameters.

  4. HRTEM Study of Oxide Nanoparticles in 16Cr-4Al-2W-0.3Ti-0.3Y2O3 ODS Steel

    SciTech Connect

    Hsiung, L; Fluss, M; Wall, M; Kimura, A

    2009-11-18

    Crystal and interfacial structures of oxide nanoparticles in 16Cr-4Al-2W-0.3Ti-0.3Y{sub 2}O{sub 3} ODS ferritic steel have been examined using high-resolution transmission electron microscopy (HRTEM) techniques. Oxide nanoparticles with a complex-oxide core and an amorphous shell were frequently observed. The crystal structure of complex-oxide core is identified to be mainly monoclinic Y{sub 4}Al{sub 2}O{sub 9} (YAM) oxide compound. Orientation relationships between the oxide and matrix are found to be dependent on the particle size. Large particles (> 20 nm) tend to be incoherent and have a spherical shape, whereas small particles (< 10 nm) tend to be coherent or semi-coherent and have a faceted interface. The observations of partially amorphous nanoparticles lead us to propose three-stage mechanisms to rationalize the formation of oxide nanoparticles containing core/shell structures in as-fabricated ODS steels.

  5. Laser fusion

    SciTech Connect

    Smit, W.A.; Boskma, P.

    1980-12-01

    Unrestricted laser fusion offers nations an opportunity to circumvent arms control agreements and develop thermonuclear weapons. Early laser weapons research sought a clean radiation-free bomb to replace the fission bomb, but this was deceptive because a fission bomb was needed to trigger the fusion reaction and additional radioactivity was induced by generating fast neutrons. As laser-implosion experiments focused on weapons physics, simulating weapons effects, and applications for new weapons, the military interest shifted from developing a laser-ignited hydrogen bomb to more sophisticated weapons and civilian applications for power generation. Civilian and military research now overlap, making it possible for several countries to continue weapons activities and permitting proliferation of nuclear weapons. These countries are reluctant to include inertial confinement fusion research in the Non-Proliferation Treaty. 16 references. (DCK)

  6. Shooting Lasers

    NASA Image and Video Library

    2012-11-02

    This picture shows a lab demonstration of the measurement chamber inside the Tunable Laser Spectrometer, an instrument that is part of the Sample Analysis at Mars investigation on NASA Curiosity rover.

  7. [Laser myringotomy].

    PubMed

    Hassmann-Poznańska, Elzbieta; Skotnicka, Bozena

    2002-01-01

    The aim of the study was assessment of the qualities of laser-assisted myringotomy (LAM) as a treatment for acute and secretory otitis media. Laser-assisted myringotomy was performed on 65 children (113 ears) mean age 6.2 years diagnosed with secretory otitis media (80%), recurrent secretory otitis media (11%) and acute otitis media (9%). Myringotomy was performed under general anesthesia using the OtoLAM device (ESC/Sharplan, Israel). In 64 ears pressure equalisation tubes were inserted after fenestration of the tympanic membrane with laser. Adenoidectomy alone or with tonsillectomy was performed at the same time in 51 cases. Laser tympanostomies remained patent for 7-32 days. All tympanostomies healed with no noticeable scarring. LAM appears to be a safe, and easy to performed, alternative technique in the treatment of otitis media.

  8. Laser barometer

    SciTech Connect

    Abercrombie, K.R.; Shiels, D.; Rash, T.

    1998-04-01

    This paper describes an invention of a pressure measuring instrument which uses laser radiation to sense the pressure in an enclosed environment by means of measuring the change in refractive index of a gas - which is pressure dependent.

  9. Laser Cutting

    DTIC Science & Technology

    1988-06-01

    lasers that are optically modified to produce high beam quality at reduced power levels for precision drilling and trepanning. * Nd:YAG lasers with...a smooth, dross-free cut face while the marking consists of a series of precisely placed shallow pits where surface finish and dross are not usually...neodymium:yttrium-aluminum-garnet (Nd:YAG) pulsed cutting data because the technique is considered vital in meeting the detailed precision cutting

  10. Laser Technology

    NASA Technical Reports Server (NTRS)

    1989-01-01

    Amoco Laser Company, a subsidiary of Amoco Corporation, has developed microlasers for the commercial market based on a JPL concept for optical communications over interplanetary distances. Lasers emit narrow, intense beams of light or other radiation. The beams transmit communication signals, drill, cut or melt materials or remove diseased body tissue. The microlasers cover a broad portion of the spectrum, and performance is improved significantly. Current applications include medical instrumentation, color separation equipment, telecommunications, etc.

  11. Tri-wave laser therapy for spinal cord injury, neuropathic pain management, and restoration of motor function

    NASA Astrophysics Data System (ADS)

    Chariff, Mark D.; Olszak, Peter

    2015-03-01

    A laser therapy device using three combined wavelengths 532nm, 808nm, and 1064nm has been demonstrated in clinical studies. Primarily, therapeutic lasers have used wavelengths in the ranges of 632nm through 1064nm, where the optical density (OD) < 5, to achieve pain relief and tissue regeneration. Conventional wisdom would argue against using wavelengths in the region of 532nm, due to poor penetration (OD ~ 8); however, the author's observations are to the contrary. The 532nm light is efficiently absorbed by chromophores such as oxyhemoglobin, deoxyhemoglobin, and cytochrome c oxidase thereby providing energy to accelerate the healing process. The 808nm light is known to result in Nitric Oxide production thereby reducing inflammation and oxidative stress. All three laser wavelengths likely contribute to pain relief by inhibiting nerve conduction; however, the 1064nm has the deepest penetration. Through the use of this device on over 1000 patients with a variety of acute and chronic neuro-musculoskeletal disorders, the author observed that a majority of these individuals experienced rapid relief from their presenting conditions and most patients reported a tingling sensation upon irradiation. Patient testimonials and thermal images have been collected to document the results of the laser therapy. These studies demonstrate the ability of laser therapy to rapidly alleviate pain from both acute and chronic conditions.

  12. Laser Physics and Laser Spectroscopy.

    DTIC Science & Technology

    1983-06-01

    Mass Spectroscopy X -ray spectroscopy Single Crystal Fibers X -ray lithography Vacuum Ultraviolet Laser Sow-ce X -ray microscopy as. AISYRACT (Cenue an...UNCLASSIFIED SCUNITYV CLASSIFICATION OF THIS PAGUZ(lM DWO &aeA") 20. (continued) studied and compared the laser produced plasma X -ray source to other X -ray...sourc s such as synchrotron and rotating anodes. It is clear that the laser plasma X -ra source has an important role to play in soft X -ray

  13. Laser optomechanics

    NASA Astrophysics Data System (ADS)

    Yang, Weijian; Adair Gerke, Stephen; Wei Ng, Kar; Rao, Yi; Chase, Christopher; Chang-Hasnain, Connie J.

    2015-09-01

    Cavity optomechanics explores the interaction between optical field and mechanical motion. So far, this interaction has relied on the detuning between a passive optical resonator and an external pump laser. Here, we report a new scheme with mutual coupling between a mechanical oscillator supporting the mirror of a laser and the optical field generated by the laser itself. The optically active cavity greatly enhances the light-matter energy transfer. In this work, we use an electrically-pumped vertical-cavity surface-emitting laser (VCSEL) with an ultra-light-weight (130 pg) high-contrast-grating (HCG) mirror, whose reflectivity spectrum is designed to facilitate strong optomechanical coupling, to demonstrate optomechanically-induced regenerative oscillation of the laser optomechanical cavity. We observe >550 nm self-oscillation amplitude of the micromechanical oscillator, two to three orders of magnitude larger than typical, and correspondingly a 23 nm laser wavelength sweep. In addition to its immediate applications as a high-speed wavelength-swept source, this scheme also offers a new approach for integrated on-chip sensors.

  14. Laser optomechanics

    PubMed Central

    Yang, Weijian; Adair Gerke, Stephen; Wei Ng, Kar; Rao, Yi; Chase, Christopher; Chang-Hasnain, Connie J.

    2015-01-01

    Cavity optomechanics explores the interaction between optical field and mechanical motion. So far, this interaction has relied on the detuning between a passive optical resonator and an external pump laser. Here, we report a new scheme with mutual coupling between a mechanical oscillator supporting the mirror of a laser and the optical field generated by the laser itself. The optically active cavity greatly enhances the light-matter energy transfer. In this work, we use an electrically-pumped vertical-cavity surface-emitting laser (VCSEL) with an ultra-light-weight (130 pg) high-contrast-grating (HCG) mirror, whose reflectivity spectrum is designed to facilitate strong optomechanical coupling, to demonstrate optomechanically-induced regenerative oscillation of the laser optomechanical cavity. We observe >550 nm self-oscillation amplitude of the micromechanical oscillator, two to three orders of magnitude larger than typical, and correspondingly a 23 nm laser wavelength sweep. In addition to its immediate applications as a high-speed wavelength-swept source, this scheme also offers a new approach for integrated on-chip sensors. PMID:26333804

  15. Laser Angioplasty

    NASA Technical Reports Server (NTRS)

    1990-01-01

    The principal method of dealing with coronary artery blockage is bypass surgery. A non-surgical alternative available to some patients is balloon angioplasty. For several years, medical researchers have been exploring another alternative that would help a wider circle of patients than the balloon treatment and entail less risk than bypass surgery. A research group is on the verge of an exciting development: laser angioplasty with a 'cool' type of laser, called an excimer laser, that does not damage blood vessel walls and offers non-surgical cleansing of clogged arteries with extraordinary precision. The system is the Dymer 200+ Excimer Laser Angioplasty System, developed by Advanced Intraventional Systems. Used in human clinical tests since 1987, the system is the first fully integrated 'cool' laser capable of generating the requisite laser energy and delivering the energy to target arteries. Thirteen research hospitals in the U.S. have purchased Dymer 200+ systems and used them in clinical trials in 121 peripheral and 555 coronary artery cases. The success rate in opening blocked coronary arteries is 85 percent, with fewer complications than in balloon angioplasty. Food and Drug Administration approval for the system is hoped for in the latter part of 1990. * Advanced Intraventional Systems became Spectranetics in 1994 and discontinued the product.

  16. Laser Physics and Laser Spectroscopy.

    DTIC Science & Technology

    1986-03-01

    effect which limits the power throughout of a device; terbium qallium garnet (TGG), a Faraday isolator material; potassium niobate (KNbO 31 a nonlinear...extending the range of materials grown in fiber form. Two materials to be emphasized are terbium gallium garnet for optical isolators and potassium niobate...for doubling gallium arsenide diode lasers. References 1. R.H. Stolen, "Fiber Raman Lasers", Fiber and Integrated Optics, 3 (1980). 2. E. Ipoen and

  17. Development of Irradiation hardening of Unalloyed and ODS molybdenum during neurtron irradiation to low doses at 300C and 600C

    SciTech Connect

    B. V. Cockeran, R. W. Smith, L.L. Snead

    2007-11-21

    Unalloyed molybdenum and Oxide Dispersion Strengthened (ODS) molybdenum were irradiated at 300 C and 600 C in the high flux isotope reactor (HFIR) to neutron fluences of 0.2, 2.1, and 24.3 x 10{sup 24} n/m{sup 2} (E > 0.1 MeV), producing damage levels of 0.01, 0.1 and 1.3 Mo-dpa. Hardness measurements, electrical resistivity measurements, tensile testing, and Transmission Electron Microscopy (TEM) were used to assess the defect structure. Irradiation hardening was evident even at a damage level of 0.01 dpa resulting in a significant increase in yield stress, decrease in ductility, and elevation of the Ductile-to-Brittle Transition Temperature (DBTT). The observed size and number density of voids and loops as well as the measured irradiation hardening and electrical resistivity were found to increase sub-linearly with fluence over the range of exposure investigated. This supports the idea that the formation of the extended defects that produce irradiation hardening in molybdenum are the result of a nucleation and growth process rather than the formation of sessile defects directly from the displacement damage cascades. The formation of sessile defect clusters in the displacement cascade would be expected to result in a linear fluence dependence for the number density of defects followed by saturation at fluences less than 1-dpa. This conclusion is supported by Molecular Dynamics (MD) simulations of cascade damage which do not reveal large clusters forming directly as a result of the short-term collapse of the cascade. The finer grain size for the unalloyed Mo and ODS Mo compared to Low Carbon Arc Cast molybdenum results in slightly less irradiation hardening and slightly lower DBTT values. The unalloyed molybdenum used in this work had a low impurity interstitial content that correlates with a slightly lower void size and void number density, less irradiation hardening and lower change in electrical resistivity in this fluence range than is observed for ODS Mo

  18. Laser beam monitoring system

    DOEpatents

    Weil, Bradley S.; Wetherington, Jr., Grady R.

    1985-01-01

    Laser beam monitoring systems include laser-transparent plates set at an angle to the laser beam passing therethrough and light sensor for detecting light reflected from an object on which the laser beam impinges.

  19. Laser Physics and Laser-Tissue Interaction

    PubMed Central

    Welch, A. J.; Torres, Jorge H.; Cheong, Wai-Fung

    1989-01-01

    Within the last few years, lasers have gained increasing use in the management of cardiovascular disease, and laser angioplasty has become a widely performed procedure. For this reason, a basic knowledge of lasers and their applications is essential to vascular surgeons, cardiologists, and interventional radiologists. To elucidate some fundamental concepts regarding laser physics, we describe how laser light is generated and review the properties that make lasers useful in medicine. We also discuss beam profile and spotsize, as well as dosimetric specifications for laser angioplasty. After considering laser-tissue interaction and light propagation in tissue, we explain how the aforementioned concepts apply to direct laser angioplasty and laser-balloon angioplasty. An understanding of these issues should prove useful not only in performing laser angioplasty but in comparing the reported results of various laser applications. (Texas Heart Institute Journal 1989;16:141-9) PMID:15227198

  20. Laser construction

    SciTech Connect

    Martin, D.W.; Osterhage, R.J.; Summa, K.M.

    1989-02-14

    A laser device is described comprising an elongated laser medium of crystal material having a cylindrical shape modified to have a flat face formed on one side thereof, a highly heat conducting mounting member having a flat surface on a portion thereof, the medium being mounted on the mounting member with the flat face of the medium in face-to-face relation with the flat surface on the mounting member, a heat sink member having a surface for attaching the mounting member to, a pump source including an array of laser diodes each having opposite ends and positioned in side-by-side single file relation, a second highly heat conducting mounting member having a surface on which the array of laser diodes is positioned, the second mounting member being mounted on the heat sink member wherein the array of laser diodes are in substantial alignment with the axis of the medium along the side thereof opposite from the flat face of the medium.

  1. Laser acceleration

    NASA Astrophysics Data System (ADS)

    Tajima, T.; Nakajima, K.; Mourou, G.

    2017-02-01

    The fundamental idea of Laser Wakefield Acceleration (LWFA) is reviewed. An ultrafast intense laser pulse drives coherent wakefield with a relativistic amplitude robustly supported by the plasma. While the large amplitude of wakefields involves collective resonant oscillations of the eigenmode of the entire plasma electrons, the wake phase velocity ˜ c and ultrafastness of the laser pulse introduce the wake stability and rigidity. A large number of worldwide experiments show a rapid progress of this concept realization toward both the high-energy accelerator prospect and broad applications. The strong interest in this has been spurring and stimulating novel laser technologies, including the Chirped Pulse Amplification, the Thin Film Compression, the Coherent Amplification Network, and the Relativistic Mirror Compression. These in turn have created a conglomerate of novel science and technology with LWFA to form a new genre of high field science with many parameters of merit in this field increasing exponentially lately. This science has triggered a number of worldwide research centers and initiatives. Associated physics of ion acceleration, X-ray generation, and astrophysical processes of ultrahigh energy cosmic rays are reviewed. Applications such as X-ray free electron laser, cancer therapy, and radioisotope production etc. are considered. A new avenue of LWFA using nanomaterials is also emerging.

  2. Tunable solid state lasers

    SciTech Connect

    Hammerling, R.; Budgor, A.B.; Pinto, A.

    1985-01-01

    This book presents the papers given at a conference on solid state lasers. Topics considered at the conference included transition-metal-doped lasers, line-narrowed alexandrite lasers, NASA specification, meteorological lidars, laser materials spectroscopy, laser pumped single pass gain, vibronic laser materials growth, crystal growth methods, vibronic laser theory, cross-fertilization through interdisciplinary fields, and laser action of color centers in diamonds.

