Size of Human Figure Drawings as Influenced by Instructions for "Sexy" versus "Average" Drawings and by the Status of the Experimenter.

ERIC Educational Resources Information Center

Duffy, Karen G.; And Others

1982-01-01

Investigated the effects of experimenter status and sex and instructional set on the size of "sexy" and "average" human figure drawings by students. Results showed no effects for experimenter status or sex. "Sexy" drawings were consistently drawn larger than "average" drawings and male figures were drawn…

Emotional indicators in children's human figure drawings.

PubMed

Catte, M; Cox, M V

1999-06-01

The human figure drawings of a group of emotionally-disturbed boys were compared with those of a group of well-adjusted boys closely matched for chronological age and another for mental age. A comparison based on Koppitz's (1968) original emotional indicators and another, based on new UK norms, showed that the emotionally-disturbed children included significantly more indicators in their drawings than their well-adjusted peers. Although this difference was statistically significant it is actually quite small. In addition, there were no differences among the groups in the kinds of indicators they exhibited. The usefulness of the Koppitz test as a tool for clinical use is questioned.

The Relationship between Drawing and Oral Language in Deaf Students Aged Three to Five

ERIC Educational Resources Information Center

Silvestre, Nuria; Cambra, Cristina

2009-01-01

This study examines the relationship between drawing and oral language acquisition in deaf students aged three to five. The sample is made up of one hundred participants: fifty deaf and fifty hearing children. Goodenough's Human Figure Drawing Test and the WPPSI Scale of Intelligence geometric design subtest have been used to evaluate graphic…

Human figure drawings by children with Duchenne's muscular dystrophy.

PubMed

Pope-Grattan, M M; Burnett, C N; Wolfe, C V

1976-02-01

Seventy-two human figure drawings by forty-three patients who had a diagnosis of Duchenne's muscular dystrophy were examined. The study includes a description of these human figure drawings according to eleven emotional indicators and according to directionality quadrants. When the human figure drawings were used as a projective tool, four personality traits of some of the children were identified: physical inadequacy, immaturity, body anxiety, and insecurity. Both the emotional indicators and the quadrant in which the figures appeared were examined in relation to stages of the disease process to see if the human figure drawings of the children might reflect more stress and anxiety at a particular stage of the disease. Suggestions for improvements and recommendations for future study are given.

Validation study of human figure drawing test in a Colombian school children population.

PubMed

Vélez van Meerbeke, Alberto; Sandoval-Garcia, Carolina; Ibáñez, Milciades; Talero-Gutiérrez, Claudia; Fiallo, Dolly; Halliday, Karen

2011-05-01

The aim of this article was to assess the validity of the emotional and developmental components of the Koppitz human figure drawing test. 2420 children's drawings available in a database resulting from a previous cross sectional study designed to determine the prevalence of neurological diseases in children between 0 and 12 years old in Bogota schools were evaluated. They were scored using the criteria proposed by Koppitz, and classified into 16 groups according to age, gender, and presence/absence of learning or attention problems. The overall results were then compared with the normative study to assess whether descriptive parameters of the two populations were significantly different. There were no significant differences associated with presence/absence of learning and attention disorders or school attended within the overall sample. An Interrater reliability test has been made to assure the homogeneity of scoring by the evaluator team. There were significant differences between this population and that of the original study. New scoring tables contextualized for our population based on the frequency of appearance in this sample are presented. We can conclude that various ethnic, social, and cultural factors can influence the way children draw the human figure. It is thus important to establish local reference values to adequately distinguish between normality and abnormality. The new scoring tables proposed here should be followed up with a clinical study to corroborate their validity.

Human figure drawings in the evaluation of severe adolescent suicidal behavior.

PubMed

Zalsman, G; Netanel, R; Fischel, T; Freudenstein, O; Landau, E; Orbach, I; Weizman, A; Pfeffer, C R; Apter, A

2000-08-01

To evaluate the reliability of using certain indicators derived from human figure drawings to distinguish between suicidal and nonsuicidal adolescents. Ninety consecutive admissions to an adolescent inpatient unit were assessed. Thirty-nine patients were admitted because of suicidal behavior and 51 for other reasons. All subjects were given the Human Figure Drawing (HFD) test. HFD was evaluated according to the method of Pfeffer and Richman, and the degree of suicidal behavior was rated by the Child Suicide Potential Scale. The internal reliability was satisfactory. HFD indicators correlated significantly with quantitative measures of suicidal behavior; of these indicators specifically, overall impression of the evaluator enabled the prediction of suicidal behavior and the distinction between suicidal and nonsuicidal inpatients (p < .001). A group of graphic indicators derived from a discriminant analysis formed a function, which was able to identify 84.6% of the suicidal and 76.6% of the nonsuicidal adolescents correctly. Many of the items had a regressive quality. The HFD is an example of a simple projective test that may have empirical reliability. It may be useful for the assessment of severe suicidal behavior in adolescents.

[Neuropsychiatric background of severe drawing disturbances].

PubMed

Molnár, Gábor

2008-01-01

Drawing ability is a primary human skill, which first appeared in the paleolithic art. In spite of this fact, neuropsychology of drawing has been a neglected subject of brain research. In the Crisis Intervention Department at the Budapest Social Center (Hungary), five patients with local brain lesions were identified, who had severe drawing disturbances. This was defined when the form representation in the House-Tree-Person drawing test was was not maintained and was associated with altered figure-perception. Patients were underwent detailed neurological, mental and neuropsychological assessment. Computer tomography of the head was performed at different hospitals in Budapest. House-Tree-Person drawing test was used, which was complemented with copy and visual memory tasks (with Rey-picture), as well as with spontaneous drawing, if it was necessary. Severe drawing disturbances were found in patients with severe right frontal, right temporo-parietal, diffuse right fronto-parieto-temporal, left occipito-temporal lesions and with bilateral basal ganglia lesions with enlarged ventriculi. Impairment of copying figures was sometimes seen without associated impairment of drawing on verbal instructions. Visual memory, visual images in long-term memory, visual analysis, the ability of adequat placement of parts into the whole representation, visuomotor transfer and perhaps the motor drawing programs could be altered separately. Severe drawing disturbance might occur with perfectly maintained writing capabilities. The data indicated that drawing ability requires the intact activity of nearly the whole brain, but it also includes several subfunctions, which could be altered relatively separately.

40 CFR 86.884-9 - Smoke measurement system.

Code of Federal Regulations, 2014 CFR

2014-07-01

...) Schematic drawing. The Figure I84-1 is a schematic drawing of the optical system of the light extinction... the exhaust from the test site. (2) Smokemeter (light extinction meter)—continuous recording, full...) Light extinction meters employing substantially identical measurement principles and producing...

[Description and evaluation of creative thinking in preterm low birth weight infants].

PubMed

Parisi, L; Di Filippo, T; Firrigno, L; La Grutta, S; Testa, D; Roccella, M

2007-04-01

Since the 1950s, the problem of how to evaluate creativity has been addressed in studies on the definition of measurement criteria and on the relationship between intelligence and creative thinking. Many revealed cognitive and relational disorders in preterm infants, particularly in preterm very low birth weight infants (birth weight <1500 g) and in infants with serious complications. This study describes the development of creative thinking in a group of children born preterm. The study sample was 43 children (21 males, 22 females; age range 6-11 years), regularly attending school, born with low birth weight (1050-2450 g) at 29-32 weeks gestational age, and compared with a control group with birth weight >2500 g. The test battery included: Torrance Test of Creative Thinking (TCTT); WISC-R intelligence test; Goodenough Human Figure Drawing Test. Statistical analysis (Mann-Whitney U test) showed a statistically significant difference (P>0.05) between the 2 groups; scores for figure originality, figure fluidity and figure elaboration were consistently higher in the control group. Within the low birth weight group, there was a significant correlation (Spearman r) between verbal IQ and verbal fluidity and verbal flexibility subscale scores and between IQ performance and figure elaboration. Scores on the figure drawing tests showed higher creative ability in the control group. In children born preterm with low birth weight, emotive dynamics and flow of affection may influence the channels of communication between child and family. The low figure originality subscale scores support the hypothesis that psychodynamic and relational factors (worry about the preterm condition, overprotective behaviour by parents and others) could lead to diminished autonomy, flexibility and manipulatory interest in the child.

Brief report: human figure drawings by children with Asperger's syndrome.

PubMed

Lim, Hui Keow; Slaughter, Virginia

2008-05-01

Twenty-nine children with Asperger's syndrome and 28 typically developing children, matched on gender, chronological age and nonverbal IQ, were asked to produce a free drawing, then requested to draw a person, a house and a tree. The drawings were scored using standardized procedures for assessing accuracy, detail and complexity. There were no differences between the diagnostic groups on the tree or house drawing scores. The human figure drawing scores of children with Asperger's syndrome were significantly lower than those of the typically developing children, and there was a positive correlation between human figure drawing scores and communication sub-scores on the Vineland Adaptive Behaviour Scales, for the Asperger's group. These results suggest that the selective deficit in generating human figure representations may derive from a relative lack of interest in the social world, and/or limited practice in drawing people.

Quality of Drawing as a Factor in the Interpretation of Figure Drawings.

ERIC Educational Resources Information Center

Johnson, Frank A.; Greenberg, Roger P.

1978-01-01

The drawings of 32 poliomyelitis patients and their matched controls were examined to see whether figure drawings primarily reflect the subject's projection of psychological state, ability to draw, or some combination of these two factors. Quality of drawing may at times be the overwhelming determinant of clinical and research findings.…

Human Figure Drawings: Abusing the Abused.

ERIC Educational Resources Information Center

Bardos, Achilles N.

1993-01-01

Responds to previous article (Motta, Little, and Tobin, this issue) which reviewed data-based studies on figure drawings and found little support for their validity or use in assessing personality, behavior, emotion, or intellectual functioning. Notes recent approaches to interpretation of human figure drawings and cites flaws in argument against…

The Use and Abuse of Human Figure Drawings.

ERIC Educational Resources Information Center

Motta, Robert W.; And Others

1993-01-01

Notes widespread use of human figure drawings to describe and predict psychological functioning. Reviews data-based studies on figure drawings and concludes that there is little support for their validity or for their use as devices to assess personality, behavior, emotion, or intellectual functioning. Presents ease of administration and anecdotal…

Figure Structure, Figure Action, and Framing in Drawings by American and Egyptian Children.

ERIC Educational Resources Information Center

Wilson, Brent; Wilson, Marjorie

1979-01-01

The purpose of this study is to investigate the interaction of biological unfolding and culturally related factors on sequences of narrative figure drawings by American and Egyptian elementary students. Findings support hypotheses relating to the interaction of natural and nurtural influences on children's drawings. (Author/SJL)

A Cross-Continental Study on Children's Drawings of Football Players: Implications for Understanding Key Issues and Controversies in Human Figure Drawings.

PubMed

Baluch, Bahman; Duffy, Linda J; Badami, Rokhsareh; Pereira, Elisangela C Ap

2017-08-01

Professionals examine various aspects of girls' and boys' drawings as a way of understanding their intelligence, personality and emotional state. However, the extent to which such measures could be universally generalised or attributed to a specific cultural norm is still a debatable issue. In the present study five key features of children's drawings namely: the size (height) of the drawings, profile or full face, figure in action or static, shaded or non-shaded and the nature of additional details were examined from a cross-cultural perspective, and by providing a topic (football) for which children's drawing of a human figure could provide opportunities for the latter indices to manifest and flourish. Children from three countries; England, Iran and Brazil, representing three continents took part in this study. The participants were asked to draw a football player from their own country and from the other participating countries. The results showed that Brazilian children differ from Iranian and English children by drawing significantly smaller figures and putting more football action in the drawings. Shading of the figure drawn was more prevalent amongst English children. Such findings have implications for the interpretation of key aspects of children's drawings in educational, clinical and therapeutic settings and from a universal vs. culturally-specific viewpoint.

Do Human-Figure Drawings of Children and Adolescents Mirror Their Cognitive Style and Self-Esteem?

ERIC Educational Resources Information Center

Dey, Anindita; Ghosh, Paromita

2016-01-01

The investigation probed relationships among human-figure drawing, field-dependent-independent cognitive style and self-esteem of 10-15 year olds. It also attempted to predict human-figure drawing scores of participants based on their field-dependence-independence and self-esteem. Area, stratified and multi-stage random sampling were used to…

49 CFR 572.75 - Lumbar spine, abdomen, and pelvis assembly and test procedure.

Code of Federal Regulations, 2012 CFR

2012-10-01

... specified in Figure 42. (2) Adjust the dummy by— (i) Tightening the femur ballflange screws at each hip socket joint to 50 inch-pounds torque; (ii) Attaching the pelvis to the seating surface by a bolt D/605... drawing Figure 42. (iv) Tightening the mountings so that the pelvis-lumbar joining surface is horizontal...

49 CFR 572.75 - Lumbar spine, abdomen, and pelvis assembly and test procedure.

Code of Federal Regulations, 2013 CFR

2013-10-01

... specified in Figure 42. (2) Adjust the dummy by— (i) Tightening the femur ballflange screws at each hip socket joint to 50 inch-pounds torque; (ii) Attaching the pelvis to the seating surface by a bolt D/605... drawing Figure 42. (iv) Tightening the mountings so that the pelvis-lumbar joining surface is horizontal...

49 CFR 572.75 - Lumbar spine, abdomen, and pelvis assembly and test procedure.

Code of Federal Regulations, 2010 CFR

2010-10-01

... specified in Figure 42. (2) Adjust the dummy by— (i) Tightening the femur ballflange screws at each hip socket joint to 50 inch-pounds torque; (ii) Attaching the pelvis to the seating surface by a bolt D/605... drawing Figure 42. (iv) Tightening the mountings so that the pelvis-lumbar joining surface is horizontal...

49 CFR 572.75 - Lumbar spine, abdomen, and pelvis assembly and test procedure.

Code of Federal Regulations, 2011 CFR

2011-10-01

... specified in Figure 42. (2) Adjust the dummy by— (i) Tightening the femur ballflange screws at each hip socket joint to 50 inch-pounds torque; (ii) Attaching the pelvis to the seating surface by a bolt D/605... drawing Figure 42. (iv) Tightening the mountings so that the pelvis-lumbar joining surface is horizontal...

49 CFR 572.75 - Lumbar spine, abdomen, and pelvis assembly and test procedure.

Code of Federal Regulations, 2014 CFR

2014-10-01

... specified in Figure 42. (2) Adjust the dummy by— (i) Tightening the femur ballflange screws at each hip socket joint to 50 inch-pounds torque; (ii) Attaching the pelvis to the seating surface by a bolt D/605... drawing Figure 42. (iv) Tightening the mountings so that the pelvis-lumbar joining surface is horizontal...

A Cross-Continental Study on Children's Drawings of Football Players: Implications for Understanding Key Issues and Controversies in Human Figure Drawings

PubMed Central

Baluch, Bahman; Duffy, Linda J.; Badami, Rokhsareh; Pereira, Elisangela C. Ap

2017-01-01

Professionals examine various aspects of girls’ and boys’ drawings as a way of understanding their intelligence, personality and emotional state. However, the extent to which such measures could be universally generalised or attributed to a specific cultural norm is still a debatable issue. In the present study five key features of children’s drawings namely: the size (height) of the drawings, profile or full face, figure in action or static, shaded or non-shaded and the nature of additional details were examined from a cross-cultural perspective, and by providing a topic (football) for which children’s drawing of a human figure could provide opportunities for the latter indices to manifest and flourish. Children from three countries; England, Iran and Brazil, representing three continents took part in this study. The participants were asked to draw a football player from their own country and from the other participating countries. The results showed that Brazilian children differ from Iranian and English children by drawing significantly smaller figures and putting more football action in the drawings. Shading of the figure drawn was more prevalent amongst English children. Such findings have implications for the interpretation of key aspects of children's drawings in educational, clinical and therapeutic settings and from a universal vs. culturally-specific viewpoint. PMID:28904595

Drawing a Close to the Use of Human Figure Drawings as a Projective Measure of Intelligence

PubMed Central

Imuta, Kana; Scarf, Damian; Pharo, Henry; Hayne, Harlene

2013-01-01

The practice of using children's human figure drawings (HFDs) to assess their intellectual ability is pervasive among psychologists and therapists in many countries. Since the first systematic scoring system for HFDs was published in 1926, their continued popularity has led to the development of several revised versions of the test. Most recently, the Draw-A-Person Intellectual Ability Test for children, adolescents, and adults (DAP:IQ) was published. It is the most up-to-date form of HFD test designed to assess intellectual functioning across a wide age range. In the present study, we assessed the validity of the DAP:IQ as a screening measure of intelligence in both children and adults. In Experiment 1, 100 4- to 5-year-old children completed the DAP:IQ and the Wechsler Preschool and Primary Scale of Intelligence-Third Edition. In Experiment 2, 100 adults completed the DAP:IQ and the Wechsler Abbreviated Scale of Intelligence. In both experiments, we found only weak to modest correlations between scores on the DAP:IQ and the Wechsler tests. Furthermore, when we compared individual's scores on the two tests, the DAP:IQ yielded high false positive and false negative rates when screening for borderline and superior intellectual functioning. Based on these findings, and based on the lack of validity of previous HFD tests, we conclude that practitioners should not rely on HFD tests as a projective measure of intelligence. PMID:23516590

Drawing a close to the use of human figure drawings as a projective measure of intelligence.

PubMed

Imuta, Kana; Scarf, Damian; Pharo, Henry; Hayne, Harlene

2013-01-01

The practice of using children's human figure drawings (HFDs) to assess their intellectual ability is pervasive among psychologists and therapists in many countries. Since the first systematic scoring system for HFDs was published in 1926, their continued popularity has led to the development of several revised versions of the test. Most recently, the Draw-A-Person Intellectual Ability Test for children, adolescents, and adults (DAP:IQ) was published. It is the most up-to-date form of HFD test designed to assess intellectual functioning across a wide age range. In the present study, we assessed the validity of the DAP:IQ as a screening measure of intelligence in both children and adults. In Experiment 1, 100 4- to 5-year-old children completed the DAP:IQ and the Wechsler Preschool and Primary Scale of Intelligence-Third Edition. In Experiment 2, 100 adults completed the DAP:IQ and the Wechsler Abbreviated Scale of Intelligence. In both experiments, we found only weak to modest correlations between scores on the DAP:IQ and the Wechsler tests. Furthermore, when we compared individual's scores on the two tests, the DAP:IQ yielded high false positive and false negative rates when screening for borderline and superior intellectual functioning. Based on these findings, and based on the lack of validity of previous HFD tests, we conclude that practitioners should not rely on HFD tests as a projective measure of intelligence.

Characterizing Spatial Ability: Different Mental Processes Reflected in Accuracy and Latency Scores.

DTIC Science & Technology

1978-08-01

Prince- ton, New Jersey: Educational Testing Service, March, 1969. 6. Guilford, J. P., The Nature of Human Intelligence . New York: McGraw- Hill, 1969. 7...of visual- figural systems (CFS-V) , cognition of figural transformations (CFT), and cogni- tion of kinesthetic -figural systems (CFS-K) , represents...position and direction that has occurred from the top to the bottom drawing of a motorboat heading toward a coastline. The time limit on the 60-item GZO is

Cognitive predictors of copying and drawing from memory of the Rey-Osterrieth complex figure in 7- to 10-year-old children.

PubMed

Senese, Vincenzo Paolo; De Lucia, Natascia; Conson, Massimiliano

2015-01-01

Cognitive models of drawing are mainly based on assessment of copying performance of adults, whereas only a few studies have verified these models in young children. Moreover, developmental investigations have only rarely performed a systematic examination of the contribution of perceptual and representational visuo-spatial processes to copying and drawing from memory. In this study we investigated the role of visual perception and mental representation in both copying and drawing from memory skills in a sample of 227 typically developing children (53% females) aged 7-10 years. Participants underwent a neuropsychological assessment and the Rey-Osterrieth Complex Figure (ROCF). The fit and invariance of the predictive model considering visuo-spatial abilities, working memory, and executive functions were tested by means of hierarchical regressions and path analysis. Results showed that, in a gender invariant way, visual perception abilities and spatial mental representation had a direct effect on copying performance, whereas copying performance was the only specific predictor for drawing from memory. These effects were independent from age and socioeconomic status, and showed that cognitive models of drawing built up for adults could be considered for predicting copying and drawing from memory in children.

Perseveration Found in a Human Drawing Task: Six-Fingered Hands Drawn by Patients with Right Anterior Insula and Operculum Damage

PubMed Central

Niki, Chiharu; Maruyama, Takashi; Muragaki, Yoshihiro; Kumada, Takatsune

2014-01-01

Background. Perseveration has been observed in a number of behavioural contexts, including speaking, writing, and drawing. However, no previous report describes patients who show perseveration only for drawing a human figure. Objective. The present report describes a group of patients who show body awareness-related cognitive impairment during a human figure drawing task, a different presentation from previously described neuropsychological cases. Methods. Participants were 15 patients who had a frontal lobe brain tumour around the insula cortex of the right hemisphere and had subsequently undergone a neurosurgical resective operation. Participants were asked to draw a human figure in both “hands-down” and “hands-up” configurations. Results. Eight of the 15 patients drew a human figure with six fingers during the “hands-up” and the “hands-down” human figure drawing tasks (one patient drew eight fingers). A statistical analysis of potential lesion areas revealed damage to the right anterior frontal insula and operculum in this group of patients relative to the five-finger drawing group. Conclusions. Our findings reveal a newly described neuropsychological phenomenon that could reflect impairment in attention directed towards body representations. PMID:24876665

Preschool Drawing and School Mathematics: The Nature of the Association

ERIC Educational Resources Information Center

Malanchini, Margherita; Tosto, Maria G.; Garfield, Victoria; Dirik, Aysegul; Czerwik, Adrian; Arden, Rosalind; Malykh, Sergey; Kovas, Yulia

2016-01-01

The study examined the etiology of individual differences in early drawing and of its longitudinal association with school mathematics. Participants (N = 14,760), members of the Twins Early Development Study, were assessed on their ability to draw a human figure, including number of features, symmetry, and proportionality. Human figure drawing was…

Supportive or suggestive: Do human figure drawings help 5- to 7-year-old children to report touch?

PubMed

Brown, Deirdre A; Pipe, Margaret-Ellen; Lewis, Charlie; Lamb, Michael E; Orbach, Yael

2007-02-01

The authors examined the accuracy of information elicited from seventy-nine 5- to 7-year-old children about a staged event that included physical contact-touching. Four to six weeks later, children's recall for the event was assessed using an interview protocol analogous to those used in forensic investigations with children. Following the verbal interview, children were asked about touch when provided with human figure drawings (drawings only), following practice using the human figure drawings (drawings with instruction), or without drawings (verbal questions only). In this touch-inquiry phase of the interview, most children provided new information. Children in the drawings conditions reported more incorrect information than those in the verbal questions condition. Forensically relevant errors were infrequent and were rarely elaborated on. Although asking children to talk about innocuous touch may lead them to report unreliable information, especially when human figure drawings are used as aids, errors are reduced when open-ended prompts are used to elicit further information about reported touches. Copyright 2007 APA, all rights reserved.

[Drawing of the family and of the human figure: a comparative study between children with epilepsy and a control group].

PubMed

Gomes-Correia, A

In this study our aim was to get to know children with epilepsy through their drawings. In this case the drawings of the human figure and the family were chosen. The population which was studied included 32 children: 16 of these children had epilepsy and the 16 others were the control group. From the comparison performed between these two groups of children it was found that in relation to family drawings children with epilepsy tend more to draw their own family than children in the control group. As for the drawing of the human figure and the global analysis of the body figure it was found that the mental age of the isolated character and the higher level character drawn by epileptic children was inferior to chronological age, while the reverse was true in the drawings of the control group. In relation to the analysis of structural cohesion in the representation of the body it was found that hands were absent in the drawings of epileptic children.

Genes influence young children's human figure drawings and their association with intelligence a decade later.

PubMed

Arden, Rosalind; Trzaskowski, Maciej; Garfield, Victoria; Plomin, Robert

2014-10-01

Drawing is ancient; it is the only childhood cognitive behavior for which there is any direct evidence from the Upper Paleolithic. Do genes influence individual differences in this species-typical behavior, and is drawing related to intelligence (g) in modern children? We report on the first genetically informative study of children's figure drawing. In a study of 7,752 pairs of twins, we found that genetic differences exert a greater influence on children's figure drawing at age 4 than do between-family environmental differences. Figure drawing was as heritable as g at age 4 (heritability of .29 for both). Drawing scores at age 4 correlated significantly with g at age 4 (r = .33, p < .001, n = 14,050) and with g at age 14 (r = .20, p < .001, n = 4,622). The genetic correlation between drawing at age 4 and g at age 14 was .52, 95% confidence interval = [.31, .75]. Individual differences in this widespread behavior have an important genetic component and a significant genetic link with g. © The Author(s) 2014.

Quantitative assessment of drawing tests in children with dyslexia and dysgraphia.

PubMed

Galli, Manuela; Cimolin, Veronica; Stella, Giacomo; De Pandis, Maria Francesca; Ancillao, Andrea; Condoluci, Claudia

2018-05-07

Drawing tests in children diagnosed with dyslexia and dysgraphia were quantitatively compared. Fourteen children with dysgraphia, 19 with dyslexia and 13 normally developing were asked to copy 3 figures: a circle, a square and a cross. An optoelectronic system allowed the acquisition of the drawing track in three-dimensions. The participants' head position and upper limb movements were measured as well. A set of parameters including movement duration, velocity, length of the trace, Range of Motion of the upper limb, was computed and compared among the 3 groups. Children with dyslexia traced the circle faster than the other groups. In the cross test, dyslexic participants showed a reduced execution time and increased velocity while drawing the horizontal line. Children with dyslexia were also faster in drawing certain sides of square with respect to the other groups. Copyright © 2018 Elsevier B.V. All rights reserved.

How Does Sam Feel?: Children's Labelling and Drawing of Basic Emotions

ERIC Educational Resources Information Center

Brechet, Claire; Baldy, Rene; Picard, Delphine

2009-01-01

This study compares the ability of children aged from 6 to 11 to freely produce emotional labels based on detailed scenarios (labelling task), and their ability to depict basic emotions in their human figure drawing (subsequent drawing task). This comparison assesses the relevance of the use of a human figure drawing task in order to test…

School-age children's fears, anxiety, and human figure drawings.

PubMed

Carroll, M K; Ryan-Wenger, N A

1999-01-01

The purpose of this study was to identify the fears of school-age children and determine the relationship between fear and anxiety. A descriptive, correlational, secondary analysis study was conducted using a convenience sample of 90 children between the ages of 8 and 12 years. Each child was instructed to complete the Revised Children's Anxiety Scale and then answer questions from a structured interview. On completion, each child was instructed to draw a human figure drawing. Frequency charts and correlational statistics were used to analyze the data. Findings indicated that the most significant fears of the boys were in the categories of animals, safety, school, and supernatural phenomena, whereas girls were more fearful of natural phenomena. High correlations existed between anxiety scores and the number of fears and emotional indicators on human figure drawings. Because human figure drawings are reliable tools for assessing anxiety and fears in children, practitioners should incorporate these drawings as part of their routine assessments of fearful children.

Human figure drawings as a measure of children's emotional status: critical review for practice.

PubMed

Skybo, Theresa; Ryan-Wenger, Nancy; Su, Ying-Hwa

2007-02-01

Human figure drawing is a common measurement that is used in practice and research. Drawing is a fun, inexpensive, and easy-to-administer method used to provide school-age children a projective means of expressing attitudes and emotions. As cognition matures, the content of drawing develops. The inclusion of emotional indicators in drawing signifies possible emotional problems. Recently, drawing has been used in countries and cultures other than the United States. Drawing can be implemented in any setting by all health care professionals.

Drawing experts have better visual memory while drawing.

PubMed

Perdreau, Florian; Cavanagh, Patrick

2015-01-01

Drawing involves frequent shifts of gaze between the original and the drawing and visual memory helps compare the original object and the drawing across these gaze shifts while creating and correcting the drawing. It remains unclear whether this memory encodes all of the object or only the features around the current drawing position and whether both the original and the copy are equally well represented. To address these questions, we designed a "drawing" experiment coupled with a change detection task. A polygon was displayed on one screen and participants had to copy it on another, with the original and the drawing presented in alternation. At unpredictable moments during the copying process, modifications were made on the drawing and the original figure (while they were not in view). Participants had to correct their drawing every time they perceived a change so that their drawing always matched the current original figure. Our results show a better memory representation of the original figure than of the drawing, with locations relevant to the current production most accurately represented. Critically, experts showed better memory for both the original and the drawing than did novices, suggesting that experts have specialized advantages for encoding visual shapes.

Girls in detail, boys in shape: gender differences when drawing cubes in depth.

PubMed

Lange-Küttner, C; Ebersbach, M

2013-08-01

The current study tested gender differences in the developmental transition from drawing cubes in two- versus three dimensions (3D), and investigated the underlying spatial abilities. Six- to nine-year-old children (N = 97) drew two occluding model cubes and solved several other spatial tasks. Girls more often unfolded the various sides of the cubes into a layout, also called diagrammatic cube drawing (object design detail). In girls, the best predictor for drawing the cubes was Mental Rotation Test (MRT) accuracy. In contrast, boys were more likely to preserve the optical appearance of the cube array. Their drawing in 3D was best predicted by MRT reaction time and the Embedded Figures Test (EFT). This confirmed boys' stronger focus on the contours of an object silhouette (object shape). It is discussed whether the two gender-specific approaches to drawing in three dimensions reflect two sides of the appearance-reality distinction in drawing, that is graphic syntax of object design features versus visual perception of projective space. © 2012 The British Psychological Society.

Child and Adult Reports of Graphic Strategies Used to Portray Figures with Contrasting Emotional Characteristics

ERIC Educational Resources Information Center

Burkitt, Esther; Barrett, Martyn

2010-01-01

This study assessed children's graphic flexibility and their ability to report on their use of drawing strategies when drawing characterized figures. 253 children (129 boys, 124 girls) aged between 4 years 3 months and 11 year 10 months formed three groups, either drawing a man, a dog or a tree. Each group was asked to draw three emotionally…

Calm, Cool, and Comfortable in Clay

ERIC Educational Resources Information Center

Stylianou, Xanthippi Cynthia

2010-01-01

The author's fourth-grade students had just finished a drawing unit that focused on the human figure. Projects included charcoal gesture drawings and chalk manikin drawings in chiaroscuro. She wanted to integrate a new medium for students to continue their study of the human figure. Since students are always excited to work with clay, making clay…

Self-Esteem and Children's Human Figure Drawings

ERIC Educational Resources Information Center

Dalby, J. Thomas; Vale, Helen L.

1977-01-01

One hundred and fifteen students in Grade 5 made human figure drawings which were compared with their scores on the Coopersmith Self-esteem Inventory and on teachers' ratings of the students' self-esteem. (Author)

Drawing Dynamic Geometry Figures Online with Natural Language for Junior High School Geometry

ERIC Educational Resources Information Center

Wong, Wing-Kwong; Yin, Sheng-Kai; Yang, Chang-Zhe

2012-01-01

This paper presents a tool for drawing dynamic geometric figures by understanding the texts of geometry problems. With the tool, teachers and students can construct dynamic geometric figures on a web page by inputting a geometry problem in natural language. First we need to build the knowledge base for understanding geometry problems. With the…

Relative Heights of Males and Females in Children's Drawings.

ERIC Educational Resources Information Center

Cox, Maureen V.; Wright, Rebekah

2000-01-01

Examined in two studies the height of male and female figures in 5- and 7-year-olds' drawings. Found that adult figures were drawn taller than child figures. For boys, mean male and female heights were approximately the same. Girls drew females taller than males because more girls used different structures such as incorporating a skirt or trousers…

The Moving Figure: In Search of a Personal Artistic Vision through Life Drawing

ERIC Educational Resources Information Center

Zourntos, Ted

2013-01-01

"The Moving Figure" unit of study examines the relationship between observation, expression, and memory drawing techniques with second year college-level Illustration students. The goal of the exercises is to foster the development of a personal artistic voice in drawing by asking the students to directly place themselves in-situ within…

Examining Social Perceptions between Arab and Jewish Children through Human Figure Drawings

ERIC Educational Resources Information Center

Yedidia, Tova; Lipschitz-Elchawi, Rachel

2012-01-01

This study examined social perceptions among 191 Arab and Jewish children who live in mixed neighborhoods in Israel. Human Figure Drawing assessment was used to examine the children's social perceptions. The drawings that the Jewish Israeli children created portrayed Arabs as the enemy, whereas the Arab Israeli children expressed a more positive…

The stigmatization of obesity among Gypsy and Hungarian children.

PubMed

Papp, Ildikó; Túry, Ferenc

2013-06-01

Prejudice against obese people has been widely confirmed in scientific papers. Therefore, recent studies have increasingly focused on investigating the individual and cultural factors related to attitudes towards obesity. Since there have been no comparative studies involving Gypsy people, our present research aimed at exploring the possible discrepancies in children's attitudes towards obese children between Gypsy and Hungarian cultures. Our survey included 247 children aged 9-16 (108 boys and 139 girls), of which 136 considered themselves Hungarian (55.1 %), while 111 children (44.9 %) claimed themselves as Gypsy. The subjects were asked to rank six male and six female figure drawings according to their preference. Each sequence of figure drawings included a healthy child, an obese child, and four drawings depicted children with disabilities. According to our results, the drawings portraying the healthy child figure were rated most preferable and those portraying the obese child figure the least preferable amongst the subjects regardless of gender and origin. However, the obese girl figures and boy figures were rated significantly more positively by Gypsy children than Hungarian children. Our results suggest that there is a difference in attitude towards obesity among Gypsy and Hungarian children. Therefore, it is worthwhile to further explore this phenomenon.

Figure Drawing as an Expression of Self-Esteem

ERIC Educational Resources Information Center

Coopersmith, Stanley; And Others

1976-01-01

Results of the study show that several features of figure drawing identify the children who differ in self esteem. These differentiating features are associated with behavioral expressions of esteem rather than with self-appraisals of personal worth. (Author/DEP)

A functional magnetic resonance imaging study of the body schema using full human line-drawing figures in an on-line verbal naming and localization task of single body part words.

PubMed

McCrea, Simon M

2007-06-18

Naming and localization of individual body part words to a high-resolution line drawing of a full human figure was tested in a mixed-sex sample of nine right handed subjects. Activation within the superior medial left parietal cortex and bilateral dorsolateral cortex was consistent with involvement of the body schema which is a dynamic postural self-representation coding and combining sensory afference and motor efference inputs/outputs that is automatic and nonconscious. Additional activation of the left rostral occipitotemporal cortex was consistent with involvement of the neural correlates of the verbalizable body structural description that encodes semantic and categorical representations to animate objects such as full human figures. The results point to a highly distributed cortical representation for the encoding and manipulation of body part information and highlight the need for the incorporation of more ecologically valid measures of body schema coding in future functional neuroimaging studies.

Preschool Drawing and School Mathematics: The Nature of the Association

PubMed Central

Malanchini, M.; Tosto, M.G.; Garfield, V.; Czerwik, A.; Dirik, A.; Arden, R.; Malykh, S.

2016-01-01

The study examined the aetiology of individual differences in early drawing and of its longitudinal association with school mathematics. Participants (N = 14,760), members of the Twins Early Development Study, were assessed on their ability to draw a human figure, including number of features, symmetry and proportionality. Human figure drawing was moderately stable across six months (average r = .40). Individual differences in drawing at age 4½ were influenced by genetic (.21), shared environmental (.30) and non-shared environmental (.49) factors. Drawing was related to later (age 12) mathematical ability (average r = .24). This association was explained by genetic and shared environmental factors that also influenced general intelligence. Some genetic factors, unrelated to intelligence, also contributed to individual differences in drawing. PMID:27079561

Planning Ahead: Influence of Figure Orientation on Size of Head in Children's Drawings of a Man.

ERIC Educational Resources Information Center

Willatts, Peter; Dougal, Shonagh

In an investigation of causes of the disproportionate relation between head and body in children's drawings of the human figure, 160 children of 3-10 years of age produced drawings of a man viewed from the front and from the back. It was expected that if planning to include facial features increased the size of the head children drew, then heads…

Human Figure Drawings in Perspective.

ERIC Educational Resources Information Center

Naglieri, Jack A.

1993-01-01

Responds to previous article (Motta, Little, and Tobin, this issue) which reviewed data-based studies on figure drawings and found little support for their validity or use in assessing personality, behavior, emotion, or intellectual functioning. Contends that article is unacceptable for publication in present form, with main criticism being that…

Fading-Figure Tracing in Williams Syndrome

ERIC Educational Resources Information Center

Nagai, Chiyoko; Inui, Toshio; Iwata, Makoto

2011-01-01

Williams syndrome (WS) is a neurodevelopmental disorder characterized by severe impairment of visuospatial abilities. Figure-drawing abilities, which are thought to reflect visuospatial abilities, have yet to be fully investigated in WS. The purpose of the present study was to clarify whether drawing abilities differ between WS individuals and…

Art and the Special Child: Nine Case Studies.

ERIC Educational Resources Information Center

Brown, Eleese V.

1983-01-01

Nine special needs children who had been mainstreamed into regular classrooms were asked to draw a man and make a clay figure of a man. All but two of the children performed at the level of students of comparable mental age. Their clay figures were less sophisticated than their drawings. (IS)

Hooke's figurations: a figural drawing attributed to Robert Hooke.

PubMed

Hunter, Matthew C

2010-09-20

The experimental philosopher Robert Hooke (1635-1703) is known to have apprenticed to the leading painter Peter Lely on his first arrival in London in the late 1640s. Yet the relevance of Hooke's artistic training to his mature draughtsmanship and identity has remained unclear. Shedding light on that larger interpretive problem, this article argues for the attribution to Hooke of a figural drawing now in Tate Britain (T10678). This attributed drawing is especially interesting because it depicts human subjects and bears Hooke's name functioning as an artistic signature, both highly unusual features for his draughtsmanship. From evidence of how this drawing was collected and physically placed alongside images by leading artists in the early eighteenth century, I suggest how it can offer new insight into the reception of Hooke and his graphic work in the early Enlightenment.

The Draw-A-Person Test: an indicator of children's cognitive and socioemotional adaptation?

PubMed

ter Laak, J; de Goede, M; Aleva, A; van Rijswijk, P

2005-03-01

The authors examined aspects of reliability and validity of the Goodenough-Harris Draw-A-Person Test (DAP; D. B. Harris, 1963). The participants were 115 seven- to nine-year-old students attending regular or special education schools. Three judges, with a modest degree of training similar to that found among practicing clinicians, rated the students' human figure drawings on developmental and personality variables. The authors found that counting details and determining developmental level in the DAP test could be carried out reliably by judges with limited experience. However, the reliability of judgments of children's social and emotional development and personality was insufficient. Older students and students attending regular schools received significantly higher scores than did younger students or students attending special education schools. The authors found that the success of the DAP test as an indicator of cognitive level, socioemotional development, and personality is limited when global judgments are used. The authors concluded that more specific, reliable, valid, and useful scoring systems are needed for the DAP test.

Pictionary-based fMRI paradigm to study the neural correlates of spontaneous improvisation and figural creativity.

PubMed

Saggar, Manish; Quintin, Eve-Marie; Kienitz, Eliza; Bott, Nicholas T; Sun, Zhaochun; Hong, Wei-Chen; Chien, Yin-hsuan; Liu, Ning; Dougherty, Robert F; Royalty, Adam; Hawthorne, Grace; Reiss, Allan L

2015-05-28

A novel game-like and creativity-conducive fMRI paradigm is developed to assess the neural correlates of spontaneous improvisation and figural creativity in healthy adults. Participants were engaged in the word-guessing game of Pictionary(TM), using an MR-safe drawing tablet and no explicit instructions to be "creative". Using the primary contrast of drawing a given word versus drawing a control word (zigzag), we observed increased engagement of cerebellum, thalamus, left parietal cortex, right superior frontal, left prefrontal and paracingulate/cingulate regions, such that activation in the cingulate and left prefrontal cortices negatively influenced task performance. Further, using parametric fMRI analysis, increasing subjective difficulty ratings for drawing the word engaged higher activations in the left pre-frontal cortices, whereas higher expert-rated creative content in the drawings was associated with increased engagement of bilateral cerebellum. Altogether, our data suggest that cerebral-cerebellar interaction underlying implicit processing of mental representations has a facilitative effect on spontaneous improvisation and figural creativity.

Pictionary-based fMRI paradigm to study the neural correlates of spontaneous improvisation and figural creativity

PubMed Central

Saggar, Manish; Quintin, Eve-Marie; Kienitz, Eliza; Bott, Nicholas T.; Sun, Zhaochun; Hong, Wei-Chen; Chien, Yin-hsuan; Liu, Ning; Dougherty, Robert F.; Royalty, Adam; Hawthorne, Grace; Reiss, Allan L.

2015-01-01

A novel game-like and creativity-conducive fMRI paradigm is developed to assess the neural correlates of spontaneous improvisation and figural creativity in healthy adults. Participants were engaged in the word-guessing game of PictionaryTM, using an MR-safe drawing tablet and no explicit instructions to be “creative”. Using the primary contrast of drawing a given word versus drawing a control word (zigzag), we observed increased engagement of cerebellum, thalamus, left parietal cortex, right superior frontal, left prefrontal and paracingulate/cingulate regions, such that activation in the cingulate and left prefrontal cortices negatively influenced task performance. Further, using parametric fMRI analysis, increasing subjective difficulty ratings for drawing the word engaged higher activations in the left pre-frontal cortices, whereas higher expert-rated creative content in the drawings was associated with increased engagement of bilateral cerebellum. Altogether, our data suggest that cerebral-cerebellar interaction underlying implicit processing of mental representations has a facilitative effect on spontaneous improvisation and figural creativity. PMID:26018874

Under Your Skin

ERIC Educational Resources Information Center

Corsino, Janet

2012-01-01

A traditional understanding in art is that, in order to draw the human figure, the artist must first understand its structure and inner workings. This project was first developed for middle-school art students in an attempt to help them better understand figure drawing. In subsequent years, it has been amended and adapted to integrate with other…

Perception and Production of the Human Figure in Drawings by Children.

ERIC Educational Resources Information Center

Itskowitz, Rivka

This research deals with the development and relative importance of both the conceptual-cognitive and the aesthetic-affective aspect of the perceptual process at various age levels of children. Three tasks were chosen: (1) sorting drawings of human figures--a task that represents a more conceptual function; (2) expressing preferences for those…

Mental simulation of drawing actions enhances delayed recall of a complex figure.

PubMed

De Lucia, Natascia; Trojano, Luigi; Senese, Vincenzo Paolo; Conson, Massimiliano

2016-10-01

Motor simulation implies that the same motor representations involved in action execution are re-enacted during observation or imagery of actions. Neurofunctional data suggested that observation of letters or abstract paintings can elicit simulation of writing or drawing gestures. We performed four behavioural experiments on right-handed healthy participants to test whether observation of a static and complex geometrical figure implies re-enactment of drawing actions. In Experiment 1, participants had to observe the stimulus without explicit instruction (observation-only condition), while performing irrelevant finger tapping (motor dual task), or while articulating irrelevant verbal material (verbal dual task). Delayed drawing of the stimulus was less accurate in the motor dual-task (interfering with simulation of hand actions) than in verbal dual-task and observation-only conditions. In Experiment 2, delayed drawing in the observation only was as accurate as when participants encoded the stimulus by copying it; in both conditions, accuracy was higher than when participants were instructed to observe the stimulus to recall it later verbally (observe to recall), thus being discouraged from engaging motor simulation. In Experiment 3, delayed drawing was as accurate in the observation-only condition as when participants imagined copying the stimulus; accuracy in both conditions was higher than in the observe-to-recall condition. In Experiment 4, in the observe-only condition participants who observed the stimulus with their right arm hidden behind their back were significantly less accurate than participants who had their left arm hidden. These findings converge in suggesting that mere observation of a geometrical stimulus can activate motor simulation and re-enactment of drawing actions.

Preschool Drawing and School Mathematics: The Nature of the Association.

PubMed

Malanchini, Margherita; Tosto, Maria G; Garfield, Victoria; Dirik, Aysegul; Czerwik, Adrian; Arden, Rosalind; Malykh, Sergey; Kovas, Yulia

2016-05-01

The study examined the etiology of individual differences in early drawing and of its longitudinal association with school mathematics. Participants (N = 14,760), members of the Twins Early Development Study, were assessed on their ability to draw a human figure, including number of features, symmetry, and proportionality. Human figure drawing was moderately stable across 6 months (average r = .40). Individual differences in drawing at age 4½ were influenced by genetic (.21), shared environmental (.30), and nonshared environmental (.49) factors. Drawing was related to later (age 12) mathematical ability (average r = .24). This association was explained by genetic and shared environmental factors that also influenced general intelligence. Some genetic factors, unrelated to intelligence, also contributed to individual differences in drawing. © 2016 The Authors. Child Development © 2016 Society for Research in Child Development, Inc.

Some effects of sex, age, and household structure on family drawings of Barbadian children.

PubMed

Payne, M A

1996-10-01

An analysis of the family drawings of a nonclinical sample of 502 Barbadian children aged 7-11 years is reported. The inclusion or omission of figures and the size and positioning of the figures of parents and self were examined with reference to sex, age, and household structure. The view that cultural values about the structure of the family unit and parental roles are reflected in children's representations of their parents in family drawings was supported.

Contribution of Regional White Matter Integrity to Visuospatial Construction Accuracy, Organizational Strategy, and Memory for a Complex Figure in Abstinent Alcoholics.

PubMed

Rosenbloom, Margaret J; Sassoon, Stephanie A; Pfefferbaum, Adolf; Sullivan, Edith V

2009-12-01

Visuospatial construction ability as used in drawing complex figures is commonly impaired in chronic alcoholics, but memory for such information can be enhanced by use of a holistic drawing strategy during encoding. We administered the Rey-Osterrieth Complex Figure Test (ROCFT) to 41 alcoholic and 38 control men and women and assessed the contribution of diffusion tensor imaging (DTI) measures of integrity of selected white matter tracts to ROCFT copy accuracy, copy strategy, and recall accuracy. Although alcoholics copied the figure less accurately than controls, a more holistic strategy at copy was associated with better recall in both groups. Greater radial diffusivity, reflecting compromised myelin integrity, in occipital forceps and external capsule was associated with poorer copy accuracy in both groups. Lower FA, reflecting compromised fiber microstructure in the inferior cingulate bundle, which links frontal and medial temporal episodic memory systems, was associated with piecemeal copy strategy and poorer immediate recall in the alcoholics. The correlations were generally modest and should be considered exploratory. To the extent that the inferior cingulate was relatively spared in alcoholics, it may have provided an alternative pathway to the compromised frontal system for successful copy strategy and, by extension, aided recall.