  3. Header For Laser Diode

    NASA Technical Reports Server (NTRS)

    Rall, Jonathan A. R.; Spadin, Paul L.

    1990-01-01

    Header designed to contain laser diode. Output combined incoherently with outputs of other laser diodes in grating laser-beam combiner in optical communication system. Provides electrical connections to laser diode, cooling to thermally stabilize laser operation, and optomechanical adjustments that steer and focus laser beam. Range of adjustments provides for correction of worst-case decentering and defocusing of laser beam encountered with laser diodes. Mechanical configuration made simple to promote stability and keep cost low.

  4. Capabilities to improve corrosion resistance of fuel claddings by using powerful laser and plasma sources

    NASA Astrophysics Data System (ADS)

    Borisov, V. M.; Trofimov, V. N.; Sapozhkov, A. Yu.; Kuzmenko, V. A.; Mikhaylov, V. B.; Cherkovets, V. Ye.; Yakushkin, A. A.; Yakushin, V. L.; Dzhumayev, P. S.

    2016-12-01

    The treatment conditions of fuel claddings of the E110 alloy by using powerful UV or IR laser radiation, which lead to the increase in the corrosion resistance at the high-temperature ( T = 1100°C) oxidation simulating a loss-of-coolant accident, are determined. The possibility of the complete suppression of corrosion under these conditions by using pulsed laser deposition of a Cr layer is demonstrated. The behavior of protective coatings of Al, Al2O3, and Cr planted on steel EP823 by pulsed laser deposition, which is planned to be used in the BREST-OD-300, is studied. The methods of the almost complete suppression of corrosion in liquid lead to the temperature of 720°C are shown.

  5. Capabilities to improve corrosion resistance of fuel claddings by using powerful laser and plasma sources

    SciTech Connect

    Borisov, V. M. Trofimov, V. N.; Sapozhkov, A. Yu.; Kuzmenko, V. A.; Mikhaylov, V. B.; Cherkovets, V. Ye.; Yakushkin, A. A.; Yakushin, V. L.; Dzhumayev, P. S.

    2016-12-15

    The treatment conditions of fuel claddings of the E110 alloy by using powerful UV or IR laser radiation, which lead to the increase in the corrosion resistance at the high-temperature (T = 1100°C) oxidation simulating a loss-of-coolant accident, are determined. The possibility of the complete suppression of corrosion under these conditions by using pulsed laser deposition of a Cr layer is demonstrated. The behavior of protective coatings of Al, Al{sub 2}O{sub 3}, and Cr planted on steel EP823 by pulsed laser deposition, which is planned to be used in the BREST-OD-300, is studied. The methods of the almost complete suppression of corrosion in liquid lead to the temperature of 720°C are shown.

  6. Fiber optic illumination of a poly(dimethylsiloxane) sheath flow cuvette for diode laser induced fluorescence detection in capillary electrophoresis.

    PubMed

    Skinner, Cameron D

    2015-02-01

    A Tee configuration sheath flow cuvette with square cross-section channels has been produced in PDMS for CE detection. The output of a 1.4 W laser diode operating at 450 nm was focused onto the 300 μm core of a 370 μm od fiber optic whose end was inserted into one arm of the Tee for LIF. The optimal configuration had the fiber optic positioned 500 μm downstream from the intersection and the end of the 35 cm 50 μm id 365 μm od capillary just outside the intersection and in the leg of the Tee, resulting in a 90° configuration. Detection limits of 50 and 3 pM and linear calibrations of at least three orders of magnitude were obtained for Lucifer Yellow and fluorescein, respectively. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. An integrated fiber and stone basket device for use in Thulium fiber laser lithotripsy

    NASA Astrophysics Data System (ADS)

    Wilson, Christopher R.; Hutchens, Thomas C.; Hardy, Luke A.; Irby, Pierce B.; Fried, Nathaniel M.

    2014-03-01

    The Thulium fiber laser (TFL) is being explored as an alternative laser lithotripter to the Holmium:YAG laser. The TFL's superior near-single mode beam profile enables higher power transmission through smaller fibers with reduced proximal fiber tip damage. Recent studies have also reported that attaching hollow steel tubing to the distal fiber tip decreases fiber degradation and burn-back without compromising stone ablation rates. However, significant stone retropulsion was observed, which increased with pulse rate. In this study, the hollow steel tip fiber design was integrated with a stone basket to minimize stone retropulsion during ablation. A device was constructed consisting of a 100-μm-core, 140-μm-OD silica fiber outfitted with 5-mm-long stainless steel tubing at the distal tip, and integrated with a 1.3-Fr (0.433-mm-OD) disposable nitinol wire basket, to form an overall 1.9-Fr (0.633-mm- OD) integrated device. This compact design may provide several potential advantages including increased flexibility, higher saline irrigation rates through the ureteroscope working channel, and reduced fiber tip degradation compared to separate fiber and stone basket manipulation. TFL pulse energy of 31.5 mJ with 500 μs pulse duration and pulse rate of 500 Hz was delivered through the integrated fiber/basket device in contact with human uric acid stones, ex vivo. TFL stone ablation rates measured 1.5 +/- 0.2 mg/s, comparable to 1.7 +/- 0.3 mg/s (P > 0.05) using standard bare fiber tips separately with a stone basket. With further development, this device may be useful for minimizing stone retropulsion, thus enabling more efficient TFL lithotripsy at higher pulse rates.

  8. An unusual case of OD-allotwinning: 9,9′-(2,5-dibromo-1,4-phenylene)bis[9H-carbazole

    PubMed Central

    Kautny, Paul; Schwartz, Thomas; Fröhlich, Johannes

    2017-01-01

    9,9′-(2,5-Dibromo-1,4-phenylene)bis[9H-carbazole] (1) crystallizes as a category I order–disorder (OD) structure composed of non-polar layers of one kind with B2/m(1)1 layer symmetry. The crystals are made up of the two polytypes with a maximum degree of order (MDO). The monoclinic MDO1 polytype (B21/d) possesses an orthorhombic B-centered lattice and appears in two orientations, which are related by reflection at (100). The orthorhombic MDO2 polytype (F2dd) has a doubled b-axis and appears in two orientations, which are related by inversion. The crystal structures of both polytypes were determined in a concurrent refinement. The MDO1:MDO2 ratio is 69:31.

  9. Quantum dynamics study of vibrational excitation effects and energy requirement on reactivity for the O + CD4/CHD3 → OD/OH + CD3 reactions.

    PubMed

    Yan, Wei; Meng, Fanbin; Wang, Dunyou

    2013-11-27

    A quantum reactive dynamics, six-degrees-of-freedom, time-dependent wave packet method is employed to study vibrational enhancement and energy requirement on reactivity of the O((3)P) + CD4/CHD3 → OD/OH + CD3 reactions. The calculations show, for O + CD4, that all the vibrational excitations of CD4 enhance reactivity, which agrees with quasi-classical trajectory results. However, this finding contradicts the experimental observation where the bending excitation suppresses reactivity. The present study also reveals that translational energy, in general, is more effective to enhance reactivity than vibrational energy; however, at higher collision energy, vibrational energy is slightly more effective than translational energy. For O + CHD3, the stretching and bending excitations of CHD3 enhance the reaction, whereas the umbrella motion hinders reactivity. The calculated excitation functions agree well with experiments.

  10. Laser cosmology

    NASA Astrophysics Data System (ADS)

    Chen, P.

    2014-05-01

    Recent years have witnessed tremendous progress in our understanding of the cosmos, which in turn points to even deeper questions to be further addressed. Concurrently the laser technology has undergone dramatic revolutions, providing exciting opportunity for science applications. History has shown that the symbiosis between direct observations and laboratory investigation is instrumental in the progress of astrophysics. We believe that this remains true in cosmology. Current frontier phenomena related to particle astrophysics and cosmology typically involve one or more of the following conditions: (1) extremely high energy events;(2) very high density, high temperature processes; (3) super strong field environments. Laboratory experiments using high intensity lasers can calibrate astrophysical observations, investigate underlying dynamics of astrophysical phenomena, and probe fundamental physics in extreme limits. In this article we give an overview of the exciting prospect of laser cosmology. In particular, we showcase its unique capability of investigating frontier cosmology issues such as cosmic accelerator and quantum gravity.

  11. Reaction of HOD+ with NO2: effects of OD and OH stretching, bending, and collision energy on reactions on the singlet and triplet potential surfaces.

    PubMed

    Boyle, Jason M; Bell, David M; Anderson, Scott L; Viggiano, A A

    2011-02-24

    Integral cross sections and product recoil velocity distributions were measured for the reaction of HOD(+) with NO(2), in which the HOD(+) reactant was prepared in its ground state and with mode-selective excitation in the 001 (OH stretch), 100 (OD stretch), and 010 (bend) modes. In addition, we measured the 300 K thermal kinetics in a selected ion flow tube reactor and report product branching ratios different from previous measurements. Reaction is found to occur on both the singlet and triplet surfaces with near-unit efficiency. At 300 K, the product branching indicates that triplet → singlet transitions occur in about 60% of triplet-coupled collisions, which we attribute to long interaction times mediated by complexes on the triplet surface. Because the collision times are much shorter in the beam experiments, the product distributions show no signs of such transitions. The dominant product on the singlet surface is charge transfer. Reactions on the triplet surface lead to NO(+), NO(2)H(+), and NO(2)D(+). There is also charge transfer, producing NO(2)(+) (a(3)B(2)); however, this triplet NO(2)(+) mostly predissociates. The NO(2)H(+)/NO(2)D(+) cross sections peak at low collision energies and are insignificant above ~1 eV due to OH/OD loss from the nascent product ions. The effects of HOD(+) vibration are mode-specific. Vibration inhibits charge transfer, with the largest effect from the bend. The NO(2)H(+)/NO(2)D(+) channels are also vibrationally inhibited, and the mode dependence reveals how energy in different reactant modes couples to the internal energy of the product ions.

  12. Vibrational Coupling Pathways in the CH Stretch Region of CH_3OH and CH_3OD as Revealed by IR and Ftmw-Ir Spectroscopies

    NASA Astrophysics Data System (ADS)

    Twagirayezu, Sylvestre; Wang, Xiaoliang; Perry, David S.; Neill, Justin L.; Muckle, Matt T.; Pate, Brooks H.; Xu, Li-Hong

    2011-06-01

    Infrared spectra of jet-cooled CH_3OD and CH_3OH in the CH stretch region are observed by coherence-converted population transfer Fourier transform microwave-infrared (CCPT-FTMW-IR) spectroscopy (E torsional species only) and by slit-jet single resonance spectroscopy (both A and E torsional species, CH_3OH only). Previously, we reported the analysis of ν_3 symmetric CH stretch region (2750-2900 Cm-1), and the present work extends the analysis to higher frequency (2900-3020 Cm-1). The overall observed spectra contain 17 interacting vibrational bands for CH_3OD and 28 for CH_3OH. The signs and magnitudes of the torsional tunneling splittings are deduced for three CH fundamentals (ν_3, ν_9, ν_2) of both molecules and are compared to a model calculation and to ab initio theory. The number and distribution of observed vibrational bands indicate that the CH stretch bright states couple first to doorway states that are binary combinations of bending modes. In the parts of the spectrum where doorway states are present, the observed density of coupled states is comparable to the total density of vibrational states in the molecule, but where there are no doorway states, only the CH stretch fundamentals are observed. A time-dependent interpretation of the present FTMW-IR spectra indicates a fast (˜ 200 fs) initial decay of the bright state followed by second, slower redistribution (˜ 1-3 ps). The qualitative agreement of the present data with the time-dependent experiments of Iwaki and Dlott provides further support for the similarity of the fastest vibrational relaxation processes in the liquid and gas phases. Twagirayezu, S.; Clasp, T. N.; Perry, D. S.; Neill, J. L.; Muckle, M. T.; Pate, B. H. J. Phys. Chem. A 2010, 114, 6818 Iwaki, L. K.; Dlott, D. D. J. Phys. Chem. A 2000, 104, 9101

  13. Excimer lasers

    NASA Technical Reports Server (NTRS)

    Palmer, A. J.; Hess, L. D.; Stephens, R. R.

    1976-01-01

    A theoretical and experimental investigation into the possibility of achieving CW discharge pumped excimer laser oscillation is reported. Detailed theoretical modeling of capillary discharge pumping of the XeF and KXe and K2 excimer systems was carried out which predicted the required discharge parameters for reaching laser threshold on these systems. Capillary discharge pumping of the XeF excimer system was investigated experimentally. The experiments revealed a lower excimer level population density than predicted theoretically by about an order of magnitude. The experiments also revealed a fluorine consumption problem in the discharge in agreement with theory.

  14. Laser barometer

    DOEpatents

    Abercrombie, Kevin R.; Shiels, David; Rash, Tim

    2001-02-06

    A pressure measuring instrument that utilizes the change of the refractive index of a gas as a function of pressure and the coherent nature of a laser light to determine the barometric pressure within an environment. As the gas pressure in a closed environment varies, the index of refraction of the gas changes. The amount of change is a function of the gas pressure. By illuminating the gas with a laser light source, causing the wavelength of the light to change, pressure can be quantified by measuring the shift in fringes (alternating light and dark bands produced when coherent light is mixed) in an interferometer.

  15. Graviton laser

    NASA Astrophysics Data System (ADS)

    Landry, A.; Paranjape, M. B.

    2016-08-01

    We consider the possibility of creating a graviton laser. The lasing medium would be a system of contained, ultra cold neutrons. Ultra cold neutrons are a quantum mechanical system that interacts with gravitational fields and with the phonons of the container walls. It is possible to create a population inversion by pumping the system using the phonons. We compute the rate of spontaneous emission of gravitons and the rate of the subsequent stimulated emission of gravitons. The gain obtainable is directly proportional to the density of the lasing medium and the fraction of the population inversion. The applications of a graviton laser would be interesting.

  16. Laser Resonator

    NASA Technical Reports Server (NTRS)

    Harper, L. L. (Inventor)

    1983-01-01

    An optical resonator cavity configuration has a unitary mirror with oppositely directed convex and concave reflective surfaces disposed into one fold and concertedly reversing both ends of a beam propagating from a laser rod disposed between two total internal reflection prisms. The optical components are rigidly positioned with perpendicularly crossed virtual rooflines by a compact optical bed. The rooflines of the internal reflection prisms, are arranged perpendicularly to the axis of the laser beam and to the optical axes of the optical resonator components.

  17. Laser barometer

    DOEpatents

    Abercrombie, Kevin R.; Shiels, David; Rash, Tim

    2001-02-06

    A pressure measuring instrument that utilizes the change of the refractive index of a gas as a function of pressure and the coherent nature of a laser light to determine the barometric pressure within an environment. As the gas pressure in a closed environment varies, the index of refraction of the gas changes. The amount of change is a function of the gas pressure. By illuminating the gas with a laser light source, causing the wavelength of the light to change, pressure can be quantified by measuring the shift in fringes (alternating light and dark bands produced when coherent light is mixed) in an interferometer.

  18. Performance analysis of continuous tracking laser Doppler vibrometry applied to rotating structures in coast-down

    NASA Astrophysics Data System (ADS)

    Martarelli, M.; Castellini, P.

    2012-06-01

    In this paper a performance analysis of the so-called tracking continuous scanning laser Doppler vibrometry (TCSLDV) exploited in coast-down has been performed. This non-contact measurement system is able to scan continuously over a rotating surface during coast-down and to determine vibration operational deflection shapes (ODSs) and natural frequencies in short time, i.e. the temporal extent of the coast-down. The method is based on a laser Doppler vibrometer (LDV) whose laser beam is driven to scan continuously over the whole rotor surface synchronously with its rotation, so that the LDV output is modulated by the structure's ODSs. This technique has a full-field nature that enables it to measure simultaneously the time and spatial dependence of the vibration in a unique measurement. However, the TCSLDV presents some criticalities in practical applications, especially when applied to rotary transient and fast processes. In fact, if the vibration is transient and decays very fast, then the laser beam could not have had the time to scan the complete structure surface and the modulation of the ODS could be partial. An analytical model reproducing a representative experiment has been developed in order to evaluate the sensitivity of results to testing conditions. The laser beam trajectory in both the fixed and rotating reference systems has been synthesized showing its dependence on experimental parameters as the rotation speed variation during coast-down. It has been demonstrated the decrease in speed induces the deformation of the laser trajectory influencing the LDV output time history, spectrum and consequently the recovered ODS.

  19. Characterisation of a complex thin walled structure fabricated by selective laser melting using a ferritic oxide dispersion strengthened steel

    SciTech Connect

    Boegelein, Thomas Louvis, Eleftherios; Dawson, Karl; Tatlock, Gordon J.; Jones, Andy R.

    2016-02-15

    Oxide dispersion strengthened (ODS) alloys exhibit superior mechanical and physical properties due to the presence of nanoscopic Y(Al, Ti) oxide precipitates, but their manufacturing process is complex. The present study is aimed at further investigation of the application of an alternative, Additive Manufacturing (AM) technique, Selective Laser Melting (SLM), to the production of consolidated ODS alloy components. Mechanically alloyed PM2000 (ODS-FeCrAl) powders have been consolidated and a fine dispersion of Y-containing precipitates were observed in an as built thin-walled component, but these particles were typically poly-crystalline and contained a variety of elements including O, Al, Ti, Cr and Fe. Application of post-build heat treatments resulted in the modification of particle structures and compositions; in the annealed condition most precipitates were transformed to single crystal yttrium aluminium oxides. During the annealing treatment, precipitate distributions homogenised and localised variations in number density were diminished. The resulting volume fractions of those precipitates were 25–40% lower than have been reported in conventionally processed PM2000, which was attributed to Y-rich slag-like surface features and inclusions formed during SLM. - Highlights: • A wall structure was grown from ODS steel powder using selective laser melting. • A fine dispersion of nano-precipitates was apparent in as-build material. • Precipitates were multi-phased containing several elements, e.g. O, Ti, Al, Fe, Cr, Y. • Post-build annealing changed those into typically single-crystalline Y–Al–O. • The anneal also reduced and stabilised the volume fraction of precipitates to ~ 0.006.

  20. Selective fluorescence functionalization of dye-doped polymerized structures fabricated by direct laser writing (DLW) lithography

    NASA Astrophysics Data System (ADS)

    de Miguel, Gustavo; Vicidomini, Giuseppe; Duocastella, Martí; Diaspro, Alberto

    2015-11-01

    The continuous development of the vast arsenal of fabrication techniques is a pivotal factor in the breakthrough of nanotechnology. Although the broad interest is generally focused on the reduction of the dimensions of the fabricated structures, localized functionalization of the nanomaterials emerges as a key factor closely linked to their potential applications. In particular, fabrication of spatially selective fluorescence nanostructures is highly demanded in nanophotonics, as for example in three-dimensional (3D) optical data storage (ODS), where massive storage capacity and fast writing-reading processes are promised. We have developed an innovative method to control the location and intensity of the fluorescence signal in dye-doped photopolymerized structures fabricated with Direct Laser Writing (DLW) lithography. Well-defined fluorescent pixels (area = 0.24 μm2) were written inside a polymer matrix with the help of a femtosecond pulsed laser (multiphoton absorption) via a thermally-induced di-aggregation of a fluorescent dye. Moreover, we have accomplished a fine control of the fluorescence intensity which can increase the storage capacity of ODS systems fabricated with this approach.The continuous development of the vast arsenal of fabrication techniques is a pivotal factor in the breakthrough of nanotechnology. Although the broad interest is generally focused on the reduction of the dimensions of the fabricated structures, localized functionalization of the nanomaterials emerges as a key factor closely linked to their potential applications. In particular, fabrication of spatially selective fluorescence nanostructures is highly demanded in nanophotonics, as for example in three-dimensional (3D) optical data storage (ODS), where massive storage capacity and fast writing-reading processes are promised. We have developed an innovative method to control the location and intensity of the fluorescence signal in dye-doped photopolymerized structures fabricated

  1. Dye laser principles, with applications

    SciTech Connect

    Duarte, F.J. . Dept. of Physics); Hillman, L.W. . Dept. of Physics)

    1990-01-01

    This book contains papers which explain dye laser principles. Topics covered include: laser dynamics, femtosecond dye lasers, CW dye lasers, technology of pulsed dye lases, photochemistry of laser dyes, and laser applications.

  2. Laser micromachining for fatigue and fracture mechanics applications

    NASA Astrophysics Data System (ADS)

    Gupta, M. C.; Li, B.; Gadag, S.; Chou, K. C.

    2010-04-01

    A laser micromachining (LMM) method to initiate flaws for fatigue and fracture mechanics applications is successfully demonstrated. Dynamic response of moving energy pulses during LMM of titanium alloy (Ti-3.5Al-2.5V) was numerically simulated by an integrated energy approach using temperature-dependent thermophysical properties and 3D heat transfer code. Stress and strain analyses were performed for a titanium tube of 9.53 mm outer diameter (OD) and 0.81 mm wall thickness (WT) with a 0.23 mm deep and 1.83-mm-long longitudinal laser micro-machined notch, using nonlinear finite element analysis (FEA). For comparison, an electric-discharge-machined (EDM) notched tube with the same notch profile as the laser-prepared tube was also investigated. The calculated hoop stress and strain amplitudes at the notch root of the EDM-prepared tube were approximately 64% and 63% of the stress and strain amplitudes in the laser-prepared tube, respectively, when two tubes were subjected to inner pressures for R ratio of 0.03 and Δ P=45, 50, and 55 MPa. Fatigue life due to crack initiation process can be minimized using LMM method. The described LMM method is, therefore, more appropriate than EDM for accomplishing flaw formation to study fatigue and fracture behavior of various materials.

  3. Iritis and pupillary distortion after periorbital cosmetic alexandrite laser.

    PubMed

    Lin, Chih-Chung; Tseng, Po-Chen; Chen, Chun-Chen; Woung, Lin-Chung; Liou, Shiow-Wen

    2011-05-01

    To describe a case of ocular complications associated with laser-assisted periorbital cosmetic treatment and to recommend consideration of the ocular damage caused by dermatological laser therapy, including pupillary distortion and anterior uveitis. Case report. A 29-year-old Caucasian woman underwent cosmetic alexandrite laser therapy in the left upper eyelid area without protective eye shields. She complained of an irregular oval pupil, photophobia, and blurred vision in her left eye. Initially, her best-corrected visual acuity (BCVA) was 30/25 (OD) and 30/25 (OS). Slit-lamp biomicroscopy revealed a distorted left pupil with 3+ cell activity in the anterior chamber, but normal intraocular pressure. She was treated with topical corticosteroids. However, marked anterior chamber activity, pigment dispersion over the iris surface, and deteriorating BCVA of 10/25 (OS) had developed at the two-week follow-up. The ocular inflammation subsided gradually and her BCVA returned to normal after intensive steroid treatment. At the six-month follow-up, an ocular examination showed poor pupillary motility and persistent pigment over the iris surface. The patient still suffered from glare in dim light and experienced problems with dark adaptation. Alexandrite laser treatment of the upper eyelid region may penetrate the eyelid, causing anterior uveitis and irreversible damage to the iris. We recommended appropriate eye protection during this therapeutic procedure.

  4. Laser Accelerator

    DTIC Science & Technology

    2014-09-01

    stretched pulse with a low enough peak power to safely pass through the main laser gain medium usually Nd:glass or Ti:sapphire (3). The amplified pulse ...2.1 Chirped Gaussian Pulse . . . . . . . . . . . . . . . . . . . . . . 11 Figure 2.2 Diagram Illustrating Chirped Pulse Amplification...High Magnetic Field Laboratory . . . . . . . . . . . . . . . . . . . . . . . . . . 19 Figure 2.7 Cutaway Diagram of a Pulsed Magnet System at the

  5. Laser altimeter

    NASA Technical Reports Server (NTRS)

    1972-01-01

    The development of a laser altimeter for use in the Apollo Lunar Orbital Experiments mission is discussed. The altimeter provides precise measurement of an Apollo vehicle above the lunar surface from an orbit of 40 to 80 nautical miles. The technical characteristics of the altimeter are described. Management of the altimeter development program is analyzed.

  6. [Vascular lasers].

    PubMed

    Michaud, T

    2009-10-01

    After reviewing the main technical features of the lasers and flashlamps currently available, the indications for these devices are detailed, mainly port wine stains, facial telangiectasia, hemangiomas, and lower-limb varicosities. Respecting the principles of treatment (briefly reviewed herein), contributes to preventing complications, which are consequently becoming rare.

  7. Excimer lasers

    NASA Technical Reports Server (NTRS)

    Palmer, A. J.; Hess, L. D.; Stephens, R. R.; Pepper, D. M.

    1977-01-01

    The results of a two-year investigation into the possibility of developing continuous wave excimer lasers are reported. The program included the evaluation and selection of candidate molecular systems and discharge pumping techniques. The K Ar/K2 excimer dimer molecules and the xenon fluoride excimer molecule were selected for study; each used a transverse and capillary discharges pumping technique. Experimental and theoretical studies of each of the two discharge techniques applied to each of the two molecular systems are reported. Discharge stability and fluorine consumption were found to be the principle impediments to extending the XeF excimer laser into the continuous wave regime. Potassium vapor handling problems were the principal difficulty in achieving laser action on the K Ar/K2 system. Of the four molecular systems and pumping techniques explored, the capillary discharge pumped K Ar/K2 system appears to be the most likely candidate for demonstrating continuous wave excimer laser action primarily because of its predicted lower pumping threshold and a demonstrated discharge stability advantage.

  8. Laser Balancing

    NASA Technical Reports Server (NTRS)

    1981-01-01

    Mechanical Technology, Incorporated developed a fully automatic laser machining process that allows more precise balancing removes metal faster, eliminates excess metal removal and other operator induced inaccuracies, and provides significant reduction in balancing time. Manufacturing costs are reduced as a result.

  9. Laser Balancing

    NASA Astrophysics Data System (ADS)

    1981-01-01

    Mechanical Technology, Incorporated developed a fully automatic laser machining process that allows more precise balancing removes metal faster, eliminates excess metal removal and other operator induced inaccuracies, and provides significant reduction in balancing time. Manufacturing costs are reduced as a result.

  10. Mitigation of Stress Corrosion Cracking Susceptibility of Machined 304L Stainless Steel Through Laser Peening

    NASA Astrophysics Data System (ADS)

    Sundar, R.; Ganesh, P.; Kumar, B. Sunil; Gupta, R. K.; Nagpure, D. C.; Kaul, R.; Ranganathan, K.; Bindra, K. S.; Kain, V.; Oak, S. M.; Singh, Bijendra

    2016-09-01

    The paper describes an experimental study aimed at suppressing stress corrosion cracking susceptibility of machined 304L stainless steel specimens through laser shock peening. The study also evaluates a new approach of oblique laser shock peening to suppress stress corrosion cracking susceptibility of internal surface of type 304L stainless steel tube. The results of the study, performed with an indigenously developed 2.5 J/7 ns Nd:YAG laser, demonstrated that laser shock peening effectively suppresses chloride stress corrosion cracking susceptibility of machined surface of type 304L stainless steel. In the investigated range of incident laser power density (3.2-6.4 GW/cm2), machined specimens peened with power density of 4.5 and 6.4 GW/cm2 displayed lower stress corrosion cracking susceptibility considerably than those treated with 3.2 and 3.6 GW/cm2 in boiling magnesium chloride test. Oblique laser shock peening, performed on machined internal surface of a type 304L stainless steel tube (OD = 111 mm; ID = 101 mm), was successful in introducing residual compressive surface stresses which brought about significant suppression of its stress corrosion cracking susceptibility. The technique of oblique laser shock peening, in spite of its inherent limitations on the length of peened region being limited by tube internal diameter and the need for access from both the sides, presents a simplified approach for peening internal surface of small tubular components.

  11. Nanowire Lasers

    NASA Astrophysics Data System (ADS)

    Couteau, C.; Larrue, A.; Wilhelm, C.; Soci, C.

    2015-05-01

    We review principles and trends in the use of semiconductor nanowires as gain media for stimulated emission and lasing. Semiconductor nanowires have recently been widely studied for use in integrated optoelectronic devices, such as light-emitting diodes (LEDs), solar cells, and transistors. Intensive research has also been conducted in the use of nanowires for subwavelength laser systems that take advantage of their quasione- dimensional (1D) nature, flexibility in material choice and combination, and intrinsic optoelectronic properties. First, we provide an overview on using quasi-1D nanowire systems to realize subwavelength lasers with efficient, directional, and low-threshold emission. We then describe the state of the art for nanowire lasers in terms of materials, geometry, andwavelength tunability.Next,we present the basics of lasing in semiconductor nanowires, define the key parameters for stimulated emission, and introduce the properties of nanowires. We then review advanced nanowire laser designs from the literature. Finally, we present interesting perspectives for low-threshold nanoscale light sources and optical interconnects. We intend to illustrate the potential of nanolasers inmany applications, such as nanophotonic devices that integrate electronics and photonics for next-generation optoelectronic devices. For instance, these building blocks for nanoscale photonics can be used for data storage and biomedical applications when coupled to on-chip characterization tools. These nanoscale monochromatic laser light sources promise breakthroughs in nanophotonics, as they can operate at room temperature, can potentially be electrically driven, and can yield a better understanding of intrinsic nanomaterial properties and surface-state effects in lowdimensional semiconductor systems.

  12. Laser diode pumped solid state laser

    SciTech Connect

    Baer, T.M.; Keirstead, M.S.

    1987-04-07

    This patent describes a high-efficiency, laser diode pumped array, frequency doubled, compact solid state laser, comprising: a rare earth doped birefringent solid laser rod selected from the group consisting of Nd:YLF, Nd:YALO having a front end and a back end, the rod producing a polarized output beam; a housing with means holding the laser rod in fixed position in the housing with its front end forward; a laser array having a predetermined wavelength pumping the laser rod, having a output frequency sufficiently matched to the laser rod to pump the laser rod, secured in the housing behind and in optical alignment with the rod; laser cavity means defining a laser cavity mounted in the housing with the laser rod positioned within the cavity, the laser cavity means further including within the cavity an output coupler means; a frequency doubler, positioned to receive a suitably polarized output beam from the laser rod and to halve its wavelength and double its frequency; a polarization means for polarizing the output beam of the laser rod and substantially maintaining a polarization which optimizes frequency doubling at the frequency doubler and means for matching a focused image of the laser diode with a lasing volume of the laser cavity.

  13. Critical slowing of quantum atomic deuterium/hydrogen with features of multiferroicity in the geometrically frustrated system C o2(OD) 3Cl /C o2(OH) 3Cl

    NASA Astrophysics Data System (ADS)

    Xu, Xing-Liang; Meng, Dong-Dong; Zheng, Xu-Guang; Yamauchi, Ichihiro; Watanabe, Isao; Guo, Qi-Xin

    2017-01-01

    An extensive study of hydroxyl salts C o2(OD) 3Cl /C o2(OH) 3Cl utilizing muon-spin-relaxation (μSR), nuclear magnetic resonance (NMR), and Raman spectroscopy, supplemented by dielectric constant and magnetic susceptibility measurements, has revealed a unique multiferroic system with deuterium-order-type ferroelectricity and geometrically frustrated magnetism. Through the temperature-dependent dynamics of the nuclear fields probed by μSR, the deuterium atoms in C o2(OD) 3Cl were found to be rapidly fluctuating in the paraelectric phase. Upon cooling, they showed a critical slowing down toward the ferroelectric transition at Tc=Tɛ= 230 K , below which eight new Raman-active phonon bands appeared as a result of symmetry breaking due to deuterium ordering. Meanwhile, the hydrogen atoms in C o2(OH) 3Cl became quasistatic at a reduced temperature near 210 K, wherein only one new Raman band appeared with a broad dielectric anomaly, suggesting incomplete ordering. Furthermore, the μSR, NMR, Raman spectroscopy, and the magnetic susceptibility all suggested an increase in magnetic couplings below ˜250 K in both C o2(OD) 3Cl and C o2(OH) 3Cl , demonstrating a multiferroic feature for C o2(OD) 3Cl . This work presents a new and unique multiferroic system with an exceptional high Tc. It also demonstrates that conventional μSR can be an effective tool for studying ferroelectrics.

  14. Effect of in vivo low-level laser therapy on bone marrow-derived mesenchymal stem cells in ovariectomy-induced osteoporosis of rats.