Probing stereotypes through students' drawings of scientists

NASA Astrophysics Data System (ADS)

Rahm, Jrène; Charbonneau, Paul

1997-08-01

The Draw-A-Scientist Test is an assessment tool devised to explore and measure children's stereotypical views of scientists. We administered this test to a group of 49 undergraduate and postgraduate students enrolled in a teacher certification program. While this was originally intended as a purely pedagogical exercise, we were struck by the degree to which the drawings so produced resembled, in stereotypical content, those usually produced by children. This suggests that stereotypes of science and scientists formed during childhood, presumably via the influence of the media, remain largely unaffected by the subsequent passage through high school and college, despite the fact that numerous real-life figures of science teachers and scientists are presumably encountered throughout those formative years. We argue that this state of affairs has subtle and far reaching consequences, and is worthy of our collective attention.

The Effective Fracture Toughness of Aluminum at Rapid Heating Rates.

DTIC Science & Technology

1987-12-01

Stress Versus Time Relation During Test Under HWdraulic (Tinius-Olsen) Loading Device 32 11. Creep Rupture Tester ( SATEC ) Drawing ...... 33 12. SEN...1B7 Machine Corp Creep Frame SATEC C C-3053-P 12,000 Load Cell MTS 661.20A 271 5500 lb .02% Load Cell Interface 1220BF 34279B 25000 lb 1.6% Extenso- MIS... SATEC creep frame. A drawing of the creep frame can be seen in Figure 11. The samples were placed in the frame and the dead weight load was applied

The Use of Art Therapy as a Predictor of Relapse in Chemical Dependency Treatment.

ERIC Educational Resources Information Center

Dickman, Sara Brizdle; Dunn, Jonathan E.; Wolf, Abraham W.

1996-01-01

Based on five years observations, three items were more likely to appear in drawings of patients who relapsed within three months: (1) presence of psychoactive substances or drug paraphernalia; (2) lack of a figure representing the self or any detailed figure; (3) notable use of abstract or geometric drawing style. (LSR)

The Human Figure Drawing with Donor and Nondonor Siblings of Pediatric Bone Marrow Transplant Patients.

ERIC Educational Resources Information Center

Packman, Wendy L.; Beck, Vanessa L.; VanZutphen, Kelly H.; Long, Janet K.; Spengler, Gisele

2003-01-01

There is little research on the psychological impact of bone marrow transplantation (BMT) on family members. This study uses the Human Figure Drawing (HFD) to measure siblings' emotional distress toward BMT. Among the siblings, feelings of isolation, anger, depression, anxiety, and low self-esteem emerged as major themes. Findings indicate the…

"What's Wrong in This Picture?": Response to Motta et al.'s Review of Human Figure Drawings.

ERIC Educational Resources Information Center

Gresham, Frank M.

1993-01-01

Responds to article (Motta, Little, and Tobin, this issue) which reviewed data-based studies on figure drawings and found little support for their validity or use in assessing personality, behavior, emotion, or intellectual functioning. Agrees with original article, suggesting that arguments be couched in terms of three basic concepts: illusory…

Characteristics of Adults' Figure Drawings: Observations of the Post-Adolescent Stasis in Graphic Development.

ERIC Educational Resources Information Center

Rush, Jean C.; Shumaker, Mary Susan

It is hypothesized that graphic skills among the general U.S. population level off at puberty. Examined were the characteristics of 357 pairs of pencil drawings of human figures (one man and one woman) made by male and female adolescents (eighth graders), nonartistic adults (university elementary education majors), and artistic adults (beginning…

Children's human figure drawings do not measure intellectual ability.

PubMed

Willcock, Emma; Imuta, Kana; Hayne, Harlene

2011-11-01

Children typically follow a well-defined series of stages as they learn to draw, but the rate at which they progress through these stages varies from child to child. Some experts have argued that these individual differences in drawing development reflect individual differences in intelligence. Here we assessed the validity of a drawing test that is commonly used to assess children's intellectual abilities. In a single study, 125 5- and 6-year-olds completed the Draw-A-Person: A Quantitative Scoring System (DAP:QSS) and the Wechsler Preschool and Primary Scale of Intelligence-Revised (WPPSI-R) or the Wechsler Abbreviated Scale of Intelligence (WASI). Although there was a statistically significant correlation between scores on the DAP:QSS and scores on the Wechsler tests, when the scores of individual children were examined, the DAP:QSS yielded a high number of false positives and false negatives for low intellectual functioning. We conclude that the DAP:QSS is not a valid measure of intellectual ability and should not be used as a screening tool. Copyright © 2011 Elsevier Inc. All rights reserved.

37 CFR 212.3 - Registration of claims for protection of eligible designs.

Code of Federal Regulations, 2013 CFR

2013-07-01

...) Drawings must be in black ink on white 81/2″ × 11″ unruled paper. A drawing of a design should include... of the design. Solid black surface shading is not permitted except when used to represent the black... included as a separate figure, in addition to other figures which fully disclose the subject matter of the...

37 CFR 212.3 - Registration of claims for protection of eligible designs.

Code of Federal Regulations, 2014 CFR

2014-07-01

...) Drawings must be in black ink on white 81/2″ × 11″ unruled paper. A drawing of a design should include... of the design. Solid black surface shading is not permitted except when used to represent the black... included as a separate figure, in addition to other figures which fully disclose the subject matter of the...

37 CFR 212.3 - Registration of claims for protection of eligible designs.

Code of Federal Regulations, 2012 CFR

2012-07-01

...) Drawings must be in black ink on white 81/2″×11″ unruled paper. A drawing of a design should include... of the design. Solid black surface shading is not permitted except when used to represent the black... included as a separate figure, in addition to other figures which fully disclose the subject matter of the...

One Size Doesn't Fit All: New Continua of Figure Drawings and Their Relation to Ideal Body Image

ERIC Educational Resources Information Center

Novella, Jocelyn; Gosselin, Jennifer T.; Danowski, Debbie

2015-01-01

Objective: This study introduces a new figure drawing measure, the Presentation of Images on a Continuum Scale (PICS), which includes continua of bodies from thin to obese and thin to muscular for both men and women. Participants: Participants were undergraduate students from a private, Catholic university in Connecticut. The data were collected…

Eye movements in patients with schizophrenia: visual stimuli, semantic content and psychiatric symptoms.

PubMed

Ishizuka, K; Kashiwakura, M; Oiji, A

1998-05-01

In order to explore a possible association between psychiatric symptoms and eye movements, 32 patients with schizophrenia were examined using an eye mark recorder in combination with the Positive and Negative Syndrome Scale, and were compared with 32 controls. Four types of figures were presented to the subjects: geometrical figures, drawings, story drawings, and sentences. Mean eye fixation time was significantly longer and mean eye scanning length was significantly shorter for the patients than for controls, not only in response to the geometric figures, but also in response to the story drawings. Eye fixation time and scanning velocity were positively correlated with degrees of thought disturbance. The number of eye fixations, eye fixation time and scanning velocity were negatively correlated with degree of depressive tendency.

Evaluation of creative thinking in children with idiopathic epilepsy (absence epilepsy).

PubMed

Di Filippo, T; Parisi, L; Roccella, M

2012-02-01

Creativity represents the silent character of human behaviour. In children with epilepsy, cognitive performance of has mainly been investigated under the assumption that the disorder represents a risk factor for the development of intellectual function. In subjects with different forms of epilepsy, neuropsychologic disorders have been detected even when cognitive-global functioning is unimpaired. The cognitive functions of subjects with epilepsy have been widely studied, but their creativity has been never evaluated to date. The aim of this study was to describe the development of creative thinking in a group of children with absence epilepsy. The test battery included: the Torrance Test of Creative Thinking (TTCT), the Wechsler Intelligence Scale for Children-revised (WISC-R) and the Goodenough Human Figure Drawing Test. Statistical analysis (Mann-Whitney test) showed a statistically significant difference (P <0.05) in test scores between two groups of subjects (children with epilesy vs control group), with higher scores for figure originality, figure fluidity and figure elaboration in the control group. There was a significant correlation (Spearman's rho) between verbal IQ and verbal fluidity and verbal flexibility subscale scores and between performance IQ and figure elaboration, between total IQ and verbal fluidity and verbal flexibility subscales (P <0.05; r >0.30). Low scores on the figure originality subscales seem to confirm the hypothesis that adverse psychodynamic and relational factors impoverish autonomy, flexibility and manipulator interests. The communication channels between subjects with epilepsy and their family members were affected by the disorder, as were the type of emotional dynamics and affective flux.

Validation of self-reported figural drawing scales against anthropometric measurements in adults.

PubMed

Dratva, Julia; Bertelsen, Randi; Janson, Christer; Johannessen, Ane; Benediktsdóttir, Bryndis; Bråbäck, Lennart; Dharmage, Shyamali C; Forsberg, Bertil; Gislason, Thorarinn; Jarvis, Debbie; Jogi, Rain; Lindberg, Eva; Norback, Dan; Omenaas, Ernst; Skorge, Trude D; Sigsgaard, Torben; Toren, Kjell; Waatevik, Marie; Wieslander, Gundula; Schlünssen, Vivi; Svanes, Cecilie; Real, Francisco Gomez

2016-08-01

The aim of the present study was to validate figural drawing scales depicting extremely lean to extremely obese subjects to obtain proxies for BMI and waist circumference in postal surveys. Reported figural scales and anthropometric data from a large population-based postal survey were validated with measured anthropometric data from the same individuals by means of receiver-operating characteristic curves and a BMI prediction model. Adult participants in a Scandinavian cohort study first recruited in 1990 and followed up twice since. Individuals aged 38-66 years with complete data for BMI (n 1580) and waist circumference (n 1017). Median BMI and waist circumference increased exponentially with increasing figural scales. Receiver-operating characteristic curve analyses showed a high predictive ability to identify individuals with BMI > 25·0 kg/m2 in both sexes. The optimal figural scales for identifying overweight or obese individuals with a correct detection rate were 4 and 5 in women, and 5 and 6 in men, respectively. The prediction model explained 74 % of the variance among women and 62 % among men. Predicted BMI differed only marginally from objectively measured BMI. Figural drawing scales explained a large part of the anthropometric variance in this population and showed a high predictive ability for identifying overweight/obese subjects. These figural scales can be used with confidence as proxies of BMI and waist circumference in settings where objective measures are not feasible.

[Influence of violent TV upon children of a public school in Bogotá, Colombia].

PubMed

Pérez-Olmos, Isabel; Pinzón, Angela María; González-Reyes, Rodrigo; Sánchez-Molano, Juliana

2005-01-01

To evaluate the impact that a violent and a non-violent movie may cause on scholars. In Bogotá, 125 public primary school students were surveyed, applying a questionnaire to learn both about their daily life violence and their attitude towards it. Two weeks later, they were shown one violent movie, and two weeks later a non-violent one. Children were asked to draw their families, express their opinions and answer a questionnaire after each movie. The initial survey showed that 23.6% of the children reported violent responses when they were offended, 39.8% reported some kind of familiar violence and 19.5% identified themselves with a violent figure. Boys were more prone to respond violently when offended and to identify themselves with a violent figure than girls (p=0.004). Compared with the non-violent movie, a greater percentage of children excluded themselves from the family drawing after watching the violent movie (Odds Ratio (OR): 2.55; 95% Interval Confidence (95% CI) 1.22-5.43, p=0.01). The family drawing after the violent movie also showed more emotional signs (OR: 3.13; 95% CI: 1.35-7.52; p=0.0053) and more aggressive signs (OR: 2.55; 95% CI: 1.22-5.43; p=0.01) than the family drawing after the non-violent movie. The family drawing test showed the immediate impact of television. Television violence negatively influences kids and should be avoided.

Listen to them draw: screening children in primary care through the use of human figure drawings.

PubMed

Tielsch, Anna H; Allen, Patricia Jackson

2005-01-01

This literature review focuses on the Human Figure Drawing (HFD) methods put forth by Elizabeth Koppitz as a screening instrument. Children's drawings have potential as a mental health screening aide for health care practitioners in the primary care setting. This paper focuses on self-portrait drawings as a screening technique for emotional well-being, anxiety, and depression in school-aged children (6-12 years old). Using Koppitz's emotional indicators checklist for mental health, practitioners can use the child's HFD as a quick screening tool. Although the HFD is not diagnostic and can not be used as the sole indicator for anxiety or depression, two or more emotional indicators may signal to the clinician that further psychiatric assessment and referral is needed.

Influence of Cognitive Styles on Technical Drawing Students' Achievements in Senior Secondary School in Federal Capital Territory, Abuja

ERIC Educational Resources Information Center

Owodunni, A. Samuel; Sanni, AbdulRahman; Nwokolo-Ojo, Joy; Igwe, C. Obeta

2017-01-01

There are different cognitive strategies for processing information which in turn influence students' academic achievement. This paper reports an investigation of cognitive styles and achievement scores of secondary school students. In the study, the standardised Group Embedded Figures Test was used to determine the influence of student's…

The Effects of Different Drawing Materials on Children's Drawings of Positive and Negative Human Figures

ERIC Educational Resources Information Center

Burkitt, Esther; Barrett, Martyn

2011-01-01

Children tend to use certain drawing strategies differentially when asked to draw topics with positive and negative emotional characterisations. These effects have however only been established when children are asked to use standard drawing materials. The present study was designed to investigate whether the above pattern of children's response…

Real-world navigation in amnestic mild cognitive impairment: The relation to visuospatial memory and volume of hippocampal subregions.

PubMed

Peter, Jessica; Sandkamp, Richard; Minkova, Lora; Schumacher, Lena V; Kaller, Christoph P; Abdulkadir, Ahmed; Klöppel, Stefan

2018-01-31

Spatial disorientation is a frequent symptom in Alzheimer's disease and in mild cognitive impairment (MCI). In the clinical routine, spatial orientation is less often tested with real-world navigation but rather with 2D visuoconstructive tasks. However, reports about the association between the two types of tasks are sparse. Additionally, spatial disorientation has been linked to volume of the right hippocampus but it remains unclear whether right hippocampal subregions have differential involvement in real-world navigation. Yet, this would help uncover different functional roles of the subregions, which would have important implications for understanding the neuronal underpinnings of navigation skills. We compared patients with amnestic MCI (aMCI; n = 25) and healthy elderly controls (HC; n = 25) in a real-world navigation task that engaged different spatial processes. The association between real-world navigation and different visuoconstructive tasks was tested (i.e., figures from the Consortium to Establish a Registry for Alzheimer's Disease; CERAD, the Rey-Osterrieth Complex Figure task; and clock drawing). Furthermore, the relation between spatial navigation and volume of right hippocampal subregions was examined. Linear regression and relative weight analysis were applied for statistical analyses. Patients with aMCI were significantly less able to correctly navigate through a route compared to HC but had comparable map drawing and landmark recognition skills. The association between visuoconstructive tasks and real-world navigation was only significant when using the visuospatial memory component of the Rey figure. In aMCI, more volume of the right hippocampal tail was significantly associated with better navigation skills, while volume of the right CA2/3 region was a significant predictor in HC. Standard visuoconstructive tasks (e.g., the CERAD figures or clock drawing) are not sufficient to detect real-world spatial disabilities in aMCI. Consequently, more complex visuoconstructive tasks (i.e., the Rey figure) should be routinely included in the assessment of cognitive functions in the context of AD. Moreover, in those elderly individuals with impaired complex visuospatial memory, route finding behaviour should be evaluated in detail. Regarding the contribution of hippocampal subregions to spatial navigation, the right hippocampal tail seems to be particularly important for patients with aMCI, while the CA2/3 region appears to be more relevant in HC. Copyright © 2017 Elsevier Ltd. All rights reserved.

Clumsiness in fine motor tasks: evidence from the quantitative drawing evaluation of children with Down Syndrome.

PubMed

Vimercati, S L; Galli, M; Stella, G; Caiazzo, G; Ancillao, A; Albertini, G

2015-03-01

Drawing tests are commonly used for the clinical evaluation of cognitive capabilities in children with learning disabilities. We analysed quantitatively the drawings of children with Down Syndrome (DS) and of healthy, mental age-matched controls to characterise the features of fine motor skills in DS during a drawing task, with particular attention to clumsiness, a well-known feature of DS gross movements. Twenty-three children with DS and 13 controls hand-copied the figures of a circle, a cross and a square on a sheet. An optoelectronic system allowed the acquisition of the three-dimensional track of the drawing. The participants' posture and upper limb movements were analysed as well. Results showed that the participants with DS tended to draw faster but with less accuracy than controls. While clumsiness in gross movements manifests mainly as slow, less efficient movements, it manifests as high velocity and inaccurate movements in fine motor tasks such as drawing. © 2014 MENCAP and International Association of the Scientific Study of Intellectual and Developmental Disabilities and John Wiley & Sons Ltd.

Walking drawings and walking ability in children with cerebral palsy.

PubMed

Chong, Jimmy; Mackey, Anna H; Stott, N Susan; Broadbent, Elizabeth

2013-06-01

To investigate whether drawings of the self walking by children with cerebral palsy (CP) were associated with walking ability and illness perceptions. This was an exploratory study in 52 children with CP (M:F = 28:24), mean age 11.1 years (range 5-18), who were attending tertiary level outpatient clinics. Children were asked to draw a picture of themselves walking. Drawing size and content was used to investigate associations with clinical walk tests and children's own perceptions of their CP assessed using a CP version of the Brief Illness Perception Questionnaire. Larger drawings of the self were associated with less distance traveled, higher emotional responses to CP, and lower perceptions of pain or discomfort, independent of age. A larger self-to-overall drawing height ratio was related to walking less distance. Drawings of the self confined within buildings and the absence of other figures were also associated with reduced walking ability. Drawing size and content can reflect walking ability, as well as symptom perceptions and distress. Drawings may be useful for clinicians to use with children with cerebral palsy to aid discussion about their condition. PsycINFO Database Record (c) 2013 APA, all rights reserved.

Brief Report: Human Figure Drawings by Children with Asperger's Syndrome

ERIC Educational Resources Information Center

Lim, Hui Keow; Slaughter, Virginia

2008-01-01

Twenty-nine children with Asperger's syndrome and 28 typically developing children, matched on gender, chronological age and nonverbal IQ, were asked to produce a free drawing, then requested to draw a person, a house and a tree. The drawings were scored using standardized procedures for assessing accuracy, detail and complexity. There were no…

Adapting Diagrams from Physics Textbooks: A Way to Improve the Autonomy of Blind Students

ERIC Educational Resources Information Center

Dickman, A. G.; Martins, A. O.; Ferreira, A. C.; Andrade, L. M.

2014-01-01

We devise and test a set of tactile symbols to represent elements frequently used in mechanics diagrams, such as vectors, ropes, pulleys, blocks and surfaces, that can be used to adapt drawings of physics situations in textbooks for blind students. We also investigate how figures are described for blind students in classroom activities and exams,…

Significance of Retinal Lesions Potentially Caused by Dazzling Lasers

DTIC Science & Technology

2015-12-01

Refractive eye surgery (e.g., LASIK and PRK ) exploit this property of UV light to reshape the cornea with great precision (Barkana and Belkin 2000). 39...response, perimetry tests document the boundaries between seeing vs . not seeing the target to produce a drawing of the visual field (Broadway 2012). Figure...8 shows an example of the perimetry test results. The curves drawn are known as “isopters” and represent boundaries between seeing vs . not seeing

A Comparison of Concept Development and Human Figure Drawings of Children Who Receive Preschool Education vs Those Who Do Not

ERIC Educational Resources Information Center

Balat, Gulden Uyanik

2010-01-01

This study evaluated from a developmental point of view the basic concept knowledge and human figure drawings of children who did and did not attend preschool. A total of 118 children who received preschool education and 147 children who did not do so participated in the study. The mean age of children was 75.4 months. Their concept knowledge was…

Illustrating the body: Cross-sectional and prospective investigations of the impact of life drawing sessions on body image.

PubMed

Swami, Viren

2016-01-30

Life drawing sessions, where individuals produce drawings of the human figure from observations of a live model, may contain embodying elements that promote healthier body image. Two pilot studies were conducted to test this hypothesis. In Study 1, 138 individuals recruited from life drawing sessions in London, UK, estimated how many sessions they had attended in their lifetime and completed measures of negative and positive body image. In women, greater attendance was significantly associated with higher body appreciation and lower drive for thinness and social physique anxiety. In men, greater attendance was significantly associated with higher body appreciation, but not drive for muscularity or social physique anxiety. In Study 2, 37 women took part in a life drawing session for the first time. Compared to pre-session scores, participants had significantly more positive state body image and appearance satisfaction after the session. The findings of these studies suggest that life drawing may promote healthier body image, particularly among women, but further research is needed. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Development Program of Dual Mode Impact Delay Module for Artillery Fuzes.

DTIC Science & Technology

1979-12-31

analysis phase to demonstrate design confidence and reliability of performance in the artillery firing environment. See Figure I for drawing of the latest...Device P/N KF88590 as proposed by us. This analysis will be based on results of penalty test« in which the test variables will include loading and...istently and unmistakably Dextrinated lead azide was, tent surrogate. On the basis of stab s Id be predicted that any system whi r mated lead azide

Understanding Molecular Genetics through a Drawing-Based Activity

ERIC Educational Resources Information Center

Rotbain, Yosi; Marbach-Ad, Gili; Stavy, Ruth

2005-01-01

The activity uses drawings typically found in textbooks, engaging students in physical and mental activities such as drawing, painting and figure completion--as well as finding missing words and answering guiding questions. The activity deals with three topics: the structure of DNA, DNA replication and protein synthesis. In this study we…

37 CFR 1.173 - Reissue specification, drawings, and amendments.

Code of Federal Regulations, 2012 CFR

2012-07-01

...,” and any added figure must be identified as “New.” In the event that a figure is canceled, the figure... the entire text of an added or rewritten paragraph, including markings pursuant to paragraph (d) of... identified where any added or rewritten paragraph is located. This paragraph applies whether the amendment is...

"Blessed": Musical Talent, Smartness, & Figured Identities

ERIC Educational Resources Information Center

Hoffman, Adria R.

2015-01-01

The purpose of this study is to explore smartness and talent as social constructs. Drawing on Holland et al.'s (1998) figured identities, this article explores the figuring of abilities by elucidating the voices of African American high school chorus students. Critical Race Theory (CRT) helps to unpack normalized language and practices that…

An exploratory study of drawings by bereaved children.

PubMed

Forrest, M; Thomas, G V

1991-11-01

Bereaved and non-bereaved children made drawings of a person, themselves, their family, and a topic of their choice; the drawings were then analysed to investigate whether the experience of bereavement was expressed in drawing in any reliable way. Bereaved children were no more likely than non-bereaved children to include indicators of emotional disturbance in their human figure drawings. Bereaved children, however, were reliably more likely than non-bereaved children to include themselves in a drawing of their family.

Ascription of Maturity to Human Figure Drawings by Preschool Children

ERIC Educational Resources Information Center

Nash, Harvey

1973-01-01

Although Ss generally distinguished more mature from less mature figures on the basis of body proportions, the proportions of immature individuals nonetheless tended to be assimilated to those of the mature individual. (Author)

The Bicycle Drawing Test: What Does It Measure in Developmentally Typical Children?

PubMed

Cannoni, Eleonora; Di Norcia, Anna; Bombi, Anna Silvia; Di Giunta, Laura

2015-10-01

To verify the dimensionality of Bicycle Drawing Test (BDT), we applied the coding system of Greenberg, Rodriguez, and Sesta to bicycle drawings made by 295 boys and 320 girls (6-10 years old) with typical development, and submitted the data to item analysis, exploratory factor analysis, and confirmatory factor analysis. These analyses confirmed only two of the original four dimensions of the BDT: spatial reasoning and visual-motor control. The scores in these two factors were correlated with the Colored Progressive Matrices, the Rey Complex Figure (Copy and Memory) and with the teachers' ratings in mathematics, language, and drawing. The correlations, albeit moderate in magnitude, were consistent with the hypothesized convergent and discriminant validity. After checking for measurement invariance across gender and age, we conducted two analyses of variance, the first of which showed a significant difference between younger children (6-8 years old) and older children (9-10 years old); the analysis of variance by gender did not yield significant differences. These data enhance the usefulness of the BDT as a measure of separate cognitive components, but do not support its use as a measure of mechanical reasoning. © The Author(s) 2014.