    PubMed

    Mostafavinia, Ataroalsadat; Dehdehi, Leila; Ghoreishi, Seyed Kamran; Hajihossainlou, Behnam; Bayat, Mohammad

    2017-08-18

    Postmenopausal osteoporosis (PMOP) is considered by decreased bone strength that escalates the threat of fractures. Positive effects of photobiomodulation (PBM) with pulse wave have been demonstrated in cell culture and animal models. The aim of this study was to assess the in vivo effects of PBM on viability and calcium ion release of ovariectomy induced osteoporosis (OVX) - bone marrow derived mesenchymal stem cells (BMMSCs). 18 female rats were distributed into the following groups: 1) control healthy, 2) LASER-healthy (890nm, 80Hz, 1.5J/cm(2), three days weekly, 60days), 3) control OVX, 4) LASER-OVX, 5) Alendronate (Alen.)-OVX [0.5mg/kg, 5days per week, 60days], and 6) Alen.+LASER-OVX. Ovariectomy was done on rats of groups 3, 4, 5 and 6. After that all rats were euthanized and their MSC harvested and cultured in complete osteogenic medium. In all groups, BMMSC viability, and calcium colorimetric assay were performed. We observed a significant increase in optical density (OD) of BMMSCs viability in LASER healthy group compared to control-OVX, Alen.-OVX, LASER-OVX, LASER+Alen.-OVX, groups. LASER+Alen.-OVX group displayed a significant escalation in OD of BMMSCs viability compared to LASER-OVX, Alen.-OVX, and control-OVX groups. There were a significant increase in calcium ion release of LASER-healthy group compared to control healthy, control-OVX, Alen.-OVX, LASER-OVX, and LASER+Alen.-OVX groups. LASER+Alen.-OVX group displayed a significant escalation in calcium ion release compared to LASER-OVX, Alen.-OVX, and control-OVX groups. Pulse wave (PW) PBM significantly stimulated viability and cell proliferation of healthy BMMSCs compared to those of control-OVX, OVX-alendronate, OVX-LASER, and LASER+alendronate-OVX. In addition stimulatory effect of LASER+alendronate on viability and cell proliferation of OVX-BMMSCs compared to those of control-OVX, alendronate-OVX, and LASER-OVX groups were found. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. New laser source technology.

    PubMed

    Christensen, C P

    1984-04-13

    Over the past 5 to 8 years several new laser sources have been developed as a result of R & D efforts stimulated by a growing number of laser applications. Four families of new devices-semiconductor diod laser arrays, free electron lasers, rare gas halide excimer sources, and several new tunable solid-state lasers-show particular promise.

  16. Infrared Lasers in Chemistry.

    ERIC Educational Resources Information Center

    John, Phillip

    1982-01-01

    Selected infrared laser chemistry topics are discussed including carbon dioxide lasers, infrared quanta and molecules, laser-induced chemistry, structural isomerization (laser purification, sensitized reactions, and dielectric breakdown), and fundamental principles of laser isotope separation, focusing on uranium isotope separation. (JN)

  17. Making a Laser Level

    ERIC Educational Resources Information Center

    Hawkins, Harry

    2004-01-01

    This article describes how to construct a laser level. This laser level can be made using a typical 4' (or shorter) bubble level and a small laser point. The laser unit is detachable, so the bubble level can also be used in the conventional way. However, the laser level works better than a simple bubble level. Making this inexpensive device is an…

  18. Infrared Lasers in Chemistry.

    ERIC Educational Resources Information Center

    John, Phillip

    1982-01-01

    Selected infrared laser chemistry topics are discussed including carbon dioxide lasers, infrared quanta and molecules, laser-induced chemistry, structural isomerization (laser purification, sensitized reactions, and dielectric breakdown), and fundamental principles of laser isotope separation, focusing on uranium isotope separation. (JN)

  19. Making a Laser Level

    ERIC Educational Resources Information Center

    Hawkins, Harry

    2004-01-01

    This article describes how to construct a laser level. This laser level can be made using a typical 4' (or shorter) bubble level and a small laser point. The laser unit is detachable, so the bubble level can also be used in the conventional way. However, the laser level works better than a simple bubble level. Making this inexpensive device is an…

  20. Laser Photochemistry.

    DTIC Science & Technology

    1981-07-01

    reaction due to decreased adsorption of the species on the catalytic surface. For example, i. . . 41 in the catalytic decomposition of formic acid ...over platinum (Ulmstead and Lin, 1978), the preexcitation of the gaseous formic acid molecules (by a 10 W/cm2 CW CO2 laser) resulted in a 50% increase...attention is given to selective and thermal excitation and the role of multiphonon couplings, heterogeneous catalysis , and chemical vapor deposition and

  1. Project LASER

    NASA Technical Reports Server (NTRS)

    1990-01-01

    NASA formally launched Project LASER (Learning About Science, Engineering and Research) in March 1990, a program designed to help teachers improve science and mathematics education and to provide 'hands on' experiences. It featured the first LASER Mobile Teacher Resource Center (MTRC), is designed to reach educators all over the nation. NASA hopes to operate several MTRCs with funds provided by private industry. The mobile unit is a 22-ton tractor-trailer stocked with NASA educational publications and outfitted with six work stations. Each work station, which can accommodate two teachers at a time, has a computer providing access to NASA Spacelink. Each also has video recorders and photocopy/photographic equipment for the teacher's use. MTRC is only one of the five major elements within LASER. The others are: a Space Technology Course, to promote integration of space science studies with traditional courses; the Volunteer Databank, in which NASA employees are encouraged to volunteer as tutors, instructors, etc; Mobile Discovery Laboratories that will carry simple laboratory equipment and computers to provide hands-on activities for students and demonstrations of classroom activities for teachers; and the Public Library Science Program which will present library based science and math programs.

  2. Increase in tartrate-resistant acid phosphatase of bone at the early stage of ascorbic acid deficiency in the ascorbate-requiring Osteogenic Disorder Shionogi (ODS) rat.

    PubMed

    Goto, A; Tsukamoto, I

    2003-08-01

    The effect of ascorbic acid deficiency on bone metabolism was evaluated using the ascorbate-requiring Osteogenic Disorder Shionogi (ODS) rat model. Ascorbic acid (Asc)-deficient rats gained body weight in a manner similar to Asc-supplemented rats (control) during 3 weeks, but began to lose weight during the 4th week of Asc deficiency. The tartrate-resistant acid phosphatase (TRAP) activity in serum increased to about 2-fold the control value in the rats fed the Asc-free diet for 2, 3, and 4 weeks (AscD2, AscD3, and AscD4), while a decrease in the alkaline phosphatase (ALP) activity was observed only in AscD4 rats. The serum pyridinoline cross-linked carboxyterminal telopeptide of type I collagen (ICTP) level significantly increased to 1.3-, 1.4-, and 1.9-fold of that in the controls in AscD2, D3, and D4, respectively. The ALP activity in the distal femur was unchanged in AscD1, D2, and D3, but decreased to 50% of the control level in AscD4 rats. The TRAP activity in the distal femur increased to about 2-fold of that in the controls in the AscD2 and D3 and decreased to the control level in the AscD4 rats. The amount of hydroxyproline in the distal femur significantly decreased to about 80%, 70%, and 60% of the control in AscD2, D3, and D4 rats, respectively. These decreases were associated with a similar reduction in the calcium content of the distal femur. Histochemical analysis of the distal femur showed an increase in TRAP-positive cells in AscD2 and AscD3 rats and a decrease in the trabecular bone in AscD2, D3, and D4 rats. These results suggested that a deficiency of Asc stimulated bone resorption at an early stage, followed by a decrease in bone formation in mature ODS rats which already had a well-developed collagen matrix and fully differentiated osteoblasts.

  3. Load partitioning between ferrite/martensite and dispersed nanoparticles of a 9Cr ferritic/martensitic (F/M) ODS steel at high temperatures

    SciTech Connect

    Zhang, Guangming; Mo, Kun; Miao, Yinbin; Liu, Xiang; Almer, Jonathan; Zhou, Zhangjian; Stubbins, James F.

    2015-06-18

    In this study, a high-energy synchrotron radiation X-ray technique was used to investigate the tensile deformation processes of a 9Cr-ODS ferritic/martensitic (F/M) steel at different temperatures. Two minor phases within the 9Cr-ODS F/M steel matrix were identified as Y2Ti2O7 and TiN by the high-energy X-ray diffraction, and confirmed by the analysis using energy dispersive X-ray spectroscopy (EDS) of scanning transmission electron microscope (STEM). The lattice strains of the matrix and particles were measured through the entire tensile deformation process. During the tensile tests, the lattice strains of the ferrite/martensite and the particles (TiN and Y2Ti2O7) showed a strong temperature dependence, decreasing with increasing temperature. Analysis of the internal stress at three temperatures showed that the load partitioning between the ferrite/martensite and the particles (TiN and Y2Ti2O7) was initiated during sample yielding and reached to a peak during sample necking. At three studied temperatures, the internal stress of minor phases (Y2Ti2O7 and TiN) was about 2 times that of F/M matrix at yielding position, while the internal stress of Y2Ti2O7 and TiN reached about 4.5-6 times and 3-3.5 times that of the F/M matrix at necking position, respectively. It indicates that the strengthening of the matrix is due to minor phases (Y2Ti2O7 and TiN), especially Y2Ti2O7 particles. Although the internal stresses of all phases decreased with increasing temperature from RT to 600 degrees C, the ratio of internal stresses of each phase at necking position stayed in a stable range (internal stresses of Y2Ti2O7 and TiN were about 4.5-6 times and 3-3.5 times of that of F/M matrix, respectively). The difference between internal stress of the F/M matrix and the applied stress at 600 degrees C is slightly lower than those at RI and 300 degrees C, indicating that the nanoparticles still have good strengthening effect at 600 degrees C. (C) 2015 Elsevier B.V. All rights reserved.

  4. Laser nitriding and laser carburizing of surfaces

    NASA Astrophysics Data System (ADS)

    Schaaf, Peter

    2003-11-01

    Laser irradiation of surfaces with short pulses in reactive atmospheres (nitrogen, methane) can lead to very effective nitrification and carburization via complicated laser-surface-gas-plasma-interactions. This laser nitriding and laser carburizing and their basic underlying phenomena will be presented and partly explained by results of example materials (iron, titanium, aluminum, silicon) where nitride and carbide coatings can be formed by fast and easily by Excimer Laser, Nd:YAG laser, Free Electron Laser and also by femtosecond Ti:sapphire laser. This implies laser pulse durations from the nanosecond to the femtosecond regime and wavelengths from ultra-violet to infrared. The resulting surfaces, thin films, coatings and their properties are investigated by combining Mossbauer Spectroscopy, x-ray diffraction, x-ray absorption spectroscopy, Nanoindentation, Resonant Nuclear Reaction Analysis, and Rutherford Backscattering Spectroscopy.

  5. Electrically tunable laser based on heliconical cholesteric (Conference Presentation)

    NASA Astrophysics Data System (ADS)

    Xiang, Jie; Varanytsia, Andrii; Minkowski, Fred; Paterson, Daniel A.; Imrie, Corrie T.; Lavrentovich, Oleg D.; Palffy-Muhoray, Peter

    2016-09-01

    STUDENT CONTRIBUTION: Cholesteric liquid crystals (CLC) self-assemble into a periodic supramolecular helical structure with properties of a one-dimensional photonic crystal. The CLCs doped with a fluorescent dye and optical pump enable a distributed feedback cavity and lasing [1]. Although lasing was observed in range of wavelength from near UV to near IR, a practical method of tuning of emission wavelength from a dye-doped CLC without structural destruction of a helix is not demonstrated yet. In this work, we demonstrate an electrically tunable dye-doped CLC laser based on the so-called oblique helicoidal, or heliconical, CLC state [2,3]. In this state, the molecules twist around the helicoidal axis, making an angle smaller than 90 degrees with the axis. Molecular tilt makes the heliconical structure different from the regular CLC (in which the molecules are perpendicular to the axis) and enable electric tunability [2,3]. An electric field applied parallel to the heliconical axis changes the pitch but does not realign the axis. When the field increases, the pitch decreases. As a result, the selective reflection band and a lasing wavelength move towards shorter wavelength. Using heliconical CLC and two laser dyes DCM and LD688, we demonstrate effective tuning of the laser emission wavelength from 574 nm to 722 nm. With appropriate laser dyes, the spectrum can be extended from near UV to near IR. Efficient electric tuning in the broad spectral range and small size of the heliconical cholesteric lasers makes them potentially useful for optical and biomedical applications. [1] P. Palffy-Muhoay, W.Y. Cao, M. Moreira, B. Taheri, A. Munoz, Photonics and lasing in liquid crystal [2] J. Xiang, S.V. Shiyanovskii, C.T. Imrie, O.D. Lavrentovich, Electrooptic Response of Chiral Nematic Liquid Crystals with Oblique Helicoidal Director, Phys Rev Lett, 112 (2014) 217801. [3] J. Xiang, Y.N. Li, Q. Li, D.A. Paterson, J.M.D. Storey, C.T. Imrie, O.D. Lavrentovich, Electrically

  6. Immediate loading of mandibular overdentures supported by one-piece, direct metal laser sintering mini-implants: a short-term prospective clinical study.

    PubMed

    Mangano, Francesco G; Caprioglio, Alberto; Levrini, Luca; Farronato, Davide; Zecca, Piero A; Mangano, Carlo

    2015-02-01

    Only a few studies have dealt with immediately loaded, unsplinted mini-implants supporting ball attachment-retained mandibular overdentures (ODs). The aim of this study is to evaluate treatment outcomes of ball attachment-retained mandibular ODs supported by one-piece, unsplinted, immediately loaded, direct metal laser sintering (DMLS) mini-implants. Over a 4-year period (2009 to 2012), all patients referred to the Dental Clinic, University of Varese, and to a private practice for treatment with mandibular ODs were considered for inclusion in this study. Each patient received three or four DMLS mini-implants. Immediately after implant placement, a mandibular OD was connected to the implants. At each annual follow-up session, clinical and radiographic parameters were assessed, including the following outcome measures: 1) implant failures; 2) peri-implant marginal bone loss; and 3) complications. Statistical analysis was conducted using a life-table analysis. A total of 231 one-piece DMLS mini-implants were inserted in 62 patients. After 4 years of loading, six implants failed, giving an overall cumulative survival rate of 96.9%. The mean distance between the implant shoulder and the first visible bone-to-implant contact was 0.38 ± 0.25 and 0.62 ± 0.20 mm at the 1- and 4-year follow-up examinations, respectively. An incidence of 6.0% of biologic complications was reported; prosthetic complications were more frequent (12.9%). Within the limits of this study, it can be concluded that the immediate loading of one-piece, unsplinted, DMLS titanium mini-implants by means of ball attachment-supported mandibular ODs is a successful treatment procedure. Long-term follow-up studies are needed to confirm these results.

  7. Probing autoionizing states of molecular oxygen with XUV transient absorption: Electronic-symmetry-dependent line shapes and laser-induced modifications

    NASA Astrophysics Data System (ADS)

    Liao, Chen-Ting; Li, Xuan; Haxton, Daniel J.; Rescigno, Thomas N.; Lucchese, Robert R.; McCurdy, C. William; Sandhu, Arvinder

    2017-04-01

    We used extreme ultraviolet (XUV) transient absorption spectroscopy to study the autoionizing Rydberg states of oxygen in an electronically- and vibrationally-resolved fashion. XUV pulse initiates molecular polarization and near-infrared pulse perturbs its evolution. Transient absorption spectra show positive optical-density (OD) change in the case of n s σg and n d πg autoionizing states of oxygen and negative OD change for n d σg states. Multiconfiguration time-dependent Hartree-Fock (MCTDHF) calculations are used to simulate the transient absorption and the resulting spectra and temporal evolution agree with experimental observations. We model the effect of near-infrared perturbation on molecular polarization and find that the laser-induced phase-shift model agrees with the experimental and MCTDHF results, while the laser-induced attenuation model does not. We relate the electronic-state-symmetry-dependent sign of the OD change to the Fano parameters of the static absorption line shapes.

  8. Lasers in Medicine.

    ERIC Educational Resources Information Center

    Hill, P. D.

    1989-01-01

    Described are the characteristics of the laser and its effects on the body. Discussed are examples of laser treatments, including angioplasty, ophthalmology, and dermatology. A discussion of lasers of clinical interest and their applications is presented. (YP)

  9. Laser-Driven Fusion.

    ERIC Educational Resources Information Center

    Gibson, A. F.

    1980-01-01

    Discusses the present status and future prospects of laser-driven fusion. Current research (which is classified under three main headings: laser-matter interaction processes, compression, and laser development) is also presented. (HM)

  10. Diode Laser Arrays

    NASA Astrophysics Data System (ADS)

    Botez, Dan; Scifres, Don R.

    2005-11-01

    Contributors; 1. Monolithic phase-locked semiconductor laser arrays D. Botez; 2. High power coherent, semiconductor laser master oscillator power amplifiers and amplifier arrays D. F. Welch and D. G. Mehuys; 3. Microoptical components applied to incoherent and coherent laser arrays J. R. Leger; 4. Modeling of diode laser arrays G. R. Hadley; 5. Dynamics of coherent semiconductor laser arrays H. G. Winfuland and R. K. Defreez; 6. High average power semiconductor laser arrays and laser array packaging with an emphasis for pumping solid state lasers R. Solarz; 7. High power diode laser arrays and their reliability D. R. Scifres and H. H. Kung; 8. Strained layer quantum well heterostructure laser arrays J. J. Coleman; 9. Vertical cavity surface emitting laser arrays C. J. Chang-Hasnain; 10. Individually addressed arrays of diode lasers D. Carlin.

  11. Hypersonic gasdynamic laser system

    SciTech Connect

    Foreman, K.M.; Maciulaitis, A.

    1990-05-22

    This patent describes a visible, or near to mid infra-red, hypersonic gas dynamic laser system. It comprises: a hypersonic vehicle for carrying the hypersonic gas dynamic laser system, and also providing high energy ram air for thermodynamic excitation and supply of the laser gas; a laser cavity defined within the hypersonic vehicle and having a laser cavity inlet for the laser cavity formed by an opening in the hypersonic vehicle, such that ram air directed through the laser cavity opening supports gas dynamic lasing operations at wavelengths less than 10.6{mu} meters in the laser cavity; and an optical train for collecting the laser radiation from the laser cavity and directing it as a substantially collimated laser beam to an output aperture defined by an opening in the hypersonic vehicle to allow the laser beam to be directed against a target.

  12. Lasers in Medicine.

    ERIC Educational Resources Information Center

    Hill, P. D.

    1989-01-01

    Described are the characteristics of the laser and its effects on the body. Discussed are examples of laser treatments, including angioplasty, ophthalmology, and dermatology. A discussion of lasers of clinical interest and their applications is presented. (YP)

  13. Laser-Driven Fusion.

    ERIC Educational Resources Information Center

    Gibson, A. F.

    1980-01-01

    Discusses the present status and future prospects of laser-driven fusion. Current research (which is classified under three main headings: laser-matter interaction processes, compression, and laser development) is also presented. (HM)

  14. Laser therapy (image)

    MedlinePlus

    A laser is used for many medical purposes. Because the laser beam is so small and precise, it enables ... without injuring surrounding tissue. Some uses of the laser are retinal surgery, excision of lesions, and cauterization ...

  15. Laser Weapons for Naval Applications

    DTIC Science & Technology

    2012-03-27

    IPG fiber lasers , 10 kW/ fiber 7 • Output wavelength is tunable (can operate in atmospheric window) Free Electron Lasers ...Multiple kilowatts over multiple kilometers • Laser power converters can be highly efficient, > 60 % • Fiber lasers are highly compact and... lasers - Free electron lasers • Background • Laser candidates • Additional capabilities - Power beaming 3 Laser Lethality -

  16. Development of a new two color far infrared laser interferometer for future fusion devices

    SciTech Connect

    Kawahata, K.; Tanaka, K.; Tokuzawa, T.; Akiyama, T.; Ito, Y.; Okajima, S.; Nakayama, K.; Wylde, R.J.

    2004-10-01

    A new two color far infrared (FIR) laser interferometer under development for future fusion devices will be presented. The laser wavelength is optimized from the consideration of the beam refraction effect due to plasma density gradient and signal-to-noise ratio for an expected phase shift due to plasmas. Laser lines of 57.2 and 47.6 {mu}m are found to be suitable for the applications to high performance plasmas of Large Helical Device and future fusion devices such as the International Thermonuclear Experimental Reactor. The output power of 57.2 {mu}m CH{sub 3}OD laser is estimated to be {approx}1.6 W, which is the highest laser power in the FIR wavelength regime. The optical configuration of a new interferometer system using two colors will be proposed. In the system, one detector simultaneously detects the beat signals of the 57.2 and 47.6 {mu}m laser lines, and each interference signal can be separated electronically (1 MHz for 57.2 {mu}m and 0.84 MHz expected for 47.6 {mu}m). Mechanical vibration can be compensated by using the two color interferometer. The present status of the development of the system is also presented.

  17. Laser accidents: Being Prepared

    SciTech Connect

    Barat, K

    2003-01-24

    The goal of the Laser Safety Officer and any laser safety program is to prevent a laser accident from occurring, in particular an injury to a person's eyes. Most laser safety courses talk about laser accidents, causes, and types of injury. The purpose of this presentation is to present a plan for safety offices and users to follow in case of accident or injury from laser radiation.

  18. TEM characterization of 14YWT and 12YWT ODS ferritic alloys neutron irradiated at 500C using in-situ helium injection

    SciTech Connect

    Jung, Hee Joon; Edwards, Danny J.; Kurtz, Richard J.; Odette, G Robert; Wu, Yuan; Yamamoto, Takuya

    2015-03-31

    This report summaries TEM characterization of 14YWT and 12YWT, ODS ferritic alloys with 14 and 12 wt % of Cr respectively, to compare the effect of neutron irradiation with and without concurrent He injection using ISHI. The density and average size of <100>/{100} type dislocation loops are always larger than those of 1/2<111>/{111} type, but this difference is significantly affected by He implantation. The density of dislocation loops of both types ranges from ~1 to 4x1021 m-3 with average size ranging from 5~20 nm. 14YWT has lower density but larger size dislocation loops than 12YWT, while the line dislocation density of 14YWT is 3 times lower than that of 12YWT. Helium bubble densities of both 14YWT and 12YWT are 1.9x1023 m-3, the average He bubbles size of 14YWT and 12YWT are 1.4 and 1.2 nm, respectively. 14YWT exhibits α-α’ phase separation, Y-rich particles and uniformly distributed W. In addition to those features, 12YWT exhibits Y-Ti-O particles (not Y-O rich) and elongated Cr-rich phases.

  19. Understanding and controlling morphology evolution via DIO plasticization in PffBT4T-2OD/PC71BM devices

    PubMed Central

    Zhang, Yiwei; Parnell, Andrew J.; Pontecchiani, Fabio; Cooper, Joshaniel F. K.; Thompson, Richard L.; Jones, Richard A. L.; King, Stephen M.; Lidzey, David G.; Bernardo, Gabriel

    2017-01-01

    We demonstrate that the inclusion of a small amount of the co-solvent 1,8-diiodooctane in the preparation of a bulk-heterojunction photovoltaic device increases its power conversion efficiency by 20%, through a mechanism of transient plasticisation. We follow the removal of 1,8-diiodooctane directly after spin-coating using ellipsometry and ion beam analysis, while using small angle neutron scattering to characterise the morphological nanostructure evolution of the film. In PffBT4T-2OD/PC71BM devices, the power conversion efficiency increases from 7.2% to above 8.7% as a result of the coarsening of the phase domains. This coarsening process is assisted by thermal annealing and the slow evaporation of 1,8-diiodooctane, which we suggest, acts as a plasticiser to promote molecular mobility. Our results show that 1,8-diiodooctane can be completely removed from the film by a thermal annealing process at temperatures ≤100 °C and that there is an interplay between the evaporation rate of 1,8-diiodooctane and the rate of domain coarsening in the plasticized film which helps elucidate the mechanism by which additives improve device efficiency. PMID:28287164

  20. The comparison of microstructure and nanocluster evolution in proton and neutron irradiated Fe-9%Cr ODS steel to 3 dpa at 500 °C

    NASA Astrophysics Data System (ADS)

    Swenson, M. J.; Wharry, J. P.

    2015-12-01

    A model Fe-9%Cr oxide dispersion strengthened (ODS) steel was irradiated with protons or neutrons to a dose of 3 displacements per atom (dpa) at a temperature of 500 °C, enabling a direct comparison of ion to neutron irradiation effects at otherwise fixed irradiation conditions. The irradiated microstructures were characterized using transmission electron microscopy and atom probe tomography including cluster analysis. Both proton and neutron irradiations produced a comparable void and dislocation loop microstructure. However, the irradiation response of the Ti-Y-O oxide nanoclusters varied. Oxides remained stable under proton irradiation, but exhibited dissolution and an increase in Y:Ti composition ratio under neutron irradiation. Both proton and neutron irradiation also induced varying extents of Si, Ni, and Mn clustering at existing oxide nanoclusters. Protons are able to reproduce the void and loop microstructure of neutron irradiation carried out to the same dose and temperature. However, since nanocluster evolution is controlled by both diffusion and ballistic impacts, protons are rendered unable to reproduce the nanocluster evolution of neutron irradiation at the same dose and temperature.

  1. Understanding and controlling morphology evolution via DIO plasticization in PffBT4T-2OD/PC71BM devices.

    PubMed

    Zhang, Yiwei; Parnell, Andrew J; Pontecchiani, Fabio; Cooper, Joshaniel F K; Thompson, Richard L; Jones, Richard A L; King, Stephen M; Lidzey, David G; Bernardo, Gabriel

    2017-03-13

    We demonstrate that the inclusion of a small amount of the co-solvent 1,8-diiodooctane in the preparation of a bulk-heterojunction photovoltaic device increases its power conversion efficiency by 20%, through a mechanism of transient plasticisation. We follow the removal of 1,8-diiodooctane directly after spin-coating using ellipsometry and ion beam analysis, while using small angle neutron scattering to characterise the morphological nanostructure evolution of the film. In PffBT4T-2OD/PC71BM devices, the power conversion efficiency increases from 7.2% to above 8.7% as a result of the coarsening of the phase domains. This coarsening process is assisted by thermal annealing and the slow evaporation of 1,8-diiodooctane, which we suggest, acts as a plasticiser to promote molecular mobility. Our results show that 1,8-diiodooctane can be completely removed from the film by a thermal annealing process at temperatures ≤100 °C and that there is an interplay between the evaporation rate of 1,8-diiodooctane and the rate of domain coarsening in the plasticized film which helps elucidate the mechanism by which additives improve device efficiency.

  2. Quantum wave packet propagation study of the photochemistry of phenol: isotope effects (Ph-OD) and the direct excitation to the 1πσ* state.

    PubMed

    An, Heesun; Baeck, Kyoung Koo

    2011-11-24

    An earlier time-dependent quantum wave packet propagation study of the photochemistry of Ph-OH [J. Chem. Phys. 2005, 122, 224315] is extended to investigate isotope effects (for Ph-OD) and the dynamics initiated by direct (vibronically induced) excitation to the (1)πσ* state. The isotope effect is significant only when the initially excited state is (1)ππ*, that is, there are noticeable changes not only in the time scale but also in the branching ratio (Ã/X̃) for the electronic states of the product Ph-O radical. In contrast, the isotope effect on the dynamics initiated by direct excitation to the (1)πσ* state is very small. Our most important observation for the dynamics initiated by direct excitation to the (1)πσ* state is that the initial excitation of the O-H stretch mode does not result in a noticeable enhancement of the product Ph-O radical in the à state, which corresponds to a dissociating H atom with low kinetic energy. The initial excitation of the CCOH torsion mode is the main reason for the enhancement of the product Ph-O radical in the à state that was observed in a vibrationally mediated two-photon experiment [J. Chem. Phys.2008, 128, 104307].

  3. Understanding and controlling morphology evolution via DIO plasticization in PffBT4T-2OD/PC71BM devices

    NASA Astrophysics Data System (ADS)

    Zhang, Yiwei; Parnell, Andrew J.; Pontecchiani, Fabio; Cooper, Joshaniel F. K.; Thompson, Richard L.; Jones, Richard A. L.; King, Stephen M.; Lidzey, David G.; Bernardo, Gabriel

    2017-03-01

    We demonstrate that the inclusion of a small amount of the co-solvent 1,8-diiodooctane in the preparation of a bulk-heterojunction photovoltaic device increases its power conversion efficiency by 20%, through a mechanism of transient plasticisation. We follow the removal of 1,8-diiodooctane directly after spin-coating using ellipsometry and ion beam analysis, while using small angle neutron scattering to characterise the morphological nanostructure evolution of the film. In PffBT4T-2OD/PC71BM devices, the power conversion efficiency increases from 7.2% to above 8.7% as a result of the coarsening of the phase domains. This coarsening process is assisted by thermal annealing and the slow evaporation of 1,8-diiodooctane, which we suggest, acts as a plasticiser to promote molecular mobility. Our results show that 1,8-diiodooctane can be completely removed from the film by a thermal annealing process at temperatures ≤100 °C and that there is an interplay between the evaporation rate of 1,8-diiodooctane and the rate of domain coarsening in the plasticized film which helps elucidate the mechanism by which additives improve device efficiency.

  4. Cut Size Determination of Centrifugal Classifier with Fluidized Bed / Wyznaczanie Ziarna Granicznego Klasyfikatora Odśrodkowego Z Warstwą Fluidalną

    NASA Astrophysics Data System (ADS)

    Otwinowski, Henryk

    2013-09-01

    The cut size determination on the basis of proposed matrix model of classification process in a centrifugal air flow classifier with a fluidized bed is presented using matrix model. The presented methodology of cut size determination is based on the precise measurement of the total mass of fed material and coarse product in experimental tests. Knowledge of the feed particle size distribution is also required. Considered classifier is a part of the fluidized bed jet mill. The presented cut size determination will allow to optimize mill work and prediction of particle size distribution of the classification products. W artykule przedstawiono metodykę wyznaczania rozmiaru ziarna granicznego procesu klasyfikacji w odśrodkowym klasyfikatorze przepływowym z warstwą fluidalną przy wykorzystaniu modelu macierzowego. Przedstawiona metodyka oparta jest na dokładnym wyznaczeniu masy nadawy i gruboziarnistego produktu klasyfikacji na podstawie badań eksperymentalnych. Wymagana jest także znajomość składu ziarnowego nadawy. Rozpatrywany klasyfikator stanowi część fluidalnego młyna strumieniowego. Wyznaczenie rozmiaru ziarna granicznego umożliwia przeprowadzenie optymalizacji pracy młyna i prognozowanie składu ziarnowego produktów klasyfikacji.

  5. Topolology-symmetry law of structure of natural titanosilicate micas and related heterophyllosilicates based on the extended OD theory: Structure prediction

    NASA Astrophysics Data System (ADS)

    Belokoneva, E. L.; Topnikova, A. P.; Aksenov, S. M.

    2015-01-01

    A topology-symmetry analysis of the structures in the family of titanosilicate micas and related heterophyllosilicates based on the extended OD theory reveals their kinship with the family of rhodezite, delhayelite, and other minerals that had been analyzed earlier by distinguishing sheets common for all the structures. Like in the family studied earlier, the structural variety of a more complex titanosilicate family is determined by different local symmetries of sheets. Sheets consist of central O layers of edge-sharing octahedra and H layers formed by tetrahedra connected into diortho groups and Ti(Nb,Fe) semioctahedra (octahedra). Three patterns of connection of O and H layers correspond to sheet symmetry P2/ m, P21/ m, and . Various symmetry modes of sheet connection in the structures are analyzed. Hypothetical structures, including structures with a higher degree of disorder, which can be found in nature or obtained by crystal synthesis, are deduced. Factors responsible for structural variety, including the existence of two main sheet varieties (with P2/ m and P21/ m symmetry) are considered a consequence of the difference in the chemism of the mineral formation medium.

  6. Laser satellite power systems

    SciTech Connect

    Walbridge, E.W.