[Expression of the emotions in the drawing of a man by the child from 5 to 11 years of age].

PubMed

Brechet, Claire; Picard, Delphine; Baldy, René

2007-06-01

This study examines the development of children's ability to express emotions in their human figure drawing. Sixty children of 5, 8, and 11 years were asked to draw "a man," and then a "sad", "happy," "angry" and "surprised" man. Expressivity of the drawings was assessed by means of two procedures: a limited choice and a free labelling procedure. Emotionally expressive drawings were then evaluated in terms of the number and the type of graphic cues that were used to express emotion. It was found that children are able to depict happiness and sadness at 8, anger and surprise at 11. With age, children use increasingly numerous and complex graphic cues for each emotion (i.e., facial expression, body position, and contextual cues). Graphic cues for facial expression (e.g., concave mouth, curved eyebrows, wide opened eyes) share strong similarities with specific "action units" described by Ekman and Friesen (1978) in their Facial Action Coding System. Children's ability to depict emotion in their human figure drawing is discussed in relation to perceptual, conceptual, and graphic abilities.

Cognitive and emotional outcome after pediatric liver transplantation.

PubMed

Adebäck, Petra; Nemeth, Antal; Fischler, Björn

2003-10-01

The aim of the study was to evaluate the cognitive and emotional development after pediatric liver transplantation. A total of 21 patients, aged 4-16.9 yr (median 9.6 yr) were tested 1-9 yr (median 4.2 yr) after the transplantation. The pretransplant diagnoses included biliary atresia (eight patients), various metabolic diseases (n = 6), acute liver failure (n = 3), and miscellaneous (n = 4). The cognitive functions were tested with Wechsler preschool and primary scale of intelligence (WPPSI)-R or Wechsler intelligence scale for children (WISC)-III according to age. The Piers-Harris self-concept scale and the evaluation of human figure drawings according to Koppitz were used to detect emotional problems. All tests in all patients were performed by the same psychologist. A significantly lower result on cognitive tests was seen when compared with the expected normal values (p < 0.01). The number of patients with results within or under the lower normal range was higher than expected. Although the mean value of the Piers-Harris self-concept scale was normal, there was a large spread within the group. Indicators of emotional problems were found in the human figure drawings of 50% of the patients. To some extent, low cognitive scores coincided with low scores on self-concept scale and indicators of emotional difficulties. We conclude that the high degree of cognitive and emotional problems after liver transplantation is an important argument for routine psychologic follow-up and support in these patients.

Orbit Transfer Rocket Engine Technology Program. Task C.5. Enhanced Heat Transfer Combustor Technology

DTIC Science & Technology

1991-12-01

December, 1991 i--" NASA-Lewis Research Center Cleveland, Ohio 44135 94-08573 Contract No. NAS3-23773 .0l•!ill~• 111 l94 3 16 09V PISULATIXI NOTICI... 3 3.1 Test Hardware and Facility Description...V - Drawings and Layouts of Calorimeter Insert and Related Hardware .... 133 - Ui - FIGURES NUMBER PIALE GE 3 -1 Integrated Component Evaluator (I.C.E

Cultural influence on directional tendencies in children's drawing.

PubMed

Portex, Marine; Foulin, Jean-Noël; Troadec, Bertrand

2017-09-01

The present study was aimed at investigating how print experience as a cultural factor influences directional tendencies in children's drawing in the interplay with biomechanical (hand), syntactic (shape orientation) and semantic (shape meaning) factors. Eighty-eight right-handed children from three literacy/age groups (preliterate, first graders and third graders) had to copy a geometrical shape adapted from the Rey-Osterrieth complex figure. The shape was presented alternatively leftward and rightward, while using both dominant (right) and non-dominant (left) hands. Directional tendencies were assessed regarding directionality of drawing movements at global, intermediate and local levels and deviation error in centre line bisection. Results show a global improvement of drawing quality and strategies across groups and an advantage for the dominant right hand from 6 years onward. Regarding directional tendencies, a reinforcement of a congruency effect between conditions and writing direction was found from preliterates to third graders. These results are discussed as a cultural embodiment process and have implications for psychological testing.

Critically Examining the Agency and Professional Identity Development of Novice Dual Language Teachers through Figured Worlds

ERIC Educational Resources Information Center

Varghese, Manka M.; Snyder, Rachel

2018-01-01

Drawing on the concept of figured worlds, we examined how four preservice teachers in a monoglossically oriented teacher preparation program developed their professional identities and sense of agency as dual language teachers. Figured worlds are socially constructed and culturally recognized realms with a story line and actors who also actively…

Finnish and English Children's Color Use to Depict Affectively Characterized Figures

ERIC Educational Resources Information Center

Burkitt, Esther; Tala, Katri; Low, Jason

2007-01-01

Recent research has shown that children use colors systematically in relation to how they feel about certain colors and the figures that they draw. This study explored cultural differences between Finnish and English children's use of color to represent figures with contrasting emotional characters. One hundred and eight children (54 Finnish, 54…

Correction to: Long noncoding RNA TUG1 facilitates osteogenic differentiation of periodontal ligament stem cells via interacting with Lin28A.

PubMed

He, Qin; Yang, Shuangyan; Gu, Xiuge; Li, Mengying; Wang, Chunling; Wei, Fulan

2018-06-15

Since publication of this article, the authors found a mistake in the drawing figure 5e. After careful checking of all original data, the authors discovered that they had submitted the wrong composite figure 5e. The correct Figure 5 is included below.

The Yin and the Yang of visuo-spatial neglect: a case study.

PubMed

Marshall, J C; Halligan, P W

1994-09-01

We report a patient (R.B.) who has shown gross left visuo-spatial neglect over the 3 years since he sustained a right parietal infarct. Although his neglect is severe on such tasks as line bisection, cancellation, and drawing, there are some domains of preserved perceptual performance: he can perceive subjective contours, he can use lateral symmetry as a cue to figure-ground segregation, and he benefits from some forms of global cueing. In a series of five experiments, we show that R.B. has a selective inability to analyse and copy accurately the left contours of geometric nonsense-figures. These results hold even when there is a single vertical contour (to be copied) that divides a rectangle or a circle into two sub-figures; this physically-identical boundary is copied more accurately when it is cued as the right edge of the left sub-figure than when it is cued as the left edge of the right sub-figure. These effects are not influenced by a manipulation in which R.B. is required to trace the outline of the relevant sub-figure with his finger immediately prior to drawing his copy. The results are interpreted in terms of classical Gestalt theories of figure-ground assignment. Pre-attentive (global) figure-ground parsing is basically intact; but when focal attention is demanded, only the right side of an object is coded as figure.

Drawing ability in typical and atypical development; colour cues and the effect of oblique lines.

PubMed

Farran, E K; Dodd, G F

2015-06-01

Individuals with Williams syndrome (WS) have poor drawing ability. Here, we investigated whether colour could be used as a facilitation cue during a drawing task. Participants with WS and non-verbal ability matched typically developing (TD) children were shown line figures presented on a 3 by 3 dot matrix, and asked to replicate the figures by drawing on an empty dot matrix. The dots of the matrix were either all black (control condition), or nine different coloured dots (colour condition). In a third condition, which also used coloured dots, participants were additionally asked to verbalise the colours of the dots prior to replicating the line drawings (colour-verbal condition). Performance was stronger in both WS and TD groups on the two coloured conditions, compared with the control condition. However, the facilitation effect of colour was significantly weaker in the WS group than in the TD group. Replication of oblique line segments was less successful than replication of non-oblique line segments for both groups; this effect was reduced by colour facilitation in the TD group only. Verbalising the colours had no additional impact on performance in either group. We suggest that colour acted as a cue to individuate the dots, thus enabling participants to better ascertain the spatial relationships between the parts of each figure, to determine the start and end points of component lines, and to determine the correspondence between the model and their replication. The reduced facilitation in the WS group is discussed in relation to the effect of oblique versus non-oblique lines, the use of atypical drawing strategies, and reduced attention to the model when drawing the replication. © 2014 MENCAP and International Association of the Scientific Study of Intellectual and Developmental Disabilities and John Wiley & Sons Ltd.

Drawings of fossils by Robert Hooke and Richard Waller

PubMed Central

Kusukawa, Sachiko

2013-01-01

The drawings of fossils by Robert Hooke and Richard Waller that were the basis of the engravings in Hooke's Posthumous works (1705) are published here for the first time. The drawings show that both Hooke and Waller were proficient draftsmen with a keen eye for the details of petrified objects. These drawings provided Hooke with a polemic edge in making the case for the organic origins of ‘figured stones’.

Development of a preprototype times wastewater recovery subsystem, addendum

NASA Technical Reports Server (NTRS)

Dehner, G. F.

1984-01-01

Six tasks are described reflecting subsystem hardware and software modifications and test evaluation of a TIMES wastewater recovery subsystem. The overall results are illustrated in a figure which shows the water production rate, the specific energy corrected to 26.5 VDC, and the product water conductivity at various points in the testing. Four tasks are described reflecting studies performed to develop a preliminary design concept for a next generation TIMES. The overall results of the study are the completion of major design analyses and preliminary configuration layout drawings.

[Psychological problems of thalassemic subjects].

PubMed

Guasco, G; La Mantia, A; Cuniolo, A

1987-01-01

Analysis of psychological problems of the thalassemic subject shown with these following tests: Der Baumtest, drawing of the human figure. Moreover, we made meetings with all boys and their parents during their stay in the day-hospital. These tests have shown subjective conflicts (fear and uncertainty of future due to illness felt as aggression and fault, depressive moods and loneliness, problems of communication, hope in a magic recovery opposite to the constant discomfort of the therapeutic dependence) and relational conflicts (ambivalence towards parents, difficulties in becoming a part of the social and school environment).

Sensor Technology Assessment for Ordnance and Explosive Waste Detection and Location. Revision B.

DTIC Science & Technology

1995-03-01

5 Figure 1.5 Examples Of Anti-Tank Mines .................... .................... 5 Figure 1.6. Sample Drawing of a Bomb...6 Figure 1.7. Examples of Scatterable Anti-Personnel Mines (top) and Scatterable Anti-Tank Mines (bottom...individuals, and therefore the OEW items must be detected and located. OEW examples are bombs, warheads, guided missiles, mortars, small arms, mines

The Theory of Unconventional Warfare: Win, Lose, and Draw

DTIC Science & Technology

2008-12-01

UNCONVENTIONAL WARFARE MODEL ...................................12 1. Planning Phase...Superiority over Time........................................................................11  Figure 3.  Unconventional Warfare Model ...superiority through the six principles of UW illustrated below in the UW model . . B. THE UNCONVENTIONAL WARFARE MODEL Figure 3. Unconventional

Structural Studies on Varicella Zoster Virus

DTIC Science & Technology

1990-08-20

TABLE OF CONTENTS INTRODUCTION 1 The VZV Genome , 8 VZV Proteins 12 VZV Transcription 14 The Structure of HSV 15 Herpesvirus Expression 16...VZV virion . . . 4 Figure 2. A drawing of the VZV nucleocapsid 6 Figure 3. A comparison of the structure of the genomes of HSV - 1 and VZV 9 Figure 4...VZV, and purified VZ virions probed with antibody against VZV IE62 (the HSV - 1 ICP4 equivalent) . . . 154 xii Figure 48. Autoradiograph of VZV IE62

Young children’s ability to use 2-dimensional and 3-dimensional symbols to show placements of body touches and hidden objects

PubMed Central

Lytle, Nicole; London, Kamala; Bruck, Maggie

2015-01-01

In two experiments, we investigated 3- to 5-year-old children’s ability to use dolls and human figure drawings as symbols to map body touches. In Experiment 1 stickers were placed on different locations of children’s bodies, and they were asked to indicate the location of the sticker using three different symbols: a doll, a human figure drawing, and the adult researcher. Performance on the tasks increased with age, but many 5-year-olds did not attain perfect performance. Surprisingly, younger children made more errors on the 2D human figure drawing task compared to the 3D doll and adult tasks. In Experiment 2, we compared children’s ability to use 3D and 2D symbols to indicate body touch as well as to guide their search for a hidden object. We replicated the findings of Experiment 1 for the body touch task: for younger children, 3D symbols were easier to use than 2D symbols. However, the reverse pattern was found for the object locations task with children showing superior performance using 2D drawings over 3D models. Though children showed developmental improvements in using dolls and drawings to show where they were touched, less than two-thirds of the 5-year-olds performed perfectly on the touch tasks. Developmental as well as forensic implications of these results are discussed. PMID:25781003

Children's Drawings of Significant Figures for a Peer or an Adult Audience

ERIC Educational Resources Information Center

Burkitt, Esther; Watling, Dawn; Murray, Lucy

2011-01-01

The present study assessed if children would present different information in their drawings of emotion eliciting stimuli when they believed that an adult or a child audience would view their drawings. Seventy-five 6-year-olds (44 boys and 31 girls) were allocated to three groups: the reference group, the child audience group and the adult…

Do Computers Improve the Drawing of a Geometrical Figure for 10 Year-Old Children?

ERIC Educational Resources Information Center

Martin, Perrine; Velay, Jean-Luc

2012-01-01

Nowadays, computer aided design (CAD) is widely used by designers. Would children learn to draw more easily and more efficiently if they were taught with computerised tools? To answer this question, we made an experiment designed to compare two methods for children to do the same drawing: the classical "pen and paper" method and a CAD…

Assessing emotional well-being of children in a Honduran orphanage: feasibility of two screening tools.

PubMed

Debiasi, Laura B; Reynolds, Annette; Buckner, Ellen B

2012-01-01

The World Health Organization (WHO) has determined mental health in children to be a priority area for evidence-based interventions. Effective and efficient screening methods are needed to assess emotional well-being of children from diverse cultures. This descriptive study examined two tools for feasibility, sensitivity, cultural appropriateness, and cost/time effectiveness. Emotional well-being was conceptualized using the Roy Adaptation Model as part of the self-concept adaptive mode. Emotional indicators were measured from Human Figure Drawings. Anxiety was measured using a modification of the Revised Children's Manifest Anxiety Survey (RCMAS). The sample included 11 girls who were 7 to 12 years of age and recruited from a girls' orphanage in Honduras. Results indicated the Human Figure Drawings identified more children possibly at risk than the RCMAS. Human Figure Drawings were found to be a time/cost-effective, sensitive, and culturally appropriate means for measuring emotional well-being in the setting. This study contributes to nursing knowledge by demonstrating feasibility of the screening tools for measuring emotional well-being of children in varied cultures.

23 CFR 750.703 - Definitions.

Code of Federal Regulations, 2012 CFR

2012-04-01

... classifications. (b) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw... frontage roads, turning roadways, or parking areas. (i) Sign, display or device, hereinafter referred to as “sign,” means an outdoor advertising sign, light, display, device, figure, painting, drawing, message...

23 CFR 750.703 - Definitions.

Code of Federal Regulations, 2010 CFR

2010-04-01

... classifications. (b) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw... frontage roads, turning roadways, or parking areas. (i) Sign, display or device, hereinafter referred to as “sign,” means an outdoor advertising sign, light, display, device, figure, painting, drawing, message...

23 CFR 750.153 - Definitions.

Code of Federal Regulations, 2014 CFR

2014-04-01

...: (a) Sign means an outdoor sign, light, display, device, figure, painting, drawing, message, placard... lanes of the highway, exclusive of frontage roads, auxiliary lanes, and ramps. (c) Interstate System....S.C. (e) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw...

23 CFR 750.153 - Definitions.

Code of Federal Regulations, 2010 CFR

2010-04-01

...: (a) Sign means an outdoor sign, light, display, device, figure, painting, drawing, message, placard... lanes of the highway, exclusive of frontage roads, auxiliary lanes, and ramps. (c) Interstate System....S.C. (e) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw...

23 CFR 750.703 - Definitions.

Code of Federal Regulations, 2011 CFR

2011-04-01

... classifications. (b) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw... frontage roads, turning roadways, or parking areas. (i) Sign, display or device, hereinafter referred to as “sign,” means an outdoor advertising sign, light, display, device, figure, painting, drawing, message...

23 CFR 750.703 - Definitions.

Code of Federal Regulations, 2014 CFR

2014-04-01

... classifications. (b) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw... frontage roads, turning roadways, or parking areas. (i) Sign, display or device, hereinafter referred to as “sign,” means an outdoor advertising sign, light, display, device, figure, painting, drawing, message...

23 CFR 750.703 - Definitions.

Code of Federal Regulations, 2013 CFR

2013-04-01

... classifications. (b) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw... frontage roads, turning roadways, or parking areas. (i) Sign, display or device, hereinafter referred to as “sign,” means an outdoor advertising sign, light, display, device, figure, painting, drawing, message...

23 CFR 750.153 - Definitions.

Code of Federal Regulations, 2011 CFR

2011-04-01

...: (a) Sign means an outdoor sign, light, display, device, figure, painting, drawing, message, placard... lanes of the highway, exclusive of frontage roads, auxiliary lanes, and ramps. (c) Interstate System....S.C. (e) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw...

23 CFR 750.153 - Definitions.

Code of Federal Regulations, 2013 CFR

2013-04-01

...: (a) Sign means an outdoor sign, light, display, device, figure, painting, drawing, message, placard... lanes of the highway, exclusive of frontage roads, auxiliary lanes, and ramps. (c) Interstate System....S.C. (e) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw...

23 CFR 750.153 - Definitions.

Code of Federal Regulations, 2012 CFR

2012-04-01

...: (a) Sign means an outdoor sign, light, display, device, figure, painting, drawing, message, placard... lanes of the highway, exclusive of frontage roads, auxiliary lanes, and ramps. (c) Interstate System....S.C. (e) Erect means to construct, build, raise, assemble, place, affix, attach, create, paint, draw...

Land and Undersea Field Testing of Very Low Frequency RF Antennas and Loop Transceivers

DTIC Science & Technology

2017-12-01

VLF RF HARDWARE: SSC PACIFIC LOOP ANTENNAS ........................................... 4 2.3 EXPERIMENTAL CONCEPT...2.3 EXPERIMENTAL CONCEPT Figure 5 shows a drawing of a typical transmit/receive scenario. Each of the WFS units and loop antennas can both transmit...kilohertz is around 20 fT/root(Hz). One femtoTesla (fT) is equal to 10-15 Tesla. Our derived value is close to the 30 fT/root(Hz) value experimentally

Projective techniques and the detection of child sexual abuse.

PubMed

Garb, H N; Wood, J M; Nezworski, M T

2000-05-01

Projective techniques (e.g., the Rorschach, Human Figure Drawings) are sometimes used to detect child sexual abuse. West recently conducted a meta-analysis on this topic, but she systematically excluded nonsignificant results. In this article, a reanalysis of her data is presented. The authors conclude that projective techniques should not be used to detect child sexual abuse. Many of the studies purportedly demonstrating validity are flawed, and none of the projective test scores have been well replicated.

The Scientific Status of Projective Techniques.

PubMed

Lilienfeld, S O; Wood, J M; Garb, H N

2000-11-01

Although projective techniques continue to be widely used in clinical and forensic settings, their scientific status remains highly controversial. In this monograph, we review the current state of the literature concerning the psychometric properties (norms, reliability, validity, incremental validity, treatment utility) of three major projective instruments: Rorschach Inkblot Test, Thematic Apperception Test (TAT), and human figure drawings. We conclude that there is empirical support for the validity of a small number of indexes derived from the Rorschach and TAT. However, the substantial majority of Rorschach and TAT indexes are not empirically supported. The validity evidence for human figure drawings is even more limited. With a few exceptions, projective indexes have not consistently demonstrated incremental validity above and beyond other psychometric data. In addition, we summarize the results of a new meta-analysis intended to examine the capacity of these three instruments to detect child sexual abuse. Although some projective instruments were better than chance at detecting child sexual abuse, there were virtually no replicated findings across independent investigative teams. This meta-analysis also provides the first clear evidence of substantial file drawer effects in the projectives literature, as the effect sizes from published studies markedly exceeded those from unpublished studies. We conclude with recommendations regarding the (a) construction of projective techniques with adequate validity, (b) forensic and clinical use of projective techniques, and (c) education and training of future psychologists regarding projective techniques. © 2000 Association for Psychological Science.

Ethnic and Socioeconomic Status Differences in Human Figure Drawings

ERIC Educational Resources Information Center

Adler, Peter T.

1971-01-01

Human figures drawn by psychiatric patients were evaluated. It was hypothesized that differences in performance, particularly differences reflecting a lower level of cognitive maturity, would be associated with the sociocultural background variables, and that these differences might well be such as to be misinterpreted as psychopathologically…

Analysis of students geometry skills viewed from spatial intelligence

NASA Astrophysics Data System (ADS)

Riastuti, Nova; Mardiyana, Pramudya, Ikrar

2017-12-01

Geometry is one of the difficult materials for students because students must have the ability to visualize, describe the picture, draw a figure, and know the kinds of figures. This study aimisto describe the students geometry skills in resolving geometry problems viewed from spatial intelligence. This research uses a descriptive qualitative method has aim to identify students geometry skills by 6 students in eight grade of Ngawi regency, Indonesia. The subjects were 2 students with high spatial intelligence, 2 students with medium spatial intelligence, and 2 students with low spatial intelligence. Datas were collected based on written test and interview. The result of this research showed that the students geometry skills viewed from spatial intelligence includes. The results of this study indicate that there was a correlation between students' spatial intelligence with geometric skills. Students had different geometric skills in each category of spatial intelligence, although there were similarities in some geometry skill indicators. Students with low spatial intelligence had less geometry skills, thus requiring special attention from teachers. Mathematics teachers are expected to provide more practice questions that reinforce students' geometry skills including visual skills, descriptive skills, drawing skills, logical skills, applied skills.

Clock Drawing in Spatial Neglect: A Comprehensive Analysis of Clock Perimeter, Placement, and Accuracy

PubMed Central

Chen, Peii; Goedert, Kelly M.

2012-01-01

Clock drawings produced by right-brain-damaged (RBD) individuals with spatial neglect often contain an abundance of empty space on the left while numbers and hands are placed on the right. However, the clock perimeter is rarely compromised in neglect patients’ drawings. By analyzing clock drawings produced by 71 RBD and 40 healthy adults, this study investigated whether the geometric characteristics of the clock perimeter reveal novel insights to understanding spatial neglect. Neglect participants drew smaller clocks than either healthy or non-neglect RBD participants. While healthy participants’ clock perimeter was close to circular, RBD participants drew radially extended ellipses. The mechanisms for these phenomena were investigated by examining the relation between clock-drawing characteristics and performance on six subtests of the Behavioral Inattention Test (BIT). The findings indicated that the clock shape was independent of any BIT subtest or the drawing placement on the test sheet and that the clock size was significantly predicted by one BIT subtest: the poorer the figure and shape copying, the smaller the clock perimeter. Further analyses revealed that in all participants, clocks decreased in size as they were placed farther from the center of the paper. However, even when neglect participants placed their clocks towards the center of the page, they were smaller than those produced by healthy or non-neglect RBD participants. These results suggest a neglect-specific reduction in the subjectively available workspace for graphic production from memory, consistent with the hypothesis that neglect patients are impaired in the ability to enlarge the attentional aperture. PMID:22390278

Choreography Styles in Figure Skating

ERIC Educational Resources Information Center

Moormann, Peter Paul

2006-01-01

Fifty-eight figure skating trainers from fifteen different countries acted as volunteers in this study on choreography styles. The styles were based on reports of artistic-creative strategies in composing music, drawing, writing poems or novels, and in making dances. The prevalence of the Mozartian (at the onset the choreographer already has a…

Comparing the drawings of children with attention deficit hyperactivity disorder with normal children.