    1980-01-01

    A laser satellite power system (SPS) converts solar power captured by earth-orbiting satellites into electrical power on the earth's surface, the satellite-to-ground transmission of power being effected by laser beam. The laser SPS may be an alternative to the microwave SPS. Microwaves easily penetrate clouds while laser radiation does not. Although there is this major disadvantage to a laser SPS, that system has four important advantages over the microwave alternative: (1) land requirements are much less, (2) radiation levels are low outside the laser ground stations, (3) laser beam sidelobes are not expected to interfere with electromagnetic systems, and (4) the laser system lends itself to small-scale demonstration. After describing lasers and how they work, the report discusses the five lasers that are candidates for application in a laser SPS: electric discharge lasers, direct and indirect solar pumped lasers, free electron lasers, and closed-cycle chemical lasers. The Lockheed laser SPS is examined in some detail. To determine whether a laser SPS will be worthy of future deployment, its capabilities need to be better understood and its attractiveness relative to other electric power options better assessed. First priority should be given to potential program stoppers, e.g., beam attenuation by clouds. If investigation shows these potential program stoppers to be resolvable, further research should investigate lasers that are particularly promising for SPS application.

  7. New laser protective eyewear

    NASA Astrophysics Data System (ADS)

    McLear, Mark

    1996-04-01

    Laser technology has significantly impacted our everyday life. Lasers are now used to correct your vision, clear your arteries, and are used in the manufacturing of such diverse products as automobiles, cigarettes, and computers. Lasers are no longer a research tool looking for an application. They are now an integral part of manufacturing. In the case of Class IV lasers, this explosion in laser applications has exposed thousands of individuals to potential safety hazards including eye damage. Specific protective eyewear designed to attenuate the energy of the laser beam below the maximum permissible exposure is required for Class 3B and Class IV lasers according to laser safety standards.

  8. Maxillary overdentures supported by four splinted direct metal laser sintering implants: a 3-year prospective clinical study.

    PubMed

    Mangano, Francesco; Luongo, Fabrizia; Shibli, Jamil Awad; Anil, Sukumaran; Mangano, Carlo

    2014-01-01

    Purpose. Nowadays, the advancements in direct metal laser sintering (DMLS) technology allow the fabrication of titanium dental implants. The aim of this study was to evaluate implant survival, complications, and peri-implant marginal bone loss of DMLS implants used to support bar-retained maxillary overdentures. Materials and Methods. Over a 2-year period, 120 implants were placed in the maxilla of 30 patients (18 males, 12 females) to support bar-retained maxillary overdentures (ODs). Each OD was supported by 4 implants splinted by a rigid cobalt-chrome bar. At each annual follow-up session, clinical and radiographic parameters were assessed. The outcome measures were implant failure, biological and prosthetic complications, and peri-implant marginal bone loss (distance between the implant shoulder and the first visible bone-to-implant contact, DIB). Results. The 3-year implant survival rate was 97.4% (implant-based) and 92.9% (patient-based). Three implants failed. The incidence of biological complication was 3.5% (implant-based) and 7.1% (patient-based). The incidence of prosthetic complication was 17.8% (patient-based). No detrimental effects on marginal bone level were evidenced. Conclusions. The use of 4 DMLS titanium implants to support bar-retained maxillary ODs seems to represent a safe and successful procedure. Long-term clinical studies on a larger sample of patients are needed to confirm these results.

  9. Maxillary Overdentures Supported by Four Splinted Direct Metal Laser Sintering Implants: A 3-Year Prospective Clinical Study

    PubMed Central

    Mangano, Francesco; Shibli, Jamil Awad; Anil, Sukumaran

    2014-01-01

    Purpose. Nowadays, the advancements in direct metal laser sintering (DMLS) technology allow the fabrication of titanium dental implants. The aim of this study was to evaluate implant survival, complications, and peri-implant marginal bone loss of DMLS implants used to support bar-retained maxillary overdentures. Materials and Methods. Over a 2-year period, 120 implants were placed in the maxilla of 30 patients (18 males, 12 females) to support bar-retained maxillary overdentures (ODs). Each OD was supported by 4 implants splinted by a rigid cobalt-chrome bar. At each annual follow-up session, clinical and radiographic parameters were assessed. The outcome measures were implant failure, biological and prosthetic complications, and peri-implant marginal bone loss (distance between the implant shoulder and the first visible bone-to-implant contact, DIB). Results. The 3-year implant survival rate was 97.4% (implant-based) and 92.9% (patient-based). Three implants failed. The incidence of biological complication was 3.5% (implant-based) and 7.1% (patient-based). The incidence of prosthetic complication was 17.8% (patient-based). No detrimental effects on marginal bone level were evidenced. Conclusions. The use of 4 DMLS titanium implants to support bar-retained maxillary ODs seems to represent a safe and successful procedure. Long-term clinical studies on a larger sample of patients are needed to confirm these results. PMID:25580124

  10. [Laser physics].

    PubMed

    Banús Gassol, J M

    2008-11-01

    The commission of this article plunged me into doubt. First I should confess that I don't find excuse to escape this part if somebody wants to minimally deepen in the knowledge of the biological effects of this energy source. Secondly, when we talk about results, we use terms made and defined by Physics. Often we have polemics about results, and what really happens is that we don't reach agreements because we refer to different terms to explain the same observation; in conclusion we cannot understand each other because we do not know the adequate terms; for example, hypoxemia as oxygen deficit, which is true in an anemic patient as well as in a low oxygen saturation rate. In consequence, a good review of these concepts seems necessary to me. The third reason is the confusion that exists in our environment, I think sometimes of interest, about properties and effects of different types of laser. Only a minimal knowledge of physics will help us to state the scientific basis for understanding. The problems, nevertheless, accumulate due to the fact that the universe to which this article is directed is formed by urologists. What Physics education should we suppose they have? Superficial? Medium? Is it a collective with a uniform knowledge, being it whatever it is? The implication is clear. The article depth will depend on the answers to these questions. Nevertheless, the aim of the authors is to give a base enough to know what the laser is and how it acts. For that, the answer I gave to my questions is that the reader should understand the article and have enough base for, at least, reading critically the articles about laser published in urological journals.

  11. Laser Stabilization

    SciTech Connect

    Hall, John L.; Taubman, Matthew S.; Ye, Jun

    2010-01-01

    This book chapter covers the basics of the field of stabilizing lasers to optical frequency references such as optical cavities and molecular transitions via the application of servo control systems. These discussions are given with reference to the real-life frequency metrology experienced in Hall-Labs (now Ye-Labs), JILA, University of Colorado. The subjects covered include: the basics of control system stability, a discussion of both the theoretical and experimental limitations, an outline of optical cavity susceptibility to environmental noise, and a brief introduction to the use and limitations of molecular transitions as frequency references.

  12. Laser biophotonics

    NASA Astrophysics Data System (ADS)

    Bashkatov, A. N.; Genina, E. A.; Priezzhev, A. V.; Tuchin, V. V.

    2016-06-01

    This issue of Quantum Electronics presents the papers that reflect the state-of-the-art of laser technologies used in biomedical studies and medical practice. Among the new technologies, one can note the methods of correlation and Doppler spectroscopy, as well as THz spectroscopy, in which biologically significant molecules are characterised by specific resonances. The latter topic is considered in the paper by Nazarov et al., where the dielectric function of aqueous solutions of glucose and albumin is studied using pulsed THz spectroscopy.

  13. Effects of bioactive glass and beta-TCP containing three-dimensional laser sintered polyetheretherketone composites on osteoblasts in vitro.

    PubMed

    von Wilmowsky, Cornelius; Vairaktaris, Eleftherios; Pohle, Dirk; Rechtenwald, Thomas; Lutz, Rainer; Münstedt, Helmut; Koller, Garrit; Schmidt, M; Neukam, Friedrich Wilhelm; Schlegel, Karl Andreas; Nkenke, Emeka

    2008-12-15

    Because of their excellent physical properties nonresorbable thermoplastic polymers have become more important for the field of reconstructive surgery. Aim of the present study was to investigate the effects of laser sintered polyetheretherketone (PEEK) with incorporated osteoconductive and bioactive bone substitution materials on osteoblasts in vitro. Human osteoblasts (hFOB 1.19) were seeded onto laser sintered PEEK samples containing nano-sized carbon black, beta-tricalciumphosphate (beta-TCP), and bioactive glass 45S5. Osteoblasts were investigated for cell viability, cell proliferation and cell morphology. A constant proliferation of osteoblasts could be observed on all samples with the highest values for bioactive glass containing samples at day 7 (OD 1.76 +/- 0.22) and day 14 (OD 3.75 +/- 0.31) and lowest values for beta-TCP containing probes throughout the study compared with the PEEK pure control group. Highest cell viability was observed for Bioglass containing probes (95.5 +/- 3.32)% whereas osteoblasts seeded on beta-TCP containing probes showed reduced viability (84.4 +/- 4.32)%. Laser sintered PEEK implants seem to be attractive candidates for use as bone substitutes for reconstructive surgery because of their biocompatibility, individual shape, and the possibility of compounding bioinert polymer powder with osteoconductive and bioactive materials which might benefit bone formation in vivo.

  14. Laser Diode Pumped Solid State Lasers

    DTIC Science & Technology

    1987-01-01

    structures, monolithic phased arrays, multiple stripe lasers which were made possible by improved manufacturing technologies su LPE and particular...mass production of single laser diodes in Japan, went a development in the U.S. which is aimed at the fabrication of powerful monolithic arrays. The...Significant progress has been made recently in developing the monolithic , linear laser diode array. Output power, slope efficiency, laser threshold and

  15. Femtosecond laser in laser in situ keratomileusis

    PubMed Central

    Salomão, Marcella Q.; Wilson, Steven E.

    2014-01-01

    Flap creation is a critical step in laser in situ keratomileusis (LASIK). Efforts to improve the safety and predictability of the lamellar incision have fostered the development of femtosecond lasers. Several advantages of the femtosecond laser over mechanical microkeratomes have been reported in LASIK surgery. In this article, we review common considerations in management and complications of this step in femtosecond laser–LASIK and concentrate primarily on the IntraLase laser because most published studies relate to this instrument. PMID:20494777

  16. Laser Propulsion - Quo Vadis

    SciTech Connect

    Bohn, Willy L.

    2008-04-28

    First, an introductory overview of the different types of laser propulsion techniques will be given and illustrated by some historical examples. Second, laser devices available for basic experiments will be reviewed ranging from low power lasers sources to inertial confinement laser facilities. Subsequently, a status of work will show the impasse in which the laser propulsion community is currently engaged. Revisiting the basic relations leads to new avenues in ablative and direct laser propulsion for ground based and space based applications. Hereby, special attention will be devoted to the impact of emerging ultra-short pulse lasers on the coupling coefficient and specific impulse. In particular, laser sources and laser propulsion techniques will be tested in microgravity environment. A novel approach to debris removal will be discussed with respect to the Satellite Laser Ranging (SRL) facilities. Finally, some non technical issues will be raised aimed at the future prospects of laser propulsion in the international community.

  17. Branch retinal artery occlusion in a patient with one eye. Laser Nd:YAG approach.

    PubMed

    Solans Pérez-Larraya, A M; Ortega-Molina, J M; Salgado-Miranda, A D; García-Serrano, J L

    2016-06-01

    An 82-year-old man was admitted to the emergency department complaining of a sudden painless visual loss in his left eye (OS). He was diagnosed with branch retinal artery occlusion (BRAO) with a visible embolus. In 2012, he had a central artery occlusion (CRAO) in his right eye (OD). An embolysis with Nd:YAG laser was attempted, the retinal arterial blood flow was restored completely and the visual field was improved, with no secondary complications. Nd:YAG laser embolysis is a treatment to be considered in patients with BRAO with a visible embolus. The risks and benefits of the procedure should be evaluated, comparing it with possible permanent loss of visual acuity and other vascular complications caused by BRAO. Copyright © 2016 Sociedad Española de Oftalmología. Published by Elsevier España, S.L.U. All rights reserved.

  18. Single Frequency, Pulsed Laser Diode Transmitter for Dial Water Vapor Measurements at 935nm

    NASA Technical Reports Server (NTRS)

    Switzer, Gregg W.; Cornwell, Donald M., Jr.; Krainak, Michael A.; Abshire, James B.; Rall, Johnathan A. R.

    1998-01-01

    We report a tunable, single frequency, narrow linewidth, pulsed laser diode transmitter at 935.68nm for remote sensing of atmospheric water vapor. The transmitter consists of a CW, tunable, external cavity diode laser whose output is amplified 2OdB using a tapered diode amplifier. The output is pulsed for range resolved DIAL lidar by pulsing the drive current to the diode amplifier at 4kHz with a .5% duty cycle. The output from the transmitter is 36OnJ/pulse and is single spatial mode. It maintains a linewidth of less than 25MHz as its wavelength is tuned across the water vapor absorption line at 935.68nm. The transmitter design and its use in a water vapor measurement will be discussed.

  19. The Geoscience Laser Altimeter System Laser Transmitter

    NASA Technical Reports Server (NTRS)

    Afzal, R. S.; Dallas, J. L.; Yu, A. W.; Mamakos, W. A.; Lukemire, A.; Schroeder, B.; Malak, A.

    2000-01-01

    The Geoscience Laser Altimeter System (GLAS), scheduled to launch in 2001, is a laser altimeter and lidar for tile Earth Observing System's (EOS) ICESat mission. The laser transmitter requirements, design and qualification test results for this space- based remote sensing instrument are presented.

  20. Studies on lasers and laser devices

    NASA Technical Reports Server (NTRS)

    Harris, S. E.; Siegman, A. E.; Young, J. F.

    1983-01-01

    The goal of this grant was to study lasers, laser devices, and uses of lasers for investigating physical phenomena are studied. The active projects included the development of a tunable, narrowband XUV light source and its application to the spectroscopy of core excited atomic states, and the development of a technique for picosecond time resolution spectroscopy of fast photophysical processes.

  1. A Q-switched Ho:YAG laser assisted nanosecond time-resolved T-jump transient mid-IR absorbance spectroscopy with high sensitivity

    SciTech Connect

    Li, Deyong; Li, Yunliang; Li, Hao; Weng, Yuxiang; Wu, Xianyou; Yu, Qingxu

    2015-05-15

    Knowledge of dynamical structure of protein is an important clue to understand its biological function in vivo. Temperature-jump (T-jump) time-resolved transient mid-IR absorbance spectroscopy is a powerful tool in elucidating the protein dynamical structures and the folding/unfolding kinetics of proteins in solution. A home-built setup of T-jump time-resolved transient mid-IR absorbance spectroscopy with high sensitivity is developed, which is composed of a Q-switched Cr, Tm, Ho:YAG laser with an output wavelength at 2.09 μm as the T-jump heating source, and a continuous working CO laser tunable from 1580 to 1980 cm{sup −1} as the IR probe. The results demonstrate that this system has a sensitivity of 1 × 10{sup −4} ΔOD for a single wavelength detection, and 2 × 10{sup −4} ΔOD for spectral detection in amide I′ region, as well as a temporal resolution of 20 ns. Moreover, the data quality coming from the CO laser is comparable to the one using the commercial quantum cascade laser.

  2. Laser Spectroscopy

    NASA Astrophysics Data System (ADS)

    Katori, H.; Yoneda, H.; Nakagawa, K.; Shimizu, F.

    2010-02-01

    .] -- Ultracold Ytterbium atoms in optical lattices / S. Sugawa ... [et al.] -- Ultracold polar molecules in the rovibrational ground state / J. Deiglmayr ... [et al.] -- Polar molecules near quantum degeneracy / J. Ye and D. S. Jin -- Production of a quantum gas of rovibronic ground-state molecules in an optical lattice / J. G. Danzl ... [et al.] -- Recent progress in x-ray nonlinear optics / K. Tamasaku, K. Sawada, and T. Ishikawa -- Gas in scattering media absorption spectroscopy - laser spectroscopy in unconventional environments / S. Svanberg -- Laser spectroscopy on relativistic ion beams / S. Reinhardt ... [et al.] -- Single frequency microcavity lasers and applications / L. Xu ... [et al.].

  3. Lasers and laser-tissue interaction.

    PubMed

    Peavy, George M

    2002-05-01

    Light produced by a laser differs from incandescent light in that it is monochromatic, coherent, and intense; and it is these properties that allow lasers to be used as such unique tools in biomedical research and patient care. The effect of a laser beam on tissue is dependent on the optical and mechanical properties of the tissue, and the wavelength, power parameters, and time domains of the laser exposure. Understanding these principles is not only important for the selection of an appropriate laser system for a specific application, but also is essential for that application to be successful.

  4. Laser Wire Stripper

    NASA Technical Reports Server (NTRS)

    1983-01-01

    NASA-developed space shuttle technology is used in a laser wire stripper designed by Raytheon Company. Laser beams cut through insulation on a wire without damaging conductive metal, because laser radiation that melts plastic insulation is reflected by the metal. The laser process is fast, clean, precise and repeatable. It eliminates quality control problems and the expense of rejected wiring.

  5. Narrow gap laser welding

    DOEpatents

    Milewski, John O.; Sklar, Edward

    1998-01-01

    A laser welding process including: (a) using optical ray tracing to make a model of a laser beam and the geometry of a joint to be welded; (b) adjusting variables in the model to choose variables for use in making a laser weld; and (c) laser welding the joint to be welded using the chosen variables.

  6. Obstacles to Laser Safety

    SciTech Connect

    Barat, K

    2005-04-25

    The growth of laser development & technology has been remarkable. Unfortunately, a number of traps or obstacles to laser safety have also developed with that growth. The goal of this article is to highlight those traps, in the hope that an aware laser user will avoid them. These traps have been the cause or contributing factor of many a preventable laser accident.

  7. Longitudinal discharge laser baffles

    DOEpatents

    Warner, B.E.; Ault, E.R.

    1994-06-07

    The IR baffles placed between the window and the electrode of a longitudinal discharge laser improve laser performance by intercepting off-axis IR radiation from the laser and in doing so reduce window heating and subsequent optical distortion of the laser beam. 1 fig.

  8. Reverse laser drilling

    NASA Technical Reports Server (NTRS)

    Anthony, Thomas R. (Inventor)

    1984-01-01

    This invention provides a method for laser drilling small diameter, closely-spaced, and accurately located holes in a body of material which is transparent or substantially transparent to the laser radiation employed whereby the holes are drilled through the thickness of the body from the surface opposite to that on which the laser beam impinges to the surface of laser beam impingement.

  9. Lasers in cosmetic dentistry.

    PubMed

    Pang, Peter

    2008-01-01

    Lasers have become a necessary instrument in the esthetic restorative armamentarium. This article presents smile design guidelines for soft tissue lasers, as well as an overview of hard tissue procedures that may be performed using all-tissue lasers. The goal is to help dentists determine the appropriate laser for a given clinical situations.

  10. Narrow gap laser welding

    DOEpatents

    Milewski, J.O.; Sklar, E.

    1998-06-02

    A laser welding process including: (a) using optical ray tracing to make a model of a laser beam and the geometry of a joint to be welded; (b) adjusting variables in the model to choose variables for use in making a laser weld; and (c) laser welding the joint to be welded using the chosen variables. 34 figs.

  11. X-ray lasers

    SciTech Connect

    Elton, R.C.

    1990-01-01

    This paper provides a source that surveys the fundamentals of x-ray lasers and summarizes recent advances. The author emphasizes x-ray lasers created using high temperature plasmas as the medium. Specific topics discussed included electron-collisional excitation pumping, plasma laser pumping, and gamma-ray lasers. Numerous literature references provided.

  12. Laser photobiology and photomedicine

    SciTech Connect

    Martellucci, S.; Chester, A.N.

    1985-01-01

    This book presents information on the following topics: the physical and biological basis of photobiology and photomedicine; the biological effects and applications of laser technology; photochemotherapy; photobiology and dermatology; surgical and ophthalmological applications of lasers; laser safety; and diagnostics and technological aspects of recent laser developments.

  13. Short wavelength laser

    DOEpatents

    Hagelstein, P.L.

    1984-06-25

    A short wavelength laser is provided that is driven by conventional-laser pulses. A multiplicity of panels, mounted on substrates, are supported in two separated and alternately staggered facing and parallel arrays disposed along an approximately linear path. When the panels are illuminated by the conventional-laser pulses, single pass EUV or soft x-ray laser pulses are produced.

  14. Laser therapy for cancer

    MedlinePlus

    ... of organs inside the body. They can treat basal cell skin cancer and cancers of the cervix, vagina, and vulva. Argon lasers. These lasers can treat skin cancer and are also used with light-sensitive drugs in a treatment called photodynamic therapy . Nd:Yag lasers. These lasers ...

  15. Longitudinal discharge laser baffles

    DOEpatents

    Warner, Bruce E.; Ault, Earl R.

    1994-01-01

    The IR baffles placed between the window and the electrode of a longitudinal discharge laser improve laser performance by intercepting off-axis IR radiation from the laser and in doing so reduce window heating and subsequent optical distortion of the laser beam.

  16. Solar driven lasers for power satellite applications

    NASA Technical Reports Server (NTRS)

    Taussio, R.; Cassady, P.; Klosterman, E.

    1980-01-01

    The technological feasibility of using multimagawatt lasers for space power transmission is discussed. Candidate lasers include electric discharge lasers, direct optically pumped lasers, and free electron lasers.

  17. OD Strategy for Today's Training

    ERIC Educational Resources Information Center

    Carter, Robert N.

    1975-01-01

    The organizational development strategy of the W. T. Grant Company, an overlapping group teamwork approach, is directed toward accountability, planned change, individual recognition, experience-based behavior, group morale, smooth information and communication flow, and decision making. (EA)

  18. Sorption and degradation of selected organic UV filters (BM-DBM, 4-MBC, and OD-PABA) in laboratory water-sediment systems.

    PubMed

    Li, Sheng; Lu, Guanghua; Xie, Zhengxin; Ding, Jiannan; Liu, Jianchao; Li, Yi

    2016-05-01

    Organic UV filters that have been widely used in sunscreens and other personal care products have drawn much public concern because of their widespread contamination in the environment and their potential ecological risks to ecosystems. We selected three UV filters with high frequency of detection in the environment, namely butyl methoxy dibenzoylmethane (BM-DBM), ethylhexyl dimethyl p-aminobenzoate (OD-PABA), and 4-methylbenzylidene camphor (4-MBC), to investigate the sorption and degradation behaviors of these compounds in lab-scale water-sediment systems set up with natural water and sediment samples collected from different rivers and lakes (i.e., Yangtze River, Qinhuai River, Xuanwu Lake, and Mochou Lake) in Nanjing, East China. The sorption isotherms of these UV filters were well described by the Freundlich equation (C s   = K f  × C w (n) ). The sorption of three UV filters in four sediments was all linear or close to it, with n values between 0.92 and 1.13. A moderate to strong sorption affinity was observed for these compounds, and the sorption appears to be irreversible. For the combined sorption and degradation studies, sorption was found to be a primary mechanism for the disappearance of these UV filters from the water phase, and biotransformation appears to be the predominant factor for the degradation of the target compounds in the water-sediment systems. All three UV filters were found to be slightly resistant to the microbes in these systems, with DT50total and DT90total values-the disappearance time (DT) describes the time in which the initial total mass of the UV filters in the whole system is reduced by 50 and 90 %-ranging between 18 and 31 days and 68 and 101 days, respectively.

  19. Late Holocene glacial history of Petermann Fjord, Northwest Greenland: Non-destructive CT, XRF, and magnetic results from OD1507 sediment cores

    NASA Astrophysics Data System (ADS)

    Reilly, B. T.; Stoner, J. S.; Mix, A. C.; Jakobsson, M.; Jennings, A. E.; Walczak, M.; Dyke, L. M.; Cheseby, M.; Albert, S. W.; Wiest, J.

    2016-12-01

    An international and interdisciplinary expedition to Nares Strait and Petermann Fjord, Northwest Greenland, onboard the Swedish Icebreaker Oden July-September 2015 (OD1507) sought to understand the Holocene history of the Petermann glacial system among other research objectives. Petermann Glacier, which terminates as a floating ice-tongue in Petermann Fjord, is thought to be especially sensitive to ice-ocean interactions. While limited historical observations dating back to 1876 suggest the Petermann Ice Tongue extends about 70-90 km from the grounding-line, large calving events in 2010 and 2012 reduced the ice-tongue extent to about 45 km from the grounding-line. A suite of 14 marine sediment cores recovered a range of glacio-marine facies that form an along fjord (15-80 km from the grounding-line) and an across fjord depth (473-1041 meters water depth) transect. CT scans clearly identify four primary fjord facies, including bioturbated, IRD-rich, laminated and mud with stratified graded sand layers. The latter of these occurs near the modern grounding-line. Additionally, a new MATLAB routine is used to quantify clasts >2 mm in size from the CT scans. XRF sediment geochemical changes mirror magnetic mineral concentrations and are driven by varying contribution of Ca-rich and Ca-poor sources, which we interpret as a reflection of the mixing of the local carbonate rocks and crystalline basement excavated by the ice sheet. Initial paleomagnetic results isolate a strong and stable characteristic remanent magnetization which show remarkable similarity to paleosecular variation (PSV) recorded in nearby mid-late Holocene varved lakes on Ellesmere Island. This non-destructive dataset provides robust correlations, indicating a coherent and dynamic record of changes in the Petermann glacial system during the late Holocene, including evidence for a significant grounding-line retreat followed by the growth and relative paleo-extent of the modern Petermann Ice Tongue.

  20. Vitamin E prevents increase in oxidative damage to lipids and DNA in liver of ODS rats given total body X-ray irradiation.

    PubMed

    Yoshimura, Mika; Kashiba, Misato; Oka, Jun; Sugisawa, Ayako; Umegaki, Keizo

    2002-01-01

    We examined the effects of dietary vitamin E (VE) on oxidative damage to DNA and lipids in the liver a few days after total body irradiation (TBI). ODS rats, which lack vitamin C synthesis, were fed either a low VE diet (4.3 mg VE/kg) or a basal VE diet (75.6 mg VE/kg) for 5 weeks while vitamin C was supplied in the drinking water. The VE level in the liver of the low VE group was lower and the levels of lipid peroxides were higher compared to those of the basal VE group: the relative levels in the two groups were 1:30 for VE, 18:1 for 4-hydroxynonenal (HNE), and 10:1 for hexanal (HA). The level of 8-hydroxydeoxyguanosine (8OHdG), a marker of oxidative DNA damage, did not differ between the low VE and the basal VE groups. When the rats received TBI at the dose of 3 Gy and were killed on day 6, the levels of HNE, HA and 8OHdG increased by 2.2-, 2-, and 1.5-times, respectively, in the low VE group, but TBI did not cause such increases in the basal VE group. Changes in antioxidative enzymes (glutathione peroxidase, catalase, and Cu/Zn-SOD) in the liver could not explain the different responses of the two diet groups to TBI-induced oxidative damage. The concentrations of vitamin C and glutathione in the liver did not differ between the two groups. These results suggest that dietary VE can prevent the oxidative damage to DNA and lipids in the liver which appear a few days after TBI at dose of 3 Gy.

  1. Fabrication and characterization of He-charged ODS-FeCrNi films deposited by a radio-frequency plasma magnetron sputtering technique

    NASA Astrophysics Data System (ADS)

    Liang, SONG; Xianping, WANG; Le, WANG; Ying, ZHANG; Wang, LIU; Weibing, JIANG; Tao, ZHANG; Qianfeng, FANG; Changsong, LIU

    2017-04-01

    He-charged oxide dispersion strengthened (ODS) FeCrNi films were prepared by a radio-frequency (RF) plasma magnetron sputtering method in a He and Ar mixed atmosphere at 150 °C. As a comparison, He-charged FeCrNi films were also fabricated at the same conditions through direct current (DC) plasma magnetron sputtering. The doping of He atoms and Y2O3 in the FeCrNi films was realized by the high backscattered rate of He ions and Y2O3/FeCrNi composite target sputtering method, respectively. Inductive coupled plasma (ICP) and x-ray photoelectron spectroscopy (XPS) analysis confirmed the existence of Y2O3 in FeCrNi films, and Y2O3 content hardly changed with sputtering He/Ar ratio. Cross-sectional scanning electron microscopy (SEM) shows that the FeCrNi films were composed of dense columnar nanocrystallines and the thickness of the films was obviously dependent on He/Ar ratio. Nanoindentation measurements revealed that the FeCrNi films fabricated through DC/RF plasma magnetron sputtering methods exhibited similar hardness values at each He/Ar ratio, while the dispersion of Y2O3 apparently increased the hardness of the films. Elastic recoil detection (ERD) showed that DC/RF magnetron sputtered FeCrNi films contained similar He amounts (∼17 at.%). Compared with the minimal change of He level with depth in DC-sputtered films, the He amount decreases gradually in depth in the RF-sputtered films. The Y2O3-doped FeCrNi films were shown to exhibit much smaller amounts of He owing to the lower backscattering possibility of Y2O3 and the inhibition effect of nano-sized Y2O3 particles on the He element.

  2. New laser materials for laser diode pumping

    NASA Technical Reports Server (NTRS)

    Jenssen, H. P.

    1990-01-01

    The potential advantages of laser diode pumped solid state lasers are many with high overall efficiency being the most important. In order to realize these advantages, the solid state laser material needs to be optimized for diode laser pumping and for the particular application. In the case of the Nd laser, materials with a longer upper level radiative lifetime are desirable. This is because the laser diode is fundamentally a cw source, and to obtain high energy storage, a long integration time is necessary. Fluoride crystals are investigated as host materials for the Nd laser and also for IR laser transitions in other rare earths, such as the 2 micron Ho laser and the 3 micron Er laser. The approach is to investigate both known crystals, such as BaY2F8, as well as new crystals such as NaYF8. Emphasis is on the growth and spectroscopy of BaY2F8. These two efforts are parallel efforts. The growth effort is aimed at establishing conditions for obtaining large, high quality boules for laser samples. This requires numerous experimental growth runs; however, from these runs, samples suitable for spectroscopy become available.

  3. Agile beam laser

    SciTech Connect

    Valley, G. C.

    1985-01-08

    A laser system for providing a rapidly steerable laser output beam. The laser system includes a phase conjugate reflector, laser gain medium and its associated pump source, an output coupling device, and an optical element which selectably controls the transverse lasing mode of the laser system. The components are arranged to form a laser oscillator between the phase conjugate reflector and the optical device, and is operated in such a manner that each selected transverse mode of laser operation generates an output beam from the system which has a different wavefront tilt. Accordingly, the output beam is steerable and is dependent upon the selected transverse mode which is currently lasing in the oscillator.

  4. Photoionization of hydroxymethyl (CD[sub 2]OH and CD[sub 2]OD) and methoxy (CD[sub 3]O) radicals. Photoion efficiency spectra, ionization energies, and thermochemistry

    SciTech Connect

    Kuo, S.C.; Zhang, Z.; Klemm, R.B. ); Liebman, J.F. ); Stief, L.J. ); Nesbitt, F.L. Coppin State College, Baltimore, MD )

    1994-04-14

    Photoion efficiency (PIE) spectra were obtained for CD[sub 2]OH, CD[sub 2]OD, and CD[sub 3]O radicals using the discharge flow-photoionization mass spectrometry technique. The radicals were generated in a flow tube via reaction of F atoms with the appropriate methanol isotopomers (CD[sub 3]OH [yields] CD[sub 2]OH, CD[sub 3]OD [yields] CD[sub 2]OD, and CD[sub 3]OH [yields] CD[sub 3]O), which were in large excess. Deuterated methoxy radicals, CD[sub 3]O, were also generated via the reaction of CD[sub 3] with NO[sub 2]. Photoionization of the radicals was achieved using high intensity, dispersed synchrotron radiation, and ionization energies (IE) of these radicals were derived from the thresholds of the PIE spectra: IE(CD[sub 2]OH) = 7.54 [+-] 0.02 eV, IE(CD[sub 2]OD) = 7.53 [+-] 0.02 eV, and IE(CD[sub 3]O) = 10.74 [+-] 0.02 eV. The PIE spectra for CD[sub 2]OH and CD[sub 3]O are compared to those of a previous photoionization study, and differences are discussed. Integration of previously published photoelectron spectroscopy data for CD[sub 2]OH yields a curve quite similar to our PIE spectrum. Empirical estimates of IE(CH[sub 2]OH) and IE(CH[sub 3]O) are given to corroborate our assignments. The measured ionization energies and the derived thermodynamic quantities are compared with previously reported results. 67 refs., 7 figs., 2 tabs.