PubMed

Haghighi, Mahnaz; Khaterizadeh, Maedeh; Chalbianloo, Gholamreza; Toobaei, Sholeh; Ghanizadeh, Ahmad

2014-10-01

Attention deficit hyperactivity disorder (ADHD) is the most common behavioral problem during childhood and in school-aged children. Various projection drawings have been designed for assessing children's personality and psychological disorders including the tests of draw a person (DAP) and draw a family (DAF). We aimed to compare the differences between typically developing children and children with ADHD using these tests. In this case-control study, all the 9-10 year-old boy students studying at the third and fourth grades were enrolled from schools in the 2nd educational district of Shiraz, south of Iran. Eighty students were then selected and enrolled into the ADHD group and the control group. The Diagnostic and Statistical Manual of Mental Disorders, 4th edition- text Revised (DSM-IV-TR), and the Child Symptoms Inventory were used to diagnose the children with ADHD. We evaluated and analyzed impulsiveness, non-impulsiveness, emotional problems and incompatibility indices in the DAP and DAF tests in each group. A significant difference was found in the indices of incompatibility and emotional problems, impulsiveness, non-impulsiveness and DAF between typically developing children and those with ADHD. The mean (±SD) total scores of the above mentioned indices in the ADHD group were 19.79(±2.94), 12.31(±1.84), 5.26(±2.29) and 5.89(±2.13), respectively (P<0.001). The corresponding figures for these indices in the normal group were 12.11(±4.74), 5.63(±2), 10.36± (2.33) and 2.88(±2.13), respectively (P<0.001). Significant differences were obtained between the control group and children with ADHD using these two drawing tests. The rate of impulsivity and emotional problems indices in drawings of children with ADHD was markedly more common than those of the typically developing children. This suggests the need for further assessment to screen ADHD.

Integrated Advanced Microwave Sounding Unit-A (AMSU-A). Performance Verification Report: Initial Comprehensive Performance Test Report, P/N 1331200-2-IT, S/N 105/A2

NASA Technical Reports Server (NTRS)

Platt, R.

1999-01-01

This is the Performance Verification Report, Initial Comprehensive Performance Test Report, P/N 1331200-2-IT, S/N 105/A2, for the Integrated Advanced Microwave Sounding Unit-A (AMSU-A). The specification establishes the requirements for the Comprehensive Performance Test (CPT) and Limited Performance Test (LPT) of the Advanced Microwave Sounding, Unit-A2 (AMSU-A2), referred to herein as the unit. The unit is defined on Drawing 1331200. 1.2 Test procedure sequence. The sequence in which the several phases of this test procedure shall take place is shown in Figure 1, but the sequence can be in any order.

Dynamic Anatomy.

ERIC Educational Resources Information Center

Hogarth, Burne

This student artist's handbook uses drawings and diagrams to demonstrate the basic structure, proportions, and expressive nature of the human form from an artist's point of view. Emphasis is placed upon the relationship of mass to movement. Drawings of the figure in action reveal the rhythmic relationship of muscles and their effect upon surface…

Evaluating the Convergence of Muscle Appearance Attitude Measures

ERIC Educational Resources Information Center

Cafri, Guy; Thompson, J. Kevin

2004-01-01

There has been growing interest in the assessment of a muscular appearance. Given the importance of assessing muscle appearance attitudes, the aim of this study was to explore the convergence of the Drive for Muscularity Scale, Somatomorphic Matrix, Contour Drawing Rating Scale, Male Figure Drawings, and the Muscularity Rating Scale. Participants…

Global ISR: Toward a Comprehensive Defense Against Unauthorized Code Execution

DTIC Science & Technology

2010-10-01

implementation using two of the most popular open- source servers: the Apache web server, and the MySQL database server. For Apache, we measure the effect that...utility ab. T o ta l T im e ( s e c ) 0 500 1000 1500 2000 2500 3000 Native Null ISR ISR−MP Fig. 3. The MySQL test-insert bench- mark measures...various SQL operations. The figure draws total execution time as reported by the benchmark utility. Finally, we benchmarked a MySQL database server using

Reinforced Concrete Beams under Combined Axial and Lateral Loading.

DTIC Science & Technology

1982-01-01

NUMBER(s) Golden E. Lane, Jr. F29601-76-C-015 9. PERFORMING ORGANIZATION NAME AND ADDRESS 10. PROGRAM ELEMENT . PROJECT, TASK AREA 4 WORK UNIT NUMBERS New...acquisition system. The voltage output from the system’s digital multimeter was recorded on a floppy disk. The sampling rate was approximately two... samples per second for every channel. The same system was used to reduce and plot the data. TEST APPARATUS Figure 9 shows a schematic drawing of the load

Structural Response of the Slotted Waveguide Antenna Stiffened Structure Components Under Compression

DTIC Science & Technology

2010-03-01

mounted in its center point. One can see the 62 Figure 45 Shear Specimen Drawing for ASTM Test D7078 wire lead pads coming from the gage in the ±45...wall is much stronger without the slots cut in it. This inward buckling motion tilts the three slots towards inward bulging and this crumpling of the...Structural Composites with Piezoelectric Micro-Constituents. Tech. rep., U.S. Army Research Office. 15. Thomas, J., Qidwai, M., Baucom, J., and Pogue, W

Assessing the association between pesticide exposure and cognitive development in rural Costa Rican children living in organic and conventional coffee farms.

PubMed

Lu, Chensheng; Essig, Christa; Root, Christa; Rohlman, Diane S; McDonald, Tom; Sulzbacher, Stephen

2009-01-01

We examined the association between pesticide exposure and cognitive development among rural Costa Rican children in a cross-sectional study. Study participants aged 4-10 years included 17 children whose parents worked in La Amistad organic coffee plantation and 18 Las Mellizas children whose parents worked in their own small conventional coffee farms. Two spot-urine samples were collected from each participant and analyzed for organophosphorus and pyrethroids pesticide metabolites. We administered the computerized Behavioral Assessment and Research System (BARS), a figure-drawing task, and a long-term memory test to evaluate study participant's cognitive development. Although urinary pesticide metabolite levels did not vary considerably between these two groups of children, we found that Las Mellizas children performed better in BARS and the figure drawing tests than did La Amistad. The results from the linear mixed-effects models suggested that family socioeconomic status (SES) might be a significant contributor to the variation of the outcomes of the neurobehavioral tests. The effect of pesticide exposure, however, as measured in a snapshot fashion, did not play a significant role to the performance of the cognitive development evaluation. Regardless of the study limitations, needed effort should be devoted to the improvement of the SES on the La Amistad families so that their children's cognitive development would not be compromised further. Additionally, future studies should focus on addressing the limitations imposed on the snapshot assessment of pesticide exposure and on conducting cognitive development evaluation so the link between childhood pesticide exposure and their cognitive development can be thoroughly investigated.

[A comparative study on family perception between abused children and normal children by Kinetic Family Drawing].

PubMed

Lee, Haeng Ja; Kim, Young Hae; Park, Nam Hee

2006-04-01

The study attempted to find family perception differences between abused children and normal children by Kinetic Family Drawing. The subjects of the study consisted of two groups, 143 abused who were in the upper 25th percentile, and 150 normal who were in the lower 25th percentile. Collected Kinetic Family Drawings were divided into five dimensions such as actions, human figure characteristics, dynamics, styles and symbols, and they was analyzed with SPSS/WIN 10.0. In the perception about their family in action dimension, their family in figure characteristics dimension, their family in dynamics dimensions, and their family in symbols dimension, there is a sharp contrast between the two groups. Putting these results together, abused children feel lower self-esteem and feel more sense of alienation in their family than normal children do. In addition, abused children perceive their parents as negative and aggressive people.

The development of Israeli children's images of Jews and Arabs and their expression in human figure drawings.

PubMed

Teichman, Y

2001-11-01

The development of images of "a Jew" and "an Arab" in Jewish Israeli children who were 4-15 years of age was investigated by means of human figure drawings followed by the administration of questionnaires. The drawings were scored on structural and thematic variables. The questionnaires assessed beliefs and intentions. The hypotheses predicted a differential perception of in- and out-groups and peaks in negativity toward the out-group at preschool age and in early adolescence. Results indicate that, irrespective of age, Jewish Israeli children have generalized images of the two ethnic groups. Preschoolers expressed both positive biases toward the in-group and negativism toward the out-group. and early adolescents manifested mainly negative biases toward the out-group. Children in middle childhood and mid-adolescents manifested reductions in both in-group favoritism and out-group negativity.

Artistic creation as stimulated by superimposed versus combined-composite visual images.

PubMed

Rothenberg, A

1986-02-01

The creative role of homospatial thinking in visual art was assessed in an experiment with 39 highly talented young artists. In order to compare the creative effects of visual elements occupying the same space with identical elements arrayed in a combined foreground and background organization, superimposed slide images were presented to a randomly selected portion of the subject group, and the other portion of the subject group viewed the same slide images constructed into a figure-ground composite. Both groups produced three drawings stimulated by the slide stimuli, and these drawings were independently judged by three art experts. Results were that drawings produced by the group exposed to the superimposed images were rated higher in creative potential than those stimulated by the figure-ground controls. These results extend previous experimental findings of a tendency toward homospatial thinking in creative individuals in literature and visual art.

High Efficiency Variable Speed Versatile Power Air Conditioning System for Military Vehicles

DTIC Science & Technology

2013-08-01

MOBILITY (P&M) MINI-SYMPOSIUM AUGUST 21-22, 2013 - TROY , MICHIGAN High efficiency variable speed versatile power air conditioning system for...power draw was measured using a calibrated Watt meter. The schematic of the setup is shown in Figure 5 and the setup is shown in Figure 6. Figure...Rocky Research environmental chamber. Cooling Capacity was directly measured in Btu/hr or Watts via measuring the Air flow velocity and the air

Mechanical Properties and Seawater Behavior of Nitronic 50 (22Cr-13Ni- 5Mn) Plate

DTIC Science & Technology

1976-01-01

Bal - balance misc - miscellaneous cfh - cubic feet per hour mpy - mils per year c/m - cycles per minute my - millivolts CVN - Charpy V-notch No...High-Cycle Fatigue Specimens F_gure 6 - Drawings; Low-Cycle Fatigue Specimens Figure 7 - Curve; Charpy V-Notch Impact Toughness Versus Temperature...for Nitronic 50 Base Plate FiGure 8 - Curve; Charpy V-Notch Toughness Versus Tempera- ture for Nitrcnic 50 Weldments Figure 9 - Photographs; Fracture

Bury my Face in Casting Plaster

ERIC Educational Resources Information Center

Judnick, Don

1976-01-01

As part of an introductory course in figure drawing, art students spent some time doing portrait studies and profile drawings. When the teacher threw in an ancedote on life masks, it had a double impact. Students learned to better understand underlying bone structure and facial planes and to create a new art product. (Author/RK)

1. Photocopy of measured drawing (from: Harvey, Robert R. 'Historic ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

1. Photocopy of measured drawing (from: Harvey, Robert R. 'Historic Stone Architecture of Winterset, Iowa, Prior to and During the Civil War Period.' Ames, IA: Iowa State University, 1960) Robert R. Harvey, delineator 1960 FLOOR PLAN, ORIGINAL HOUSE ('FIGURE 3-A') - Caleb Clark House, 814 South Eighth Street, Winterset, Madison County, IA

Breakdown of Spatial Parallel Coding in Children's Drawing

ERIC Educational Resources Information Center

De Bruyn, Bart; Davis, Alyson

2005-01-01

When drawing real scenes or copying simple geometric figures young children are highly sensitive to parallel cues and use them effectively. However, this sensitivity can break down in surprisingly simple tasks such as copying a single line where robust directional errors occur despite the presence of parallel cues. Before we can conclude that this…

Becoming Economic Subjects: Agency, Consumption and Popular Culture in Early Childhood

ERIC Educational Resources Information Center

Saltmarsh, Sue

2009-01-01

This paper considers how young children in early childhood education draw on popular texts and consumer goods in their constitution of subjectivities and social relations. The paper draws on poststructuralist theories of subjectivity, agency, consumption and power, to explore how performative practices of consumption figure in the constitution of…

Figure-ground mechanisms provide structure for selective attention.

PubMed

Qiu, Fangtu T; Sugihara, Tadashi; von der Heydt, Rüdiger

2007-11-01

Attention depends on figure-ground organization: figures draw attention, whereas shapes of the ground tend to be ignored. Recent research has revealed mechanisms for figure-ground organization in the visual cortex, but how these mechanisms relate to the attention process remains unclear. Here we show that the influences of figure-ground organization and volitional (top-down) attention converge in single neurons of area V2 in Macaca mulatta. Although we found assignment of border ownership for attended and for ignored figures, attentional modulation was stronger when the attended figure was located on the neuron's preferred side of border ownership. When the border between two overlapping figures was placed in the receptive field, responses depended on the side of attention, and enhancement was generally found on the neuron's preferred side of border ownership. This correlation suggests that the neural network that creates figure-ground organization also provides the interface for the top-down selection process.

Figure-ground mechanisms provide structure for selective attention

PubMed Central

Qiu, Fangtu T.; Sugihara, Tadashi; von der Heydt, Rüdiger

2009-01-01

Attention depends on figure-ground organization: figures draw attention, while shapes of the ground tend to be ignored. Recent research has demonstrated mechanisms of figure-ground organization in the visual cortex, but how they relate to the attention process remains unclear. Here we show that the influences of figure-ground organization and volitional (top-down) attention converge in single neurons of area V2. While assignment of border ownership was found for attended as well as for ignored figures, attentional modulation was stronger when the attended figure was located on the neuron’s preferred side of border ownership. When the border between two overlapping figures was placed in the receptive field, responses depended on the side of attention, and enhancement was generally found on the neuron’s preferred side of border ownership. This correlation suggests that the neural network that creates figure-ground organization also provides the interface for the top-down selection process. PMID:17922006

An Experimental Study of a Turbulent Wing-Body Junction and Wake Flow

DTIC Science & Technology

1991-09-01

10 ................... 323 Figure 5.37. Comparison of Contours of (a(W)/aY) 5fU ,’I, Plane 11 ......... 324 Figure 5.38. Comparison of Contours of h...the mean velocity in the boundary layer and the vortex position. The vortex depresses the contours of Urc by drawing in high momentum fluid from the

Empowering the Self, Creating Worlds: Lesbian and Gay Latina/o College Students' Identity Negotiation in Figured Worlds

ERIC Educational Resources Information Center

Pena-Talamantes, Abraham E.

2013-01-01

Drawing from Holland, Lachicotte, Skinner, and Cain's (1998) identity theory, this study sought to understand how six self-identified lesbian and gay Latina/o college students negotiated their sexual and ethnic identities. Participants identified two equally flawed dimensions, the hometown and college figured worlds, from which they sought an…

The relation of hand and arm configuration variances while tracking geometric figures in Parkinson's disease: aspects for rehabilitation.

PubMed

Keresztényi, Zoltán; Cesari, Paola; Fazekas, Gábor; Laczkó, József

2009-03-01

Variances of drawing arm movements between patients with Parkinson's disease and healthy controls were compared. The aim was to determine whether differences in joint synergies or individual joint rotations affect the endpoint (hand position) variance. Joint and endpoint coordinates were measured while participants performed drawing tasks. Variances of arm configurations and endpoints were computed and statistically analyzed for 12 patients and 12 controls. The variance of arm movements for patients (both for arm configuration and endpoint) was overall higher than that for the control group. Variation was smaller for drawing a circle versus a square and for drawing with the dominant versus the nondominant hand within both groups. The ratio of arm configuration variances between groups was similar to the ratio of endpoint variances. There were significant differences in the velocity, but not in the path lengths of movements comparing the two groups. Patients presented less movement stability while drawing different figures in different trials. Moreover, the similarity of the ratios suggests that the ill-coordinated hand movement was caused by the error in the movements of individual body parts rather than by the lack of intersegmental coordination. Thus, rehabilitation may focus on the improvement of the precision of individual joint rotations.

Improved Necker Cube Drawing-Based Assessment Battery for Constructional Apraxia: The Mie Constructional Apraxia Scale (MCAS)

PubMed Central

Satoh, Masayuki; Mori, Chika; Matsuda, Kana; Ueda, Yukito; Tabei, Ken-ichi; Kida, Hirotaka; Tomimoto, Hidekazu

2016-01-01

Background/Aims Constructional apraxia (CA) is usually diagnosed by having patients draw figures; however, the reported assessments only evaluate the drawn figure. We designed a new assessment battery for CA (the Mie Constructional Apraxia Scale, MCAS) which includes both the shape and drawing process, and investigated its utility against other assessment methods. Methods We designed the MCAS, and evaluated inter- and intrarater reliability. We also investigated the sensitivity, specificity, and positive and negative predictive values in dementia patients, and compared MCAS assessment with other reported batteries in the same subjects. Results Moderate interrater reliability was shown for speech therapists with limited experience. Moderate to substantial intrarater reliability was shown several weeks after initial assessment. When cutoff scores and times were set at 2/3 points and 39/40 s, sensitivity and specificity were 77.1 and 70.4%, respectively, with positive and negative predictive values of 80.0 and 66.7%, respectively. Dementia patients had significantly worse scores and times for Necker cube drawing than an elderly control group on the MCAS, and on other assessments. Conclusions We conclude that the MCAS, which includes both the assessment of the drawn Necker cube shape and the drawing process, is useful for detecting even mild CA. PMID:27790241

3. Photocopy of measured drawing (from: Harvey, Robert R. 'Historic ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

3. Photocopy of measured drawing (from: Harvey, Robert R. 'Historic Stone Architecture of Winterset, Iowa, Prior to and During the Civil War Period.' Ames, IA: Iowa State University, 1960.) Robert R. Harvey, delineator 1960 FLOOR PLAN, ORIGINAL HOUSE PLUS SMOKEHOUSE ADDITION ('FIGURE 3-C') - Caleb Clark House, 814 South Eighth Street, Winterset, Madison County, IA

2. Photocopy of measured drawing (from: Harvey, Robert R. 'Historic ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

2. Photocopy of measured drawing (from: Harvey, Robert R. 'Historic Stone Architecture of Winterset, Iowa, Prior to and During the Civil War Period.' Ames, IA: Iowa State University, 1960.) Robert R. Harvey, delineator 1960 FLOOR PLAN, ORIGINAL HOUSE PLUS WELLHOUSE ADDITION ('FIGURE 3-B') - Caleb Clark House, 814 South Eighth Street, Winterset, Madison County, IA

The Relation of Hand and Arm Configuration Variances while Tracking Geometric Figures in Parkinson's Disease: Aspects for Rehabilitation

ERIC Educational Resources Information Center

Keresztenyi, Zoltan; Cesari, Paola; Fazekas, Gabor; Laczko, Jozsef

2009-01-01

Variances of drawing arm movements between patients with Parkinson's disease and healthy controls were compared. The aim was to determine whether differences in joint synergies or individual joint rotations affect the endpoint (hand position) variance. Joint and endpoint coordinates were measured while participants performed drawing tasks.…

What Stick Figures Tell Us about Irish Politics: Creating a Critical and Collaborative Learning Space

ERIC Educational Resources Information Center

Feeney, Sharon; Hogan, John; Donnelly, Paul F.

2015-01-01

This paper focuses upon the interpretation of freehand drawings produced by a small sample of 220 first-year students taking an Irish politics introductory module in response to the question, "What is Irish Politics?" By sidestepping cognitive verbal-processing routes, through employing freehand drawing, we aim to create a critical and…

A comparison of emotional indicators and depressive symptom levels of school-age children with and without cancer.

PubMed

Durualp, Ender; Altay, Naime

2012-01-01

This study aims to compare the emotional indicators and depressive symptom levels of 6- to 12-year-old children with and without cancer. The sample included 20 children with cancer and 20 healthy children of similar ages and gender. Data were collected by using the Child Introduction Form, Children's Depression Inventory, the Human Figure Drawing test, and children's drawings. The results showed that the depressive symptom levels of children with cancer were significantly higher than those of healthy children. Impulsivity, mistrust, and anger were observed significantly more in children with cancer (P < .05). Although anxiety was equal in the two groups, shyness was observed more in the cancer group, though the difference was not significant (P > .05). The emotional indicators of both groups of children did not have an effect on their depression scores.

[Pseudoaneurysm in the vicinity of the ascending aorta caused by contained disruption at the insertion site of a coronary artery bypass graft. A case report].

PubMed

Drögemüller, A; Zahn, R; Bergmeier, C; Werling, C; Isgro, F; Senges, J

1998-08-01

In this case report a 65-year-old patient came into the emergency ward with acute chest pain after coronary artery bypass graft operation in 1985. On routine chest X-ray in 1995 a mediastinal widening was diagnosed. The chest X-ray in 1997 (Figure 1) showed an increase of the diameter of the known mediastinal widening. Therefore a CT-scan was performed (Figures 2a and 2b). This showed an enhancement of contrast material in a contained structure, without identifying its origin. Therefore a coronary angiography was done. Here, we diagnosed a contained disruption of the aorta at the insertion site of the bypass graft at the right coronary artery. Figure 3a shows leakage of contrast material out of the aorta into the pseudoaneurysm and in Figure 3b this is demonstrated in a schematic drawing. Figure 4a shows supraselective imaging of the pseudoaneurysm, demonstrated in a schematic drawing in Figure 4b. As the chest pain could only be handled by i.v.-medication, betablocker and bed rest we decided to operate. Intra-operatively the diagnosis was confirmed (Figure 5a and 5b). Postoperatively the patient died due to cerebral ischemia. Despite the lethal outcome an operative revision appears even retrospectively justified because of the increasing size of the pseudoaneurysm in addition to new symptoms that were difficult to treat. On the other hand there are no data available in order to estimate the risk of a spontaneous course.

Miratü'lEbdan Fi Teşrih-i Azaül-İnsan: first printed illustrated anatomy book in Ottoman-Turkish medicine.

PubMed

Ortug, Gursel; Ortug, Alpen; Kurt, Namik Kemal

2018-04-13

Medical education in Ottoman-Turkish medicine was shaped by the influence of Claudius Galenus (c.130-c.210) and Ibn-i Sina (c.980-c.1037). These teachings were performed in madrasahs until the beginning of the 19th century period. Within the scope of master-apprentice relationship, medical training was also given in private clinics. As a result of religious and social pressures on scientific studies human cadavers were never used because they were considered sacred. For centuries, all books were handwritten during the Ottoman Empire until the first printing press was established in Istanbul during 1726. However, the first illustrated book on anatomy was not printed until another 100 years later. A comparative study was conducted on the anatomical drawings in"Miratü'l Ebdan Fi Teşrih-i Azau'l İnsan" (Ataullah ŞM, 17th),and significance of this book. 46 out of 56 figures were received from the book of physian and anatomist Jean Palfin (1650-1730). Remaining 9 figures were cited from author himself as collected from Bernard Siegfried Albinus (1697-1170), Raymond Vieussens (1614- 1715), R. Drake (1667-1707), Clopton Havers (1657-1702), Albrecht von Haller (1708- 1777), Joseph Guichard Duverney (1648-1730). The figures were drawn exactly the same way with minimal changes. Main text of the book is mostly translation from Italian edition of Bertin and Palfin's Works.The book is not only the first printed anatomical book but also the first printed work in Ottoman-Turkish medicine. Another very significant aspect is the illustrations are perspective drawing figures which differs from miniature style drawings of the past. Şânîzade Ataullah's work is a significant value not only for being the first printed illustrated anatomy book which makes it more approachable but also gives anatomical drawings as illustrations not as miniature style painting.

Integrated Electronic Warfare System Advanced Development Model (ADM); Appendix 1 - Functional Requirement Specification.

DTIC Science & Technology

1977-10-01

APPROVED DATE FUNCTION APPROVED jDATE WRITER J . K-olanek 2/6/76 REVISIONS CHK DESCRIPTION REV CHK DESCRIPTION IREV REVISION jJ ~ ~ ~~~ _ II SHEET NO...DOCUMENT (CDBDD) 45 5.5 COMPUTER PROGRAM PACKAGE (CPP)- j 45 5.6 COMPUTER PROGRAM OPERATOR’S MANUAL (CPOM) 45 5.7 COMPUTER PROGRAM TEST PLAN (CPTPL) 45...I LIST OF FIGURES Number Page 1 JEWS Simplified Block Diagram 4 2 System Controller Architecture 5 SIZE CODE IDENT NO DRAWING NO. A 49956 SCALE REV J

Metaphorically speaking: cognitive abilities and the production of figurative language.

PubMed

Beaty, Roger E; Silvia, Paul J

2013-02-01

Figurative language is one of the most common expressions of creative behavior in everyday life. However, the cognitive mechanisms behind figures of speech such as metaphors remain largely unexplained. Recent evidence suggests that fluid and executive abilities are important to the generation of conventional and creative metaphors. The present study investigated whether several factors of the Cattell-Horn-Carroll model of intelligence contribute to generating these different types of metaphors. Specifically, the roles of fluid intelligence (Gf), crystallized intelligence (Gc), and broad retrieval ability (Gr) were explored. Participants completed a series of intelligence tests and were asked to produce conventional and creative metaphors. Structural equation modeling was used to assess the contribution of the different factors of intelligence to metaphor production. For creative metaphor, there were large effects of Gf (β = .45) and Gr (β = .52); for conventional metaphor, there was a moderate effect of Gc (β = .30). Creative and conventional metaphors thus appear to be anchored in different patterns of abilities: Creative metaphors rely more on executive processes, whereas conventional metaphors primarily draw from acquired vocabulary knowledge.

Numerical Electromagnetics Simulations of the Leakage Through the Pump-out Holes in the DISC Electromagnetic Interference Shield

DOE Office of Scientific and Technical Information (OSTI.GOV)

Brown, Jr., Charles G.; Cooper, Amy; Moore, Alastair S.

In order to prevent electromagnetic interference (EMI) from affecting the DISC diagnostic, an EMI shield was added. Figure 1 is a cross section from a CAD model of DISC and shows the EMI shield in situ. The shield is orange and at the top of the figure. Figure 2 is a drawing of just the EMI shield. The slit in the center of the EMI shield is covered by a metal mesh, which is not shown in this drawing. The small holes toward the base of the conical portion of the EMI shield are the pump-out holes, and the electromagneticmore » leakage through these holes is the subject of this report1. An alternate design for the EMI shield is considered in order to determine how to increase the EMI effectiveness of the pump-out holes in the shield without compromising the flow rate through the shield. Both the original and alternate designs are simulated and compared.« less

Nonflammable Hydraulic Power System for Tactical Aircraft. Volume 1. Aircraft System Definition, Design and Analysis

DTIC Science & Technology

1989-05-01

89 99 Eaton - Hydraulic Pressure Transducer Outline Drawing . . 90 100 ITT - Hydraulic Pressure Switch Outline Drawing ...... . 90...Charge Value .......................... 7,500 hr Pressure Switch ....................... 15,000 hr Pumps ................................ 3,700 hr...mechanisms for the RLS. A pressure switch is connected to the circuit for remotely indicating the closure of applicable circuit shutoff valves. Figures

Training children aged 5-10 years in manual compliance control to improve drawing and handwriting.

PubMed

Bingham, Geoffrey P; Snapp-Childs, Winona

2018-04-12

A large proportion of school-aged children exhibit poor drawing and handwriting. This prevalence limits the availability of therapy. We developed an automated method for training improved manual compliance control and relatedly, prospective control of a stylus. The approach included a difficult training task, while providing parametrically modifiable support that enables the children to perform successfully while developing good compliance control. The task was to use a stylus to push a bead along a 3D wire path. Support was provided by making the wire magnetically attractive to the stylus. Support was progressively reduced as 3D tracing performance improved. We report studies that (1) compared performance of Typically Developing (TD) children and children with Developmental Coordination Disorder (DCD), (2) tested training with active versus passive movement, (3) tested progressively reduced versus constant or no support during training, (4) tested children of different ages, (5) tested the transfer of training to a drawing task, (6) tested the specificity of training in respect to the size, shape and dimensionality of figures, and (7) investigated the relevance of the training task to the Beery VMI, an inventory used to diagnose DCD. The findings were as follows. (1) Pre-training performance of TD and DCD children was the same and good with high support but distinct and poor with low support. Support yielded good self-efficacy that motivated training. Post training performance with no support was improved and the same for TD and DCD children. (2) Actively controlled movements were required for improved performance. (3) Progressively reduced support was required for good performance during and after training. (4) Age differences in performance during pre-training were eliminated post-training. (5) Improvements transferred to drawing. (6) There was no evidence of specificity of training in transfer. (7) Disparate Beery scores were reflected in pre-training but not post-training performance. We conclude that the method improves manual compliance control, and more generally, prospective control of movements used in drawing performance. Copyright © 2018. Published by Elsevier B.V.

Cognitive profile of patients with rotated drawing at copy or recall: a controlled group study.

PubMed

Molteni, Federica; Traficante, Debora; Ferri, Francesca; Isella, Valeria

2014-03-01

When copying or recalling a figure from memory, some patient with dementia or focal brain lesions may rotate the drawing through ±90° or 180°. We have tried to clarify the nature of this phenomenon by investigating the cognitive profile of 22 patients who rotated the copy of the Rey-Osterrieth Complex Figure and 27 who rotated (only) the recall, and two control groups of cases with the same neuropsychiatric diagnoses, but no misorientation deficit. Brain MRI and FDG-PET images were also analysed. Predictor of rotation at the copy versus rotation at the recall was visuospatial impairment as measured by the copy of the Rey Figure; predictors of rotation at the copy versus no rotation were, again, visuospatial deficits, in addition to an abnormal performance at the task of selective attention. No specific profile of cognitive impairment distinguished patients with and without rotation at the recall. Disproportionate temporo-parieto-occipital atrophy or hypometabolism were evident in cases with misorientation of the copy, while predominant frontal abnormalities were found in cases of rotated recall. Based on these findings, rotated drawing at the copy is interpreted as a dorsal visual stream deficit, whose occurrence is more probable when attentional control is impaired. Rotation at recall seems to have a distinct, more anterior, neural substrate, but its dysexecutive nature has yet to be demonstrated. Copyright © 2014 Elsevier Inc. All rights reserved.

Validity and test-retest reliability in assessing current body size with figure drawings in Chinese adolescents.

PubMed

Lo, Wing-Sze; Ho, Sai-Yin; Wong, Bonny Yee-Man; Mak, Kwok-Kei; Lam, Tai-Hing

2011-06-01

The reliability and validity of Stunkard's Figure Rating Scale (FRS) as a measure of current body size (CBS) was established in Western adolescent girls but not in non-Western population. We examined the validity and test-retest reliability of Stunkard's FRS in assessing CBS among Chinese adolescents. Methods. In a school-based survey in Hong Kong, 5666 adolescents (boys: 45.1%; mean age 14.7 years) provided data on self-reported height and weight, CBS, perceived weight status, and health-related quality of life using the Medical Outcomes Study Short-Form version 2 (SF-12v2). Height and weight were also objectively measured. Spearman's correlation was used to assess construct validity, concurrent validity and test-retest reliability. Convergent and discriminant validity were good: CBS correlated strongly with weight and self-reported/measured BMI, but only weakly with SF-12v2. CBS correlated strongly with perceived weight status, showing concurrent validity. Spearman's correlation (r) for CBS was 0.78 for girls and 0.72 for boys indicating good test-retest reliability. Validity and reliability results did not differ significantly between senior and junior grade adolescents. Our findings support the use of Stunkard's FRS to measure body size among Chinese adolescents.

Implementation of Individual System Qualification (ISQ) in a CBRN Respiratory Protection Program, Part B: Standard Operating Procedures

DTIC Science & Technology

2014-10-01

or V2) on the side that is being tested. f. Plug the threaded hole in the face-form with a wetted finger. g. Gently pump the vacuum bulb enough to...a stop watch for a 45 second count down. 8. Close the bleed valve on the appropriate vacuum squeeze bulb (V1 or V2). Pump the bulb to draw a... vacuum into the mask until the gauge reaches or exceeds the green section of the dial (Figure 6). Generally 2 pumps will be sufficient. If the vacuum will

The Impact of Audience Age and Familiarity on Children's Drawings of Themselves in Contrasting Affective States

ERIC Educational Resources Information Center

Burkitt, Esther; Watling, Dawn

2013-01-01

The present study was designed to investigate the impact of familiarity and audience age on children's self-presentation in self-drawings of happy, sad and neutral figures. Two hundred children (100 girls and 100 boys) with the average age of 8 years 2 months, ranging from 6 years 3 months to 10 years 1 month, formed two age groups and five…

Facilitating complex shape drawing in Williams syndrome and typical development.

PubMed

Hudson, Kerry D; Farran, Emily K

2013-07-01

Individuals with Williams syndrome (WS) produce drawings that are disorganised, likely due to an inability to replicate numerous spatial relations between parts. This study attempted to circumvent these drawing deficits in WS when copying complex combinations of one, two and three shapes. Drawing decisions were reduced by introducing a number of facilitators, for example, by using distinct colours and including facilitatory cues on the response sheet. Overall, facilitation improved drawing in the WS group to a comparable level of accuracy as typically developing participants (matched for non-verbal ability). Drawing accuracy was greatest in both groups when planning demands (e.g. starting location, line lengths and changes in direction) were reduced by use of coloured figures and providing easily distinguished and clearly grouped facilitatory cues to form each shape. This study provides the first encouraging evidence to suggest that drawing of complex shapes in WS can be facilitated; individuals with WS might be receptive to remediation programmes for drawing and handwriting. Copyright © 2013 Elsevier Ltd. All rights reserved.

Anthropomorphic robot for recognition and drawing generalized object images

NASA Astrophysics Data System (ADS)

Ginzburg, Vera M.

1998-10-01

The process of recognition, for instance, understanding the text, written by different fonts, consists in the depriving of the individual attributes of the letters in the particular font. It is shown that such process, in Nature and technique, can be provided by the narrowing the spatial frequency of the object's image by its defocusing. In defocusing images remain only areas, so-called Informative Fragments (IFs), which all together form the generalized (stylized) image of many identical objects. It is shown that the variety of shapes of IFs is restricted and can be presented by `Geometrical alphabet'. The `letters' for this alphabet can be created using two basic `genetic' figures: a stripe and round spot. It is known from physiology that the special cells of visual cortex response to these particular figures. The prototype of such `genetic' alphabet has been made using Boolean algebra (Venn's diagrams). The algorithm for drawing the letter's (`genlet's') shape in this alphabet and generalized images of objects (for example, `sleeping cat'), are given. A scheme of an anthropomorphic robot is shown together with results of model computer experiment of the robot's action--`drawing' the generalized image.

Edge-assignment and figure-ground segmentation in short-term visual matching.

PubMed

Driver, J; Baylis, G C

1996-12-01

Eight experiments examined the role of edge-assignment in a contour matching task. Subjects judged whether the jagged vertical edge of a probe shape matched the jagged edge that divided two adjoining shapes in an immediately preceding figure-ground display. Segmentation factors biased assignment of this dividing edge toward a figural shape on just one of its sides. Subjects were faster and more accurate at matching when the probe edge had a corresponding assignment. The rapid emergence of this effect provides an on-line analog of the long-term memory advantage for figures over grounds which Rubin (1915/1958) reported. The present on-line advantage was found when figures were defined by relative contrast and size, or by symmetry, and could not be explained solely by the automatic drawing of attention toward the location of the figural region. However, deliberate attention to one region of an otherwise ambiguous figure-ground display did produce the advantage. We propose that one-sided assignment of dividing edges may be obligatory in vision.

Your Brain and Nervous System

MedlinePlus

... using your cerebrum. You need it to solve math problems, figure out a video game, and draw ... said to be more analytical, helping you with math, logic, and speech. Scientists do know for sure ...

Innovations in Air Insertion (Involving Parachutes)

DTIC Science & Technology

2008-03-01

be utilized to develop lift. ......................52 Figure 18. Leonardo da Vinci and Fausto Veranzio’s canopy designs from the 15th and 16th...The Skydiver’s Handbook, ed. Para Publishing, 6th ed. (Santa Barbara, CA: Para Publishing, 1992), 82. 56 Figure 18. Leonardo da Vinci and Fausto...experimented with rigid, umbrella-like, canopies around 1000 A.D. One of the first recorded canopy designs is Leonardo da Vinci’s late 15th century drawing

Evaluation of family drawings of physically and sexually abused children.

PubMed

Piperno, Francesca; Di Biasi, Stefania; Levi, Gabriel

2007-09-01

The aim of this study is to analyse the family drawings of two groups of physically and/or sexually abused children as compared to the drawings of non-abused children of a matched control group. The drawings by 12 physically abused, 12 sexually abused and 12 non-abused children, all aged between 5 years-old and 10 years-old, were assessed and compared. Family drawings were analysed using a specific Screening Inventory (FDI-Family Drawing Inventory). This Inventory takes into consideration such qualitative and quantitative variables as the quality of drawing, the children's perception of their family members and their own perception of themselves within the family system. The results have shown significant differences between the abused minors and the control group. Abused children are more likely to draw distorted bodies, the human figure is usually represented devoid of details, their drawings generally show clear signals of trauma and the majority of the abused children are likely to exclude their primary caregiver from the drawings. The "drawings of the family" of physically and/or sexually abused children significantly evidence a greater emotional distress then the drawings of the non-abused children of the matched control group.

The creative brain in the figural domain: Distinct patterns of EEG alpha power during idea generation and idea elaboration.

PubMed

Rominger, Christian; Papousek, Ilona; Perchtold, Corinna M; Weber, Bernhard; Weiss, Elisabeth M; Fink, Andreas

2018-02-13

This study investigated EEG activity in the upper alpha band during the well-known Picture Completion Task of the Torrance Test of Creative Thinking (TTCT), a widely used creative ideation task in the figural domain. The application of a sophisticated computerized version of the TTCT facilitating the online assessment and digitalizing of participant's drawings allowed to separate two central stages of the creative ideation process (i.e., idea generation and idea elaboration). During idea generation, the participants' task was to generate an initial draft of an original and creative completion of the presented abstract lines and figures of the TTCT. During idea elaboration, the participants were required to mentally improve the originality of the initially generated idea/draft. Creative ideation in this figural task was generally associated with comparatively strong desynchronization of upper alpha power over parietal and occipital sites, indicating high visual/figural processing demands. Interestingly, the stage of idea elaboration was accompanied by a relative increase of upper alpha power at parietal and occipital sites compared to the stage of idea generation, indicating heightened top-down processing demands. Furthermore, task performance was associated with relative increases of upper alpha power at frontal sites and relative decreases at centro-temporal sites from the stage of idea generation to idea elaboration. This association suggests the importance of increased inhibitory control over stimulus-based bottom-up information and motor imagery in order to achieve more creative outputs. Taken together these findings add to the relevant literature in that they a) extend research on the relationship between EEG alpha activity and creativity to the figural domain, and b) support a multistage view of creative ideation, involving cognitive control and mental imagery as important components of creativity. Copyright © 2018 Elsevier Ltd. All rights reserved.

[The Vitruvian Man: an anatomical drawing for proportions by Leonardo Da Vinci].

PubMed

Le Floch-Prigent, P

2008-12-01

The aim of the study was to find out and to analyse the text by Vitruvius which inspired the famous drawing by Leonardo da Vinci (circa 1490) kept in the Galleria dell'Accademia, in Venezia, Italy: the man inscribed in one circle and in one square. The book "de Architectura" by Vitruvius Marcus Pollio was printed several times since the Renaissance when both the roman architecture of antiquity and this text became very popular. From a French translation by Claude Perrault in 1864, it became easy to find a French translation with the original text in Latin (Paris, 2003, Les Belles Lettres, French text by Pierre Gros). The drawing by Leonardo da Vinci illustrates with great accuracy and fidelity the quotation of Vitruvius (with the exception of two of the 12 main relationships). The genius of Leonardo da Vinci was to keep only one trunk, head and neck for two pairs of limbs: scapular and pelvic; to make the circle tangent to the lower edge of the square; to adjust a few features of the quotation for the equilibrium of the whole figure; and of course to bring his incredible skill as a drawer (one of the best of his century). The drawing was made on a sheet of paper 344x245mm, in black ink which became dark brown with time; several lines complete the figure above and below; a short caption and a horizontal scale appear just under the drawing. The celebrity of the drawing, a symbol of the Renaissance, of the equilibrium of man and mankind, of the universality of the artists and intellectuals of the time (Humanism) made it iconic and it has been constantly reproduced and adapted especially for advertisement and logos, not only in the medical field.

Failure Analysis of a Missile Locking Hook from the F-14 Jet

DTIC Science & Technology

1989-09-01

MTL) to determine the probable cause of failure. The component is one of two launcher housing support points for the Spar- row Missile and is located...reference Raytheon Draw- ing No. 685029, Figure 3). Atomic absorpticn and inductively coupled argon plasma emission spectroscopy were used to determine ...microscopy, while Figure 16 is a SEM fractograph taken of the same region. The crack initiation site was determined by tracing the radial marks indicative of

Figural properties are prioritized for search under conditions of uncertainty: Setting boundary conditions on claims that figures automatically attract attention.

PubMed

Peterson, Mary A; Mojica, Andrew J; Salvagio, Elizabeth; Kimchi, Ruth

2017-01-01

Nelson and Palmer (2007) concluded that figures/figural properties automatically attract attention, after they found that participants were faster to detect/discriminate targets appearing where a portion of a familiar object was suggested in an otherwise ambiguous display. We investigated whether these effects are truly automatic and whether they generalize to another figural property-convexity. We found that Nelson and Palmer's results do generalize to convexity, but only when participants are uncertain regarding when and where the target will appear. Dependence on uncertainty regarding target location/timing was also observed for familiarity. Thus, although we could replicate and extend Nelson and Palmer's results, our experiments showed that figures do not automatically draw attention. In addition, our research went beyond Nelson and Palmer's, in that we were able to separate figural properties from perceived figures. Because figural properties are regularities that predict where objects lie in the visual field, our results join other evidence that regularities in the environment can attract attention. More generally, our results are consistent with Bayesian theories in which priors are given more weight under conditions of uncertainty.

Eduard Jaeger's Test-Types (Schrift-Scalen) and the historical development of vision tests.

PubMed Central

Runge, P E

2000-01-01

PURPOSE: Eduard Jaeger's original Test-Types were carefully evaluated: (1) to determine whether Jaeger had maintained a consistent standard, (2) to establish the correct Snellen equivalent for Jaeger's Test-Types, (3) to answer the question of why and how the standard was lost, and (4) to compare the visual angle of optotypes to lines of continuous text. METHODS: All original Viennese editions of Jaeger's Test-Types, as well as first generation United Kingdom (UK) and United States (US) versions, were evaluated. Data were collected objectively using a microruler with a 20X loupe and subjectively using a laser distance-measuring device. The data were analyzed using Microsoft Excel. All previous measurements of Jaeger's Test-Types, objective and subjective, collected over the past 133 years were compared to the current data and to each other. RESULTS: The correct Snellen equivalent of Jaeger's Test-Types was determined. The visual angle created from the measurement of the height of lowercase letters, without ascenders or descenders, provides an accurate method of assigning a visual angle of a line of continuous text. Comparing the typefaces used in printing first generation UK and US versions of Jaeger's Test-Types to the Viennese editions provided an explanation for the absence of a consistent standard for Jaeger's Test-Types today. CONCLUSIONS: All 10 versions of Jaeger's original Test-Types are virtually identical and established a gold standard for reading vision tests. Jaeger's standard was lost when his Test-Types were first printed in the UK and the US using local typefaces. The Jaeger standard has been re-established. Visual angles determined using continuous text are comparable to those obtained by using optotypes. Images FIGURE 1 FIGURE 2 FIGURE 3 FIGURE 4 FIGURE 5 FIGURE 6 FIGURE 7C FIGURE 9 FIGURE 10 FIGURE 11 FIGURE 12 FIGURE 13 FIGURE 14 FIGURE 16 FIGURE 17 FIGURE 18 FIGURE 19A FIGURE 19B p409-a FIGURE 20 FIGURE 21 FIGURE 22 FIGURE 23 FIGURE 24 FIGURE 25 FIGURE 26 FIGURE 27 FIGURE 28A FIGURE 28B FIGURE 28C FIGURE 29 FIGURE 30 FIGURE 31 FIGURE 32 FIGURE 33 FIGURE 34 FIGURE 35 FIGURE 36A FIGURE 37 FIGURE 38 FIGURE 39 PMID:11190034

Seizure drawings: insight into the self-image of children with epilepsy.

PubMed

Stafstrom, Carl E; Havlena, Janice

2003-02-01

Epilepsy is a chronic disorder that is associated with numerous psychological challenges, especially in children. Drawings have been underutilized as a method to obtain insight into psychological issues in children with epilepsy. We asked 105 children with epilepsy, ages 5 to 18 years, to draw a picture of what it is like to have a seizure. Across ages and epilepsy syndromes, the drawings showed evidence of impaired self-concept, low self-esteem, and a sense of helplessness and vulnerability. Overall, the drawings of human figures were less developed than expected for chronological age. In some drawings, indicators of underlying depression were found. When considered by epilepsy syndrome or seizure type, some specific artistic features were noted. Children with simple partial (motor) seizures drew distorted body parts, especially limbs. Those with complex partial seizures depicted sensory symptoms and mental status changes such as confusion. Children with generalized tonic-clonic seizures showed shaking extremities. Drawings by children with absence seizures illustrated mainly staring. In conclusion, drawings are a powerful method to examine the self-concept of children with epilepsy and gain insight into their feelings about themselves and their world.

A critique of Lilienfeld et al.'s (2000) "The scientific status of projective techniques".

PubMed

Hibbard, Stephen

2003-06-01

Lilienfeld, Wood, and Garb (2000) published a largely negative critique of the validity and reliability of projective methods, concentrating on the Comprehensive System for the Rorschach (Exner, 1993), 3 systems for coding the Thematic Apperception Test (TAT; Murray, 1943) cards, and human figure drawings. This article is an effort to document and correct what I perceive as errors of omission and commission in the Lilienfeld et al. article. When projective measures are viewed in the light of these corrections, the evidence for the validity and clinical usefulness of the Rorschach and TAT methods is more robust than Lilienfeld et al. represented.

Cerebral activations related to writing and drawing with each hand.