  5. Laser extensometer

    NASA Technical Reports Server (NTRS)

    Stocker, P. J.; Marcus, H. L. (Inventor)

    1977-01-01

    A drift compensated and intensity averaged extensometer for measuring the diameter or other properties of a substantially cylindrical sample based upon the shadow of the sample is described. A beam of laser light is shaped to provide a beam with a uniform intensity along an axis normal to the sample. After passing the sample, the portion of the beam not striking said sample is divided by a beam splitter into a reference signal and a measurement signal. Both of these beams are then chopped by a light chopper to fall upon two photodiode detectors. The resulting ac currents are rectified and then divided into one another, with the final output being proportional to the size of the sample shadow.

  6. Lasers in flow cytometry.

    PubMed

    Telford, William G

    2011-01-01

    Laser technology has advanced tremendously since the first gas lasers were incorporated into early flow cytometers. Gas lasers have been largely replaced by solid-state laser technology, making virtually any desirable visible light wavelength available for flow cytometry. Multiwavelength, white light, and wavelength tunable lasers are poised to enhance our analytical capabilities even further. In this chapter, I summarize the role that lasers play in cytometry, and the practical characteristics that make a laser appropriate for flow cytometry. I then review the latest single wavelength lasers available for flow cytometry, and how they can be used to excite the ever-expanding array of available fluorochromes. Finally, I review the contribution and potential of the latest tunable laser technology to flow cytometry, and show several examples of these novel sources integrated into production instruments. Technical details and critical parameters for successful application of these lasers for biomedical analysis are covered in depth.

  7. Tunable lasers- an overview

    SciTech Connect

    Guenther, B.D.; Buser, R.G.

    1982-08-01

    This overview of tunable lasers describes their applicability to spectroscopy in the ultraviolet and middle infrared ranges; to rapid on-line diagnostics by ultrashort cavity lasers; to exploration, by the free electron laser, for its wide tuning in the far infrared to submillimeter region; to remote detection, in areas such as portable pollution monitors, on-line chemical analyzers, auto exhaust analyzers, and production line controls; to photochemistry; and to other potential areas in diagnostics, communications, and medical and biological sciences. The following lasers are characterized by their tunability: solid state lasers, primarily alexandrite, with a tuning range of ca 1000 Angstroms; color center lasers; semiconductor lasers; dye lasers; gas lasers, where high-pressure CO/sub 2/ discharges are the best known example for a wide tunability range, and research is continuing in systems such as the alkali dimers; and, at wavelengths beyond 10 micrometers, the possibilities beyond Cerenkov and free electron lasers.

  8. What is a Laser?

    NASA Astrophysics Data System (ADS)

    Julien, Lucile; Schwob, Catherine

    2015-10-01

    The first laser was built more than 50 years ago, inMay 1960: it was a pulsed ruby laser. It was a simple laboratory curiosity and nobody knew what its usefulness could be. Other devices were rapidly demonstrated, and the variety and number of lasers in the world increased at a huge rate. Currently, the annual laser world market is worth about 6 billion dollars. Thanks to the remarkable properties of laser light, laser applications increase steadily in the domains of industry, building, medicine, telecommunications, etc. One can find many lasers in research laboratories, and they are used more and more in our everyday life and almost everybody has already seen a laser beam. The goal of the first chapter of this book is to explain simply what a laser is, how it is built and how it operates. Firstly, let us point out the outstanding properties of the laser light.

  9. Reflected laser radiation - relevance for laser safety?

    NASA Astrophysics Data System (ADS)

    Zaeh, M. F.; Braunreuther, S.; Daub, R.; Stadler, T.

    Safety is compulsory in today's production lines. Those lines often use laser material processing applications. The highest risk for the operator or a bystander of a laser application is the exposure to the direct beam. With the present laser beam intensities, an accident at least causes sudden blindness or severe burns. Even if the process works correctly, which means the beam is always oriented towards the workpiece, the scattered and reflected parts of the laser beam still can be powerful enough to cause serious harm. The state-of-the-art safety measures are passive laser safety cabins around the application. Because of the high intensities and the low beam divergence of the highly brilliant laser beam sources, they cannot guarantee a safe use of these laser applications. An option is to use active laser safety barriers that react to an impinging laser beam on its surface. A new approach to guarantee laser safety is to monitor the system and watch for incidents, to ensure that the laser spot never reaches the safety barrier. Assuming that accidents with the direct laser beam cannot occur, the passive safety measures still have to withstand the reflected laser radiation. In this paper a theoretical model is presented with which the energy distribution in a hemisphere above a deep-welding-process can be calculated. The model was calibrated and validated with intensity measurements during a welding process. The results of the measurement can be used to develop a process-tailored safety cabin. Because of the increased mobility such a system increases the flexibility of the production cell. Furthermore, the costs for laser-safety may be decreased significantly.

  10. Ascorbic acid deficiency decreases hepatic cytochrome P-450, especially CYP2B1/2B2, and simultaneously induces heme oxygenase-1 gene expression in scurvy-prone ODS rats.

    PubMed

    Kobayashi, Misato; Hoshinaga, Yukiko; Miura, Natsuko; Tokuda, Yuki; Shigeoka, Shigeru; Murai, Atsushi; Horio, Fumihiko

    2014-01-01

    The mechanisms underlying the decrease in hepatic cytochrome P-450 (CYP) content in ascorbic acid deficiency was investigated in scurvy-prone ODS rats. First, male ODS rats were fed a diet containing sufficient ascorbic acid (control) or a diet without ascorbic acid (deficient) for 18 days, with or without the intraperitoneal injection of phenobarbital. Ascorbic acid deficiency decreased hepatic microsomal total CYP content, CYP2B1/2B2 protein, and mitochondrial cytochrome oxidase (COX) complex IV subunit I protein, and simultaneously increased heme oxygenase-1 protein in microsomes and mitochondria. Next, heme oxygenase-1 inducers, that is lipopolysaccharide and hemin, were administered to phenobaribital-treated ODS rats fed sufficient ascorbic acid. The administration of these inducers decreased hepatic microsomal total CYP content, CYP2B1/2B2 protein, and mitochondrial COX complex IV subunit I protein. These results suggested that the stimulation of hepatic heme oxygenase-1 expression by ascorbic acid deficiency caused the decrease in CYP content in liver.

  11. LASER-tissue interactions.

    PubMed

    Carroll, Lisa; Humphreys, Tatyana R

    2006-01-01

    As new laser devices continue to emerge, it becomes increasingly important for the clinical dermatologist to understand the basic principles behind their operation. A fundamental understanding of how lasers interact with tissue will enable the physician to choose the most appropriate laser for a given clinical situation. Although the physical laws guiding laser design are vastly complex, the fundamental principles of laser-tissue interaction can be summarized as they are applicable to the clinician.

  12. Mercury Bromide Laser Research.

    DTIC Science & Technology

    1981-05-04

    Discharge", Optics Lett., 2(3), (March 1978). 7. R. Burnham, "Discharge Pumped Mercuric Halide Dissociation Lasers", Appl. Phys. Lett., 33: 15 (July 1978...laser and fluorescence signals. Neutral density filters served to prevent saturation of the detector during the laser measurements. F. Laser Output as a...REFERENCES . E. J. Schimitschek and J. E. Celto, " Mercuric Bromide Dissociation Laser in an Electric Discharge," Optics Lett. 2(3), March 1978. This

  13. Surgical lasers in dermatology

    NASA Astrophysics Data System (ADS)

    Szymanczyk, Jacek; Nowakowski, Wlodzimierz; Golebiowska, Aleksandra; Michalska, I.; Mindak, Marek K.

    1997-10-01

    Almost every laser for medical applications was first tried in dermatology. The efficiency of YAG, CO2, and Argon lasers on this area and their potential advantages over conventional methods were mostly evaluated by cosmetic effect of laser therapy. The indications for different laser treatment in such dermatological cases as: angiomas, telangiectasias, pigmented lesions, nevus flammeus congenitus, deep cavernous angiomas, skin neoplasms and condylomata acuminata are discussed in this paper and the results of the laser therapy are also presented.

  14. Intracavity Raman lasers

    SciTech Connect

    Band, Y.B.; Ackerhalt, J.R.; Krasinski, J.S.; Heller, D.F.

    1989-02-01

    Experimental and theoretical studies of intracavity Raman lasers are presented. Advantages of intracavity Raman lasers, particularly for low-emission cross section and broadly tunable vibronic gain media, are described. Experimental studies of a hydrogen gas Raman laser pumped inside the cavity of an alexandrite laser are presented. A theoretical model of the dynamics of a unidirectional intracavity Raman ring laser is developed and solved analytically. This model is adapted to simulate experiments.

  15. Lasers used in dermatology.

    PubMed

    Lim, J T; Goh, C L

    1994-01-01

    This review introduces the various lasers available for the treatment of dermatological conditions. The applications of various lasers used in dermatology, including the carbon dioxide, argon, Q-switch Nd:YAG, ruby, dye and metal vapour lasers are discussed. We present our experience with the use of the carbon dioxide laser, flashlamp pulse-dye laser and Q-switch Nd:YAG laser in the National Skin Centre, Singapore. Our experience indicated that the lasers if used selectively are useful tools in the management of numerous skin disorders. The carbon dioxide laser is a versatile tool, useful for vaporizing or destroying skin lesions. The treatment of vascular or pigmented (melanin) lesions requires lasers that emit wavelengths corresponding to the absorption spectrum of haemoglobin or melanin respectively. Choosing the right laser gives optimal cosmetic result whereas the wrong lasers can lead to a less satisfactory result and even severe scarring. It is important to note that there is no single laser system that is versatile enough to be used to treat all skin disorders. To provide full coverage in the treatment of skin disorders, a laser centre has to be equipped with many different laser systems. This makes using lasers in the treatment of skin disorders very expensive.

  16. Laser communication system

    SciTech Connect

    Fredriksen, H.A.; Walter, R.K.; Mentzer, R.B.

    1987-04-28

    A laser communication system is described for transmission across an atmospheric link between a radio frequency source and a load comprising: a primary transmitter including a primary laser, a primary laser modulator connected to the primary laser and to a signal source, and a laser intensity control means connected to the laser for varying the primary laser intensity; a primary receiver located in the path of a beam from the primary laser; a haze comparator circuit connected to a primary photodetector means and comparing the electrical signal from the primary photodetector means to a standard signal to produce an output signal which indicates the sense and degree of difference between the two; a secondary laser located at the primary receiver location; secondary laser modulator circuit; a secondary laser control circuit; a secondary photodetector; a first control means connected to the secondary photodetector and the primary laser intensity control means; and an interconnection between the output of the haze comparator circuit and the secondary laser intensity control circuit so that the intensity of the output of the secondary laser is varied by the haze comparator in the same manner as is the intensity of the output of the primary laser.

  17. Development of the Zebra load region for increased capability plasma diagnostics and improved Leopard laser access

    NASA Astrophysics Data System (ADS)

    Astanovitskiy, Alexey; Presura, R.; Ivanov, V. V.; Haboub, A.; Plachaty, C.; Kindel, J. M.

    2008-11-01

    A new geometry for the load area in the Zebra (1MA pulse generator) is developed. It will form the basis for future experiments requiring Leopard (1057nm, 50TW laser) to Zebra coupling and give extended capability to z-pinch diagnostics. This required the development of a new current return, which allows laser access and installation of the OD 4'' parabolic mirror for the x-ray radiography, isochoric heating and magnetized plasma experiments, and accommodates wire-array z-pinch loads, to which the laser may then be coupled. In addition, this configuration allows diagnostics access close to the plasma, leading to a significant increase of the spatial resolution for imaging of z-pinches, as well as the photon flux in imaging and spectroscopy of laser produced plasmas. These diagnostics will allow coupling of the Leopard beam for x-ray laser probing of the pinch plasma and we will test point-projection x-ray backlighting of the pinch plasma.

  18. The effectiveness of laser diode induction to Carica Papaya L. chlorophyll extract to be ROS generating in the photodynamic inactivation mechanisms for C.albicans biofilms

    NASA Astrophysics Data System (ADS)

    Dewi Astuty, S.; Baktir, A.

    2017-05-01

    Research on the effectiveness of photo inactivation of C.albicans biofilms led by a-PDT system mediated by chlorophyll-diode-laser-induced was done. This research was done using in vitro technique in order to effectively determine chlorophyll extract of ROS-generated Carica Papaya L. using in situ technique. This technique induced laser diode on different dose and C. albicans with reduced degree. This research is a preliminary study in efforts to find anew sensitizer agent candidate made of chlorophyll extract and antifungal of Carica Papaya L. The effectiveness of eradication has been tested with MDA’s content and OD of biomass biofilms as well as analyzed using ANOVA and Tukey Test (α=0.05). The characteristic of chlorophyll extract of Carica Papaya L. has maximum absorptions on blue areas (λmax = 420 nm) and red areas (λmax = 670 nm). The MIC value of Carica Papaya L.’schlorophyll extract against C. albicans planktonic and biofilms cell is 63.8 μM and 31.9 μM respectively. The result shows that treatment using laser which was combined with chlorophyll extract is more effective than that with laser only or chlorophyll extract only. The treatment using laser combined with chlorophyll extract obtained more than 65% (α=0.05) (more than that of negative control) for P2L1 group with OD595 0.915. The MDA’s content showed that group of laser which was mediated with chlorophyll extract had larger values than group of laser or chlorophyll extract only.

  19. Tri-length laser therapy associated to tecar therapy in the treatment of low-back pain in adults: a preliminary report of a prospective case series.

    PubMed

    Osti, Raffaella; Pari, Carlotta; Salvatori, Giada; Massari, Leo

    2015-01-01

    Low-back pain is very frequent, especially in active adult population. There are several different orthopaedic condition that can cause low-back pain, and the pain worsen the quality of life significantly. The treatments vary from drugs, physical therapies, kinesiology, local infiltrations, and so on. Laser therapy has an important role in the treatment of the inflammatory causes of pain, with several studies that demonstrate the efficacy of low and high energy laser therapy in the treatment of low-back pain. Sixty-six consecutive patients with low-back pain with or without leg pain were treated using a combination of Tri-length laser I-Triax® (Mectronic Medicale, Bergamo, Italy) and Pharon® tecar therapy (Mectronic Medicale, Bergamo, Italy). The patients were treated three times a week, every other day, for a total of 10 sessions. Clinical results were evaluated using visual analogic scale for individual pain (0 to 10) and the Oswestry disability scale (ODS). Tests started before the beginning of therapies and 8 weeks after the end of the therapies. Visual analogic scale (VAS) score significantly improved from an average value of 8.1 ± 1.58 pre-treatment to an average value 8-weeks post-treatment of 2.63 ± 2.74 (P < .01). ODS values start from a pre-treatment average value of 53.0 ± 13.0 to a post-treatment average value of 23.5 ± 19.8 (P < .01). A higher improvement both in VAS and in ODS was denoted in the group of patient with low-back pain and leg pain (respectively, VAS from 8.66 ± 1.58 to 2.86 ± 2.94 and ODS from 57.8 ± 15.5 to 23.7 ± 19.5). Low-back pain, associated or not with leg pain, is a very common clinical situation. The treatments of this condition are different, and an important role can be given to the laser therapy. The conclusion of this study is that the association between laser therapy iLux-Triax® and tecar therapy Pharon® in the treatment of low-back pain, with or without leg pain, can

  20. Ceramic Laser Materials

    PubMed Central

    Sanghera, Jasbinder; Kim, Woohong; Villalobos, Guillermo; Shaw, Brandon; Baker, Colin; Frantz, Jesse; Sadowski, Bryan; Aggarwal, Ishwar

    2012-01-01

    Ceramic laser materials have come a long way since the first demonstration of lasing in 1964. Improvements in powder synthesis and ceramic sintering as well as novel ideas have led to notable achievements. These include the first Nd:yttrium aluminum garnet (YAG) ceramic laser in 1995, breaking the 1 KW mark in 2002 and then the remarkable demonstration of more than 100 KW output power from a YAG ceramic laser system in 2009. Additional developments have included highly doped microchip lasers, ultrashort pulse lasers, novel materials such as sesquioxides, fluoride ceramic lasers, selenide ceramic lasers in the 2 to 3 μm region, composite ceramic lasers for better thermal management, and single crystal lasers derived from polycrystalline ceramics. This paper highlights some of these notable achievements. PMID:28817044