PubMed

Potgieser, Adriaan R E; van der Hoorn, Anouk; de Jong, Bauke M

2015-01-01

Writing is a sequential motor action based on sensorimotor integration in visuospatial and linguistic functional domains. To test the hypothesis of lateralized circuitry concerning spatial and language components involved in such action, we employed an fMRI paradigm including writing and drawing with each hand. In this way, writing-related contributions of dorsal and ventral premotor regions in each hemisphere were assessed, together with effects in wider distributed circuitry. Given a right-hemisphere dominance for spatial action, right dorsal premotor cortex dominance was expected in left-hand writing while dominance of the left ventral premotor cortex was expected during right-hand writing. Sixteen healthy right-handed subjects were scanned during audition-guided writing of short sentences and simple figure drawing without visual feedback. Tapping with a pencil served as a basic control task for the two higher-order motor conditions. Activation differences were assessed with Statistical Parametric Mapping (SPM). Writing and drawing showed parietal-premotor and posterior inferior temporal activations in both hemispheres when compared to tapping. Drawing activations were rather symmetrical for each hand. Activations in left- and right-hand writing were left-hemisphere dominant, while right dorsal premotor activation only occurred in left-hand writing, supporting a spatial motor contribution of particularly the right hemisphere. Writing contrasted to drawing revealed left-sided activations in the dorsal and ventral premotor cortex, Broca's area, pre-Supplementary Motor Area and posterior middle and inferior temporal gyri, without parietal activation. The audition-driven postero-inferior temporal activations indicated retrieval of virtual visual form characteristics in writing and drawing, with additional activation concerning word form in the left hemisphere. Similar parietal processing in writing and drawing pointed at a common mechanism by which such visually formatted information is used for subsequent sensorimotor integration along a dorsal visuomotor pathway. In this, the left posterior middle temporal gyrus subserves phonological-orthographical conversion, dissociating dorsal parietal-premotor circuitry from perisylvian circuitry including Broca's area.

Cerebral Activations Related to Writing and Drawing with Each Hand

PubMed Central

Potgieser, Adriaan R. E.; van der Hoorn, Anouk; de Jong, Bauke M.

2015-01-01

Background Writing is a sequential motor action based on sensorimotor integration in visuospatial and linguistic functional domains. To test the hypothesis of lateralized circuitry concerning spatial and language components involved in such action, we employed an fMRI paradigm including writing and drawing with each hand. In this way, writing-related contributions of dorsal and ventral premotor regions in each hemisphere were assessed, together with effects in wider distributed circuitry. Given a right-hemisphere dominance for spatial action, right dorsal premotor cortex dominance was expected in left-hand writing while dominance of the left ventral premotor cortex was expected during right-hand writing. Methods Sixteen healthy right-handed subjects were scanned during audition-guided writing of short sentences and simple figure drawing without visual feedback. Tapping with a pencil served as a basic control task for the two higher-order motor conditions. Activation differences were assessed with Statistical Parametric Mapping (SPM). Results Writing and drawing showed parietal-premotor and posterior inferior temporal activations in both hemispheres when compared to tapping. Drawing activations were rather symmetrical for each hand. Activations in left- and right-hand writing were left-hemisphere dominant, while right dorsal premotor activation only occurred in left-hand writing, supporting a spatial motor contribution of particularly the right hemisphere. Writing contrasted to drawing revealed left-sided activations in the dorsal and ventral premotor cortex, Broca’s area, pre-Supplementary Motor Area and posterior middle and inferior temporal gyri, without parietal activation. Discussion The audition-driven postero-inferior temporal activations indicated retrieval of virtual visual form characteristics in writing and drawing, with additional activation concerning word form in the left hemisphere. Similar parietal processing in writing and drawing pointed at a common mechanism by which such visually formatted information is used for subsequent sensorimotor integration along a dorsal visuomotor pathway. In this, the left posterior middle temporal gyrus subserves phonological-orthographical conversion, dissociating dorsal parietal-premotor circuitry from perisylvian circuitry including Broca's area. PMID:25955655

Toward the development of a rational scale in the use of human-figure drawings as a kindergarten screening measure.

PubMed

Goldman, R K; Velasco, M M

1980-04-01

The Draw-A-Person Test was individually administered to 120 kindergartners from diverse socioeconomic backgrounds, ranging in age from 4 yr. and 10 mo. to 6 yr. and 4 mo. This study was conducted to validate and expand Goldman and Warren's earlier work (1976) on the development of a rational scale for use as a kindergarten screening measure. Correlational analyses corroborate the earlier findings that body-part omissions are the most predictive items of emotional high risk. Factor analyses of the current data also replicate earlier findings in which two underlying cohesive factors emerged. The first factor has high loadings on peripheral body-part omissions; the second factor has high loadings on central body-part omission. The results suggest that an interchangeable number of body-part omissions together, rather than any one item, predict high emotional risk. Structural and content characteristics do not contribute significantly to the development of a kindergarten screening measure.

The Effects of Enhanced Disparity on Manual Control Stereopsis and Tracking Performance.

DTIC Science & Technology

1981-06-22

Modestino for her help in drawing the figures, and Margaret Armour for typing the manuscript. This research was supported by the U.S. Air Force Office of...had both eyes open, but only one of the optical channels transmitted an image. ------- DRAPE 4’ 4-1 Go, IPD JOYSTICK Figure 1. Diagram of the...eliminated. To enhance target detectability, a dark blue cloth was draped behind the targets. This dark background spanned ± 50 and had a luminance of

The Impact of the Information Revolution on Policymakers’ Use of Intelligence Analysis

DTIC Science & Technology

2005-01-01

Site Support Area Figure 1-12 2 Image of site named Yurya taken from the Smithsonian National Air & Space Museum archives, and can also be found at...from the intelligence community, this image was taken by a commercial imaging satellite IKONOS, owned and operated by the firm Space Imaging , and paid...for and published by Aviation Week and Space Technology magazine. The image was posted on the WWW, as was the accompanying drawing, shown in figure 1-3

Adapting diagrams from physics textbooks: a way to improve the autonomy of blind students

NASA Astrophysics Data System (ADS)

Dickman, A. G.; Martins, A. O.; Ferreira, A. C.; Andrade, L. M.

2014-09-01

We devise and test a set of tactile symbols to represent elements frequently used in mechanics diagrams, such as vectors, ropes, pulleys, blocks and surfaces, that can be used to adapt drawings of physics situations in textbooks for blind students. We also investigate how figures are described for blind students in classroom activities and exams, by interviewing three blind students using the oral history method. The symbols were tested at a specialized school for the blind. Our results indicate that, with training, blind students become familiar with the symbols and can identify them in a problem without the need for a spoken description. This educational product can help blind students to achieve the same conditions of autonomy as sighted ones when studying physics.

A Call to Action

ERIC Educational Resources Information Center

Thomas, P. L.

2003-01-01

University educator P. L. Thomas recalls the significant figures in his professional life and, drawing from their example, exhorts us to "command the daily events of our own careers." He outlines specific actions that he believes English language arts teachers must take.

The Humble Pie--Half-Baked or Well Done?

ERIC Educational Resources Information Center

Hunt, Neville; Mashhoudy, Houshang

2008-01-01

This article re-examines the much maligned piechart and provides justification for its use. It identifies common pitfalls when drawing piecharts in Microsoft Excel and offers advice on how to avoid them. (Contains 6 figures and 5 tables.)

Assessing the Concordance between Child Reports and Adult Observations of Single and Mixed Emotion in Children's Drawings of Themselves or Another Child

ERIC Educational Resources Information Center

Burkitt, Esther

2018-01-01

The present study assessed concordance between child reported and adult observed strategies to depict single and mixed emotion in the same human figure drawings. 205 children (104 boys, 101 girls) aged 6 years 2 months to 8 years 3 months formed two age groups (6 years 2 months-7 years 2 months and 7 years 3 months-8 years 3 months) across two…

Taking the cure to the poor: patients' responses to New York City's tuberculosis program, 1894 to 1918.

PubMed Central

Abel, E K

1997-01-01

Drawing on the case files of a major charitable agency, this paper explores how poor people experienced New York City's pioneering program of tuberculosis control. Although the program provided enormous benefits, poor New Yorkers often had pressing concerns that took priority over eradicating tuberculosis. Moreover, the program imposed extreme hardships even as it promised liberation from a terrible scourge. Poor people did not protest collectively, but many individually resisted. They delayed seeking diagnosis, disobeyed the advice promulgated by the Department of Health, attended clinics irregularly, and either refused to enroll in hospitals, sanatoria, and preventoria or fled soon after arrival. Images FIGURE 1 FIGURE 2 FIGURE 3 PMID:9366638

Path Planning for Reduced Identifiability of Unmanned Surface Vehicles Conducting Intelligence, Surveillance, and Reconnaissance

DTIC Science & Technology

2017-05-22

angular velocity values Figure 33: Feasibility test Figure 34: Bellman’s Principle Figure 35: Bellman’s Principle validation Minimum Figure 36...Distribution of at test point for simulated ISR traffic Figure 48: PDFs of observed and ISR traffic Table 2: Adversary security states at test point #10...Figure 49: Hypothesis testing at test point #10 Figure 50: Distribution of for observed traffic Figure 51: Distribution of for ISR traffic Table 3

Hemispheric specialization in the assessment of female physical attractiveness.

PubMed

Dural, Seda; Cetinkaya, Hakan; Gülbetekin, Evrim

2015-01-01

Female physical attractiveness has been widely related to waist-to-hip ratio (WHR) and body weight (BW). The present study was conducted to examine the role of hemispheric specialization in the perception of physical attractiveness. Drawings of female figures that differed in BW (underweight, normal and overweight) and WHR (0.7 and 1.0) were presented to both male and female subjects using the visual half-field technique. The stimuli were presented for an unusually short duration (180 msec). Under these conditions, male but not female subjects rated the various female figures as differing in attractiveness. Thus, male judgements of female attractiveness depended on weight and WHR. Reaction time and accuracy scores obtained from male subjects suggested that the left hemisphere (LH) was slower but more accurate than the right hemisphere in detecting differences in the attractiveness of the figures. Additionally, the most attractive figure was detected significantly more accurately than the least attractive figure when the figures were presented to the LH. The findings were discussed in terms of evolutionary views of sex differences in mate selection.

Attachment-based classifications of children's family drawings: psychometric properties and relations with children's adjustment in kindergarten.

PubMed

Pianta, R C; Longmaid, K; Ferguson, J E

1999-06-01

Investigated an attachment-based theoretical framework and classification system, introduced by Kaplan and Main (1986), for interpreting children's family drawings. This study concentrated on the psychometric properties of the system and the relation between drawings classified using this system and teacher ratings of classroom social-emotional and behavioral functioning, controlling for child age, ethnic status, intelligence, and fine motor skills. This nonclinical sample consisted of 200 kindergarten children of diverse racial and socioeconomic status (SES). Limited support for reliability of this classification system was obtained. Kappas for overall classifications of drawings (e.g., secure) exceeded .80 and mean kappa for discrete drawing features (e.g., figures with smiles) was .82. Coders' endorsement of the presence of certain discrete drawing features predicted their overall classification at 82.5% accuracy. Drawing classification was related to teacher ratings of classroom functioning independent of child age, sex, race, SES, intelligence, and fine motor skills (with p values for the multivariate effects ranging from .043-.001). Results are discussed in terms of the psychometric properties of this system for classifying children's representations of family and the limitations of family drawing techniques for young children.

Gay male attraction toward muscular men: does mating context matter?

PubMed

Varangis, Eleanna; Lanzieri, Nicholas; Hildebrandt, Tom; Feldman, Matthew

2012-03-01

The purpose of this study was to examine gay men's perceived attractiveness of male figures based on short-term and long-term partner contexts. A sample of 190 gay adult men rated the attractiveness of line-drawings depicting male figures varying systematically in muscularity and body fat percentage in both short-term and long-term dating contexts. Mixed effects modeling was used to estimate the effects of figure (muscularity and body fat), dating context (short-term vs. long-term), and individual rater characteristics on attractiveness ratings. Results indicated that figure muscularity and body-fat had significant non-linear (i.e., quadratic) relationships with attractiveness ratings, and short-term dating context was associated with more discriminating ratings of attractiveness. Interactions between individual characteristics and figure characteristics indicated that the more available the individual and lower body fat, the more discriminating they were in ratings of attractiveness. The implications for future investigations considering both object and observer characteristics of attractiveness preferences are discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.

Familiar shapes attract attention in figure-ground displays.

PubMed

Nelson, Rolf A; Palmer, Stephen E

2007-04-01

We report five experiments that explore the effect of figure-ground factors on attention. We hypothesized that figural cues, such as familiar shape, would draw attention to the figural side in an attentional cuing task using bipartite figure-ground displays. The first two experiments used faces in profile as the familiar shape and found a perceptual advantage for targets presented on the meaningful side of the central contour in detection speed (Experiment 1) and discrimination accuracy (Experiment 2). The third experiment demonstrated the figural advantage in response time (RT) with nine other familiar shapes (including a sea horse, a guitar, a fir tree, etc.), but only when targets appeared in close proximity to the contour. A fourth experiment obtained a figural advantage in a discrimination task with the larger set of familiar shapes. The final experiment ruled out eye movements as a possible confounding factor by replicating the RT advantage for targets on the figural side of face displays when all trials containing eye movements were eliminated. The results are discussed in terms of ecological influences on attention, and are cast within the framework of Yantis and Jonides's hypothesis that attention is exogenously drawn to the onset of new perceptual objects. We argue that the figural side constitutes an "object" whereas the ground side does not, and that figural cues such as shape familiarity are effective in determining which areas represent objects.

30 CFR 18.80 - Approval of machines assembled with certified or explosion-proof components.

Code of Federal Regulations, 2014 CFR

2014-07-01

... approved machines will be accepted in lieu of certified components. (b) A single layout drawing (see Figure... approval. A design of the approval plate will accompany the notification of approval. (Refer to §§ 18.10...

Inhibitory competition between shape properties in figure-ground perception.

PubMed

Peterson, Mary A; Skow, Emily

2008-04-01

Theories of figure-ground perception entail inhibitory competition between either low-level units (edge or feature units) or high-level shape properties. Extant computational models instantiate the 1st type of theory. The authors investigated a prediction of the 2nd type of theory: that shape properties suggested on the ground side of an edge are suppressed when they lose the figure-ground competition. In Experiment 1, the authors present behavioral evidence of the predicted suppression: Object decisions were slower for line drawings that followed silhouettes suggesting portions of objects from the same rather than a different category on their ground sides. In Experiment 2, the authors reversed the silhouette's figure-ground relationships and obtained speeding rather than slowing in the same category condition, thereby demonstrating that the Experiment 1 results reflect suppression of those shape properties that lose the figure-ground competition. These experiments provide the first clear empirical evidence that figure-ground perception entails inhibitory competition between high-level shape properties and demonstrate the need for amendments to existing computational models. Furthermore, these results suggest that figure-ground perception may itself be an instance of biased competition in shape perception. (Copyright) 2008 APA, all rights reserved.

Mechanical Drawing of Gas Sensors on Paper

PubMed Central

Mirica, Katherine A.; Weis, Jonathan G.; Schnorr, Jan M.; Esser, Birgit

2012-01-01

This communication describes a simple solvent-free method for fabricating chemoresistive gas sensors on the surface of paper. The method involves mechanical abrasion of compressed powders of sensing materials on the fibers of cellulose. We illustrate this approach by depositing conductive layers of several forms of carbon (e.g., single-walled carbon nanotubes [SWCNTs], multi-walled carbon nanotubes, and graphite) on the surface of different papers (Figure 1, Figure S1). The resulting sensors based on SWCNTs are capable of detecting NH3 gas at concentrations as low as 0.5 part-per-million. PMID:23037938

The ambivalence of the maternal body: psychoanalytic readings of the legend of Van Gogh.

PubMed

Pollock, G

1994-08-01

This article aims to identify the collective social investment in 'Van Gogh' as a cultural icon, and to ask what function his life story, colourfully illustrated by his art work, has performed in the West since the 1890s. It argues that the life and work of a Dutch artist have become the raw materials for a series of secular 'mystery' plays and christological psychodramas that reflect the ills of twentieth-century experience. The key moments when Van Gogh was made into a figure in a popular imagination were psychologically significant: the Depression and the immediate aftermath of World War II. 'Van Gogh', a fantasy figure of modern man, has been over-'psychologised', his work becoming only the testament to the myth of modern man. Using social-art-historical techniques, the author tries to distance this kind of reading in the case of one drawing of a peasant woman, bending over. Situating the fantasy that the drawing services in precise social and historical terms of bourgeois men formed in childhood in relation to a split feminine/maternal figure of the lady/mother and the working-class nursemaid, the article examines how to use psychoanalysis to read the formal oddities of the work--distortion and monumentality, attention to a fragmented, eroticised but also punished body--for the oscillation between pre-oedipal fantasies of maternal plenitude and awe and oedipal anxieties which sadistically inflict humiliation on the maternal body. Finally, instead of producing Van Gogh as the extreme case of an 'other', the author recognises the drawing as a space where present fantasies of the reader encounter those of the producer. Psychoanalysis informing historically-precise interpretation becomes a demythologising hermeneutic.

The development of preferences for specific body shapes.

PubMed

Connolly, Jennifer M; Slaughter, Virginia; Mealey, Linda

2004-02-01

Research with adults has shown a preference for average-weight female figures with waist-to-hip ratios (WHR) of 0.7, and average weight male figures with waist-to-hip ratios of 0.9. This study investigated the development of preferences for WHR sizes as well as preferences for specific body weights. Five-hundred eleven children ranging in age from 6 to 17 were presented with drawings of 12 male and 12 female silhouettes varying in weight and WHR and asked to select one they thought looked the nicest or most attractive. The youngest children showed preferences for the underweight figures, changing to consistent preferences for the average weight figures in the teenage years. The developmental curves for waist-to-hip ratio preferences were linear, changing gradually over time to become more adult-like. Potential developmental models for the development of preferences for specific body shapes are considered in relation to these data.

Reading a standing wave: figure-ground-alternation masking of primes in evaluative priming.

PubMed

Bermeitinger, Christina; Kuhlmann, Michael; Wentura, Dirk

2012-09-01

We propose a new masking technique for masking word stimuli. Drawing on the phenomena of metacontrast and paracontrast, we alternately presented two prime displays of the same word with the background color in one display matching the font color in the other display and vice versa. The sequence of twenty alterations (spanning approx. 267 ms) was sandwich-masked by structure masks. Using this masking technique, we conducted evaluative priming experiments with positive and negative target and prime words. Significant priming effects were found - for primes and targets drawn from the same as well as from different word sets. Priming effects were independent of prime discrimination performance in direct tests and they were still significant after the sample was restricted to those participants who showed random responding in the direct test. Copyright © 2012 Elsevier Inc. All rights reserved.

Arctic Craft Demonstration Report

DTIC Science & Technology

2012-11-01

equivalent to a domestic lifeboat.” Figure 1. ARKTOS evacuation craft drawing. The ARKTOS consists of a permanently linked pair of laminated e...glass/ Kevlar -hybrid hulls. On land motive power is provided by a track system, and water jets for propulsion in the water. Each hull is independently

The Dynamic Discograph.

ERIC Educational Resources Information Center

Bell, Garry

1991-01-01

Mechanical devices offer an alternative to computers to explore mathematical concepts in different curricula areas. Described is the discograph, a series of pulleys and wheels, that can be used to teach mathematical principles in pattern drawing, locus, rotation in geared systems, gearing, rotational symmetry, regular plane figures, decimal, and…

Ride or Die

ERIC Educational Resources Information Center

Denmead, Tyler; Brown, Ruth-Nicole

2014-01-01

In this Instructional Resource, Denmead and Brown consider how "Ruffneck Constructivists," an exhibition curated by Kara Walker at the Institute for Contemporary Art (ICA), University of Pennsylvania, can disturb and provoke young creatives and art education more broadly. For this exhibition, Walker draws on the figure that MC Lyte…

Masculine somatotype and hirsuteness as determinants of sexual attractiveness to women.

PubMed

Dixson, Alan F; Halliwell, Gayle; East, Rebecca; Wignarajah, Praveen; Anderson, Matthew J

2003-02-01

Five questionnaire studies asked women to rate the attractiveness of outline drawings of male figures that varied in somatotype, body proportions, symmetry, and in distribution of trunk hair. In Study 1, back-posed figures of mesomorphic (muscular) somatotypes were rated as most attractive, followed by average, ectomorphic (slim), and endomorphic (heavily built) figures by both British and Sri Lankan women. In Study 2, computer morphing of somatotypes to produce an intergraded series resulted in a graded response in terms of perceived attractiveness which mirrored the findings of Study 1. In Study 3, back-posed figures were manipulated in order to change waist-to-hip ratios (WHR) and waist-to-shoulder ratios (WSR). A WHR of 0.8-0.9 and a WSR of 0.6 were rated as most attractive and these effects were more pronounced when modeling mesomorphic figures. In Study 4, symmetric figures of a mesomorphic somatotype were rated as less attractive than a normal (asymmetric) version of the same man. Study 5 showed that presence of trunk hair had a marked, positive effect upon women's ratings of attractiveness for both mesomorphic and endomorphic male figures. Women also judged figures with trunk hair as being older and they consistently rated endomorphic figures as being older than mesomorphs. These results are consistent with effects of sexual selection upon visual signals that advertise health, physical prowess, age, and underlying endocrine condition in the human male.

The use of children's drawings in the evaluation and treatment of child sexual, emotional, and physical abuse.

PubMed

Peterson, L W; Hardin, M; Nitsch, M J

1995-05-01

Primary care physicians can be instrumental in the initial identification of potential sexual, emotional, and physical abuse of children. We reviewed the use of children's artwork as a method of communicating individual and family functioning. A quantitative method of analyzing children's artwork provides more reliability and validity than some methods used previously. A new scoring system was developed that uses individual human figure drawings and kinetic family drawings. This scoring system was based on research with 842 children (341 positively identified as sexually molested, 252 positively not sexually molested but having emotional or behavioral problems, and 249 "normal" public school children). This system is more comprehensive than previous systems of assessment of potential abuse.

The impact of culture and education on non-verbal neuropsychological measurements: a critical review.

PubMed

Rosselli, Mónica; Ardila, Alfredo

2003-08-01

Clinical neuropsychology has frequently considered visuospatial and non-verbal tests to be culturally and educationally fair or at least fairer than verbal tests. This paper reviews the cross-cultural differences in performance on visuoperceptual and visuoconstructional ability tasks and analyzes the impact of education and culture on non-verbal neuropsychological measurements. This paper compares: (1) non-verbal test performance among groups with different educational levels, and the same cultural background (inter-education intra-culture comparison); (2) the test performance among groups with the same educational level and different cultural backgrounds (intra-education inter-culture comparisons). Several studies have demonstrated a strong association between educational level and performance on common non-verbal neuropsychological tests. When neuropsychological test performance in different cultural groups is compared, significant differences are evident. Performance on non-verbal tests such as copying figures, drawing maps or listening to tones can be significantly influenced by the individual's culture. Arguments against the use of some current neuropsychological non-verbal instruments, procedures, and norms in the assessment of diverse educational and cultural groups are discussed and possible solutions to this problem are presented.

Show Me a Sign

ERIC Educational Resources Information Center

Wilson, Johnnie

2012-01-01

According to the author, much of their math teaching is through pictures and words. They write number sentences, they draw geometric figures, and they talk about math. The representations they use--numbers, shapes, operators, and mathematics vocabulary--make it possible for them to learn and communicate mathematical ideas. These representations…

Reading Exercises on Mexican Americans.

ERIC Educational Resources Information Center

Almaraz, Felix D., Jr.; Almaraz, Maria O.

Short biographical sketches and drawings of 30 prominent Mexican Americans are presented in this book of reading exercises. Written on a fourth or fifth grade level, the book includes figures representing a variety of occupations and fields of achievement: the arts, sports, business, journalism, education, entertainment, literature, medicine, law,…

Neurons forming optic glomeruli compute figure-ground discriminations in Drosophila.

PubMed

Aptekar, Jacob W; Keleş, Mehmet F; Lu, Patrick M; Zolotova, Nadezhda M; Frye, Mark A

2015-05-13

Many animals rely on visual figure-ground discrimination to aid in navigation, and to draw attention to salient features like conspecifics or predators. Even figures that are similar in pattern and luminance to the visual surroundings can be distinguished by the optical disparity generated by their relative motion against the ground, and yet the neural mechanisms underlying these visual discriminations are not well understood. We show in flies that a diverse array of figure-ground stimuli containing a motion-defined edge elicit statistically similar behavioral responses to one another, and statistically distinct behavioral responses from ground motion alone. From studies in larger flies and other insect species, we hypothesized that the circuitry of the lobula--one of the four, primary neuropiles of the fly optic lobe--performs this visual discrimination. Using calcium imaging of input dendrites, we then show that information encoded in cells projecting from the lobula to discrete optic glomeruli in the central brain group these sets of figure-ground stimuli in a homologous manner to the behavior; "figure-like" stimuli are coded similar to one another and "ground-like" stimuli are encoded differently. One cell class responds to the leading edge of a figure and is suppressed by ground motion. Two other classes cluster any figure-like stimuli, including a figure moving opposite the ground, distinctly from ground alone. This evidence demonstrates that lobula outputs provide a diverse basis set encoding visual features necessary for figure detection. Copyright © 2015 the authors 0270-6474/15/357587-13$15.00/0.

Pupils' over-reliance on linearity: a scholastic effect?

PubMed

Van Dooren, Wim; De Bock, Dirk; Janssens, Dirk; Verschaffel, Lieven

2007-06-01

From upper elementary education on, children develop a tendency to over-use linearity. Particularly, it is found that many pupils assume that if a figure enlarges k times, the area enlarges k times too. However, most research was conducted with traditional, school-like word problems. This study examines whether pupils also over-use linearity if non-linear problems are embedded in meaningful, authentic performance tasks instead of traditional, school-like word problems, and whether this experience influences later behaviour. Ninety-three sixth graders from two primary schools in Flanders, Belgium. Pupils received a pre-test with traditional word problems. Those who made a linear error on the non-linear area problem were subjected to individual interviews. They received one new non-linear problem, in the S-condition (again a traditional, scholastic word problem), D-condition (the same word problem with a drawing) or P-condition (a meaningful performance-based task). Shortly afterwards, pupils received a post-test, containing again a non-linear word problem. Most pupils from the S-condition displayed linear reasoning during the interview. Offering drawings (D-condition) had a positive effect, but presenting the problem as a performance task (P-condition) was more beneficial. Linear reasoning was nearly absent in the P-condition. Remarkably, at the post-test, most pupils from all three groups again applied linear strategies. Pupils' over-reliance on linearity seems partly elicited by the school-like word problem format of test items. Pupils perform much better if non-linear problems are offered as performance tasks. However, a single experience does not change performances on a comparable word problem test afterwards.

Multimodal Self-Authoring across Bi/Multilingual Educator and Student Learning Spaces

ERIC Educational Resources Information Center

Valdez, Verónica E.; Omerbašic, Delila

2015-01-01

Drawing on sociocultural perspectives, this article illustrates the potential for extending figured worlds through cultural artifacts. Using thematic and multimodal analysis, the authors first compare how spaces of authoring were produced in two professional development settings: Proyecto Bilingüe and Critical Education Studies. Following one…

Information Processing Analysis of Visual Perception: A Review

DTIC Science & Technology

1974-06-01

cartoon ( Wittgenstein ,!953), and Boring’s Young Woman/Old Hag (Boring.l 942) drawing, as well as examples of figure-ground confusions which are all...8217, New York. WINSTON,^ (1970) ’Learning Structural Descripi,ons from Examples’, MIT Al i.ab. WITTGENSTEIN , L.W. (1 953) ’Philosophical Investigations

Education and Emigration: The Case of the Iranian-American Community

ERIC Educational Resources Information Center

Mossayeb, Sina M.; Shirazi, Roozbeh

2006-01-01

This paper explores the plausibility of a hypothesis that puts forth perceived educational opportunity as a significant pull factor influencing Iranians' decisions to immigrate to the United States. Drawing on various literatures, including research on educational policy in Iran, government policy papers, and figures from recent studies and census…

In Search of a Hero, in Search of Self

ERIC Educational Resources Information Center

Jolley, Susan Arpajian

2007-01-01

In this article, the author vitalizes her British literature course by asking seniors to investigate, through an I-Search paper, the concept of heroism. Students research a historic or contemporary individual, drawing on their understanding of heroic literary figures previously studied, and interview family, community members, and others connected…

Computer-Generated Diagrams for the Classroom.

ERIC Educational Resources Information Center

Carle, Mark A.; Greenslade, Thomas B., Jr.

1986-01-01

Describes 10 computer programs used to draw diagrams usually drawn on chalkboards, such as addition of three vectors, vector components, range of a projectile, lissajous figures, beats, isotherms, Snell's law, waves passing through a lens, magnetic field due to Helmholtz coils, and three curves. Several programming tips are included. (JN)

Scale Model of 9x6 Thermal Structures Tunnel

NASA Image and Video Library

1960-07-19

Scale Model of 9x6 Thermal Structures Tunnel: Image L-7256.01 is a Drawing Figure 12 in NASA Document L-1265. The Major components of the 9-by6-Foot Thermal Structures Tunnel. The 97 foot-long diffuser was added in 1960 to reduce noise.

A Longitudinal Study of Psychological Differentiation In Nigerian Children.

ERIC Educational Resources Information Center

Jegede, R. Olukayode; Bamgboye, E. Afolabi

1983-01-01

Presents results of a three-year follow-up study of the development of psychological differentiation in Nigerian children. Human figure drawings made in 1974 and 1977 by 204 subjects aged 7 to 14 years were analyzed using Witkins Articulation of Body Concept scale and compared. (Author/RH)

Advanced Cyber Attack Modeling Analysis and Visualization

DTIC Science & Technology

2010-03-01

Graph Analysis Network Web Logs Netflow Data TCP Dump Data System Logs Detect Protect Security Management What-If Figure 8. TVA attack graphs for...Clustered Graphs,” in Proceedings of the Symposium on Graph Drawing, September 1996. [25] K. Lakkaraju, W. Yurcik, A. Lee, “NVisionIP: NetFlow

Preliminary Investigation of the Shock-Boundary Layer Interaction in a Simulated Fan Passage

DTIC Science & Technology

1991-03-01

unlimited 2b DECLASSIFICATION/DOWNGRADING SCHEDULE 4 PERFORMING ORGANIZATION REPORT NUMBER(S) 5 MONITORING ORGANIZATION REPORT NUMBER(S) 6a NAME OF...Figure 4. Vortex Generator Jets Configuration [Ref. 2] 27 Figure 5 . Cascade Geometry 28 Figure 6. Schematic of Transonic Cascade Wind Tunnel 29 Figure 7... 65 Figure A9. Test Section Top Blade 66 Figure A1O. Test Section Middle Blade 67 Figure A 11. Test Section Lower Blade 68 Figure A12. Pressure Tap

FLOWCHART; a computer program for plotting flowcharts

USGS Publications Warehouse

Bender, Bernice

1982-01-01

The computer program FLOWCHART can be used to very quickly and easily produce flowcharts of high quality for publication. FLOWCHART centers each element or block of text that it processes on one of a set of (imaginary) vertical lines. It can enclose a text block in a rectangle, circle or other selected figure. It can draw a 'line connecting the midpoint of any side of any figure with the midpoint of any side of any other figure and insert an arrow pointing in the direction of flow. It can write 'yes' or 'no' next to the line joining two figures. FLOWCHART creates flowcharts using some basic plotting subroutine* which permit plots to be generated interactively and inspected on a Tektronix compatible graphics screen or plotted in a deferred mode on a Houston Instruments 42' pen plotter. The size of the plot, character set and character height in inches are inputs to the program. Plots generated using the pen plotter can be up to 42' high--the larger size plots being directly usable as visual aids in a talk. FLOWCHART centers each block of text on an imaginary column line. (The number of columns and column width are specified as input.) The midpoint of the longest line of text within the block is defined to be the center of the block and is placed on the column line. The spacing of individual words within the block is not altered when the block is positioned. The program writes the first block of text in a designated column and continues placing each subsequent block below the previous block in the same column. A block of text may be placed in a different column by specifying the number of the column and an earlier block of text with which the new block is to be aligned. If block zero is given as the earlier block, the new text is placed in the new column continuing down the page below the previous block. Optionally a column and number of inches from the top of the page may be given for positioning the next block of text. The program will normally draw one of five types of figure to enclose a block of text: a rectangle, circle, diamond, eight sided figure or figure with parallel sides and rounded ends. It can connect the figure with a line to the preceding figure, and place an arrow pointing toward the second figure. Text blocks not in sequence can also be connected and 'yes' or 'no' written next to any line to indicate branching. Figure 1 illustrates the various types of figures that can be drawn, spacings, connecting lines and the like. * The plotting package employed is Buplot available on the VAX and PDP-1170 computers at the USGS Office of Earthquake Studies, Golden, Colo. Calls to the plotting subroutines must be adjusted if some other plotting package is used.

Aging, body image, and body shape.

PubMed

Ferraro, F Richard; Muehlenkamp, Jennifer J; Paintner, Ashley; Wasson, Kayla; Hager, Tracy; Hoverson, Fallon

2008-10-01

Participants were 25 older men (M age = 72 years, SD = 10 years) and 27 older women (M age = 71 years, SD = 8 years) who examined multiple line-drawing figures of babies, children, young adults, middle-aged adults, and older adults. Participants picked a number on a Likert-type scale ranging from 1 (very thin) to 9 (very obese) in response to questions including "Which is the most attractive?" and "Which figure would you most like to look like?" They also completed questionnaires about their body image and body shape. In response to the age-specific line drawings (e.g., those depicting older men and older women), older women endorsed thinner figures (e.g., picked smaller numbers) than did men. Likewise, older women reported thinking more about their body shape and appearance than did men and perceived their body image as "a little too big" in comparison with the older men who perceived their body image as "just the right size." However, a breakdown of normal and overweight women in this sample revealed that for some overweight elderly women, obesity could become a satisfactory way of life. Much as with college-aged women, the endorsement of a thinner body image by many of the older adult female participants appeared to persist into late adulthood and suggests that research into body image issues with older adults is relevant and necessary.

Effects of audience awareness on procedural text writing.

PubMed

Sato, Koichi; Matsushima, Kazutoshi

2006-08-01

Effects of audience awareness were examined. Some participants acted as writers and the others acted as readers. Writers wrote a text describing a geometrical figure. Readers read the text and tried to draw the figure according to the description. In Exp. 1, audience awareness was manipulated among undergraduate students, 11 men and 34 women. Writers in the high audience-awareness condition spent more time planning and writing texts than writers in the low audience-awareness condition. Texts in the high audience-awareness condition consisted of more letters and sentences with descriptions elaborating the texts. In Exp. 2, prototype texts were constructed based on the results of Exp. 1. Undergraduate students, 11 men and 47 women, who read the prototype text in the high audience-awareness condition could draw the figure more accurately. In Exp. 3, effects of feedback from readers were examined. Ninth-grade students, 22 boys and 34 girls, participated as writers and 7th-grade students, 22 boys and 34 girls, participated as readers. Merely being told to attend to an audience did not improve the quality of texts written by 9th-grade students. However, feedback from the readers who were 7th-grade students was effective. Writers could revise the texts appropriately according to feedback and improve the quality of texts. In addition, the experience of revising the text according to feedback transferred to later writing. Educational implications of the results are discussed.

Evaluation of 25-Percent ATJ Fuel Blends in the John Deere 4045HF 280 Engine

DTIC Science & Technology

2014-08-01

25% ATJ Blend ........ 26 Figure 16 . THC Emissions, Pre-Test, Ambient Temperature ...................................................... 28 Figure...17 . THC Emissions, Pre-Test, Desert Temperature ......................................................... 28 Figure 18 . NOx Emissions, Pre-Test...Emissions, Pre-Test, Desert Temperature (Scaled) ............................................. 32 Figure 23 . THC Emissions, Post-Test, Ambient

What Makes Fusion Cells Effective?

DTIC Science & Technology

2009-12-01

83 Figure 18. Breusch - Pagan Test for Overall Model ...........................................................83 Figure 19. Ramsey Test for Overall...Probability Norm for DoD Model IV5 ............................................................89 Figure 31. Breusch - Pagan Test for DoD Model... Breusch - Pagan Test for State and Local Model ..............................................95 Figure 45. Ramsey Test for State and Local Model

[State of health, eating and body image disorders among employees in the beauty industry].

PubMed

Lukács-Márton, Réka; Szabó, Pál

2013-04-28

Beauticians are considered as risk populations for eating disorders and body image disorders, as their work is closely related to beauty and fashion. The aim of the authors was to examine whether eating and body image disorders occur more frequently among beauticians than in control subjects. Eating disorders were assessed using the Eating Attitudes Test, Eating Behaviour Severity Scale, and body image measures included the Human Figure Drawings Test, the Body Dissatisfaction Subscale of the Eating Disorders Inventory, the Body Attitudes Test, and the Body Investment Scale. The study sample included 56 beauticians from Transylvania and 59 from Hungary. These groups were compared with control groups including 57 subjects from Transylvania and 54 subjects from Hungary. Questionnaire data were analysed. The occurrence of weight reducing methods such as binge eating was significantly more prevalent in the beautician groups than in controls. Subclinical eating disorders were more frequent in the Transylvanian beautician group. Clinical and subclinical eating disorders occur more frequently in beauticians than in control subjects.

Entering the Arena: The Figured Worlds Transition of Preservice Teachers

ERIC Educational Resources Information Center

Saunders, Jane M.; Ash, Gwynne Ellen

2013-01-01

The article describes a semester-long project that draws on Suzanne Collins' "The Hunger Games" as a resource and over-arching theme for preservice teachers taking a content area literacy course. We examine how preservice teachers learn to connect written texts to content area (disciplinary) literacy and consider ways to prepare them for…

A Picture Is Worth Less than a Thousand Words: Response to Reviewers.

ERIC Educational Resources Information Center

Motta, Robert W.; And Others

1993-01-01

Responds to reviewers of authors' previous article (Motta, Little, and Tobin, this issue) which reviewed data-based studies on figure drawings and found little support for their validity or use in assessing personality, behavior, emotion, or intellectual functioning. Defends position of original article and addresses issues raised by reviewers.…

Felix Klein and the NCTM's Standards: A Mathematician Considers Mathematics Education.

ERIC Educational Resources Information Center

McComas, Kim Krusen

2000-01-01

Discusses the parallels between Klein's position at the forefront of a movement to reform mathematics education and that of the National Council of Teachers of Mathematics' (NCTM) Standards. Draws a picture of Klein as an important historical figure who saw equal importance in studying pure mathematics, applying mathematics, and teaching…

Authoring Multiple "Formas de ser": Three Bilingual Latino/a Fifth Graders Navigating School

ERIC Educational Resources Information Center

Cuero, Kimberley K.

2009-01-01

Drawing from sociocultural and anthropological perspectives, I present 3 case examples of bilingual, Mexican-origin students enrolled in a transitional bilingual educational program in an urban elementary school. By using the theoretical constructs of figured worlds, authoring, and "formas de ser" (ways of being), I examine how student identities…

Secret Snowflake: Analysis of a Holiday Gift Exchange

ERIC Educational Resources Information Center

Turton, Roger W.

2007-01-01

This article describes several methods from discrete mathematics used to simulate and solve an interesting problem occurring at a holiday gift exchange. What is the probability that two people will select each other's names in a random drawing, and how does this result vary with the total number of participants? (Contains 5 figures.)

Characterization of Rain Attenuation and Depolarization at W/V Bands

DTIC Science & Technology

2015-07-30

AIR FORCE BASE , NM 87117-5776 DTIC COPY NOTICE AND SIGNATURE PAGE Using Government drawings, specifications, or other data included in this...WITH ASSIGNED DISTRIBUTION STATEMENT. //SIGNED// //SIGNED// STEVEN A. LANE PAUL HAUSGEN, Ph.D. Program Manager Technical Advisor, Space Based Advanced... Stations ........................................................................................ 11  Figure 3. Transmitter Block Diagram

Teaching Conversations, Contemporary Art, and Figure Drawing

ERIC Educational Resources Information Center

Graham, Mark A.

2012-01-01

An important problem for high school art teachers is deciding what belongs in the art curriculum. What works of art, media, or ideas will inspire their students to more fully develop their own artistic potential and critically engage with contemporary art and culture? What artifacts of art, visual culture, or material culture should be included…

General Sales Taxation. National Education Association Search.

ERIC Educational Resources Information Center

National Education Association, Washington, DC. Research Div.

The third in a series on school finance, this report describes state sales tax practices that, when coupled with individual income and property taxes, add stability and diversity to the local tax system from which public education draws its support. Figures and tables illustrate: the percent of state and local government expenditures for selected…

Adult and Child Identities in Irish Primary Schools, c.1830-1909

ERIC Educational Resources Information Center

Dolan, Paddy

2016-01-01

Drawing on teaching manuals, government reports and school inspectors' reports from the 1830s up to the early twentieth century, this paper traces the changing conceptual and social distance between childhood and adulthood in Ireland. Using Norbert Elias's figurational approach, it is argued that children became increasingly involved in both…

Association between different phases of menstrual cycle and body image measures of perceived size, ideal size, and body dissatisfaction.

PubMed

Teixeira, André Luiz S; Dias, Marcelo Ricardo C; Damasceno, Vinícius O; Lamounier, Joel A; Gardner, Rick M

2013-12-01

The association between phases of the menstrual cycle and body image was investigated. 44 university women (M age = 23.3 yr., SD = 4.7) judged their perceived and ideal body size, and body dissatisfaction was calculated at each phase of the menstrual cycle, including premenstrual, menstrual, and intermenstrual. Participants selected one of nine figural drawings ranging from very thin to obese that represented their perceived size and ideal size. Body dissatisfaction was measured as the absolute difference between scores on perceived and ideal figural drawings. During each menstrual phase, anthropometric measures of weight, height, body mass index, circumference of waist and abdomen, and body composition were taken. There were no significant differences in any anthropometric measures between the three menstrual cycle phases. Perceived body size and body dissatisfaction were significantly different between menstrual phases, with the largest perceived body size and highest body dissatisfaction occurring during the menstrual phase. Ideal body size did not differ between menstrual phases, although participants desired a significantly smaller ideal size as compared to the perceived size.

Human figure drawings and children's recall of touching.

PubMed

Bruck, Maggie

2009-12-01

In 2 studies, children ages 3 to 7 years were asked to recall a series of touches that occurred during a previous staged event. The recall interview took place 1 week after the event in Study 1 and immediately after the event in Study 2. Each recall interview had 2 sections: In 1 section, children were given human figure drawings (HFDs) and were asked to show where the touching took place; in the other section, the same questions were asked without the HFDs (verbal condition). Children were randomly assigned to 2 different conditions: HFD 1st/verbal 2nd or verbal 1st/HFD 2nd. There were 2 major findings. First, HFDs elicited more errors than the verbal condition when used to probe for information that the child had already been asked. Second, regardless of interview method, children had poor recall of the touches even when these occurred minutes before the interview. It is suggested that cognitive mechanisms involving memory and semantics underlie children's poor recall of touching in both verbal and HFD conditions. Copyright 2009 APA

Human Figure Drawings and Children’s Recall of Touching

PubMed Central

Bruck, Maggie

2010-01-01

In 2 studies, children ages 3 to 7 years were asked to recall a series of touches that occurred during a previous staged event. The recall interview took place 1 week after the event in Study 1 and immediately after the event in Study 2. Each recall interview had 2 sections: In 1 section, children were given human figure drawings (HFDs) and were asked to show where the touching took place; in the other section, the same questions were asked without the HFDs (verbal condition). Children were randomly assigned to 2 different conditions: HFD 1st/verbal 2nd or verbal 1st/HFD 2nd. There were 2 major findings. First, HFDs elicited more errors than the verbal condition when used to probe for information that the child had already been asked. Second, regardless of interview method, children had poor recall of the touches even when these occurred minutes before the interview. It is suggested that cognitive mechanisms involving memory and semantics underlie children’s poor recall of touching in both verbal and HFD conditions. PMID:20025421

Meta-analysis of studies assessing the efficacy of projective techniques in discriminating child sexual abuse.

PubMed

West, M M

1998-11-01

This meta-analysis of 12 studies assesses the efficacy of projective techniques to discriminate between sexually abused children and nonsexually abused children. A literature search was conducted to identify published studies that used projective instruments with sexually abused children. Those studies that reported statistics that allowed for an effect size to be calculated, were then included in the meta-analysis. There were 12 studies that fit the criteria. The projectives reviewed include The Rorschach, The Hand Test, The Thematic Apperception Test (TAT), the Kinetic Family Drawings, Human Figure Drawings, Draw Your Favorite Kind of Day, The Rosebush: A Visualization Strategy, and The House-Tree-Person. The results of this analysis gave an over-all effect size of d = .81, which is a large effect. Six studies included only a norm group of nondistressed, nonabused children with the sexual abuse group. The average effect size was d = .87, which is impressive. Six studies did include a clinical group of distressed nonsexually abused subjects and the effect size lowered to d = .76, which is a medium to large effect. This indicates that projective instruments can discriminate distressed children from nondistressed subjects, quite well. In the studies that included a clinical group of distressed children who were not sexually abused, the lower effect size indicates that the instruments were less able to discriminate the type of distress. This meta-analysis gives evidence that projective techniques have the ability to discriminate between children who have been sexually abused and those who were not abused sexually. However, further research that is designed to include clinical groups of distressed children is needed in order to determine how well the projectives can discriminate the type of distress.

Critical periods of vulnerability for the developing nervous system: evidence from humans and animal models.

PubMed Central

Rice, D; Barone, S

2000-01-01

Vulnerable periods during the development of the nervous system are sensitive to environmental insults because they are dependent on the temporal and regional emergence of critical developmental processes (i.e., proliferation, migration, differentiation, synaptogenesis, myelination, and apoptosis). Evidence from numerous sources demonstrates that neural development extends from the embryonic period through adolescence. In general, the sequence of events is comparable among species, although the time scales are considerably different. Developmental exposure of animals or humans to numerous agents (e.g., X-ray irradiation, methylazoxymethanol, ethanol, lead, methyl mercury, or chlorpyrifos) demonstrates that interference with one or more of these developmental processes can lead to developmental neurotoxicity. Different behavioral domains (e.g., sensory, motor, and various cognitive functions) are subserved by different brain areas. Although there are important differences between the rodent and human brain, analogous structures can be identified. Moreover, the ontogeny of specific behaviors can be used to draw inferences regarding the maturation of specific brain structures or neural circuits in rodents and primates, including humans. Furthermore, various clinical disorders in humans (e.g., schizophrenia, dyslexia, epilepsy, and autism) may also be the result of interference with normal ontogeny of developmental processes in the nervous system. Of critical concern is the possibility that developmental exposure to neurotoxicants may result in an acceleration of age-related decline in function. This concern is compounded by the fact that developmental neurotoxicity that results in small effects can have a profound societal impact when amortized across the entire population and across the life span of humans. Images Figure 2 Figure 3 Figure 4 Figure 5 Figure 6 Figure 8 Figure 9 Figure 12 Figure 14 Figure 16 Figure 17 PMID:10852851

Medical College of Georgia Complex figures in repeated memory testing: a preliminary study of healthy young adults.

PubMed

Yasugi, Mina; Yamashita, Hikari

2010-02-01

The Medical College of Georgia Complex Figures developed as an alternate version of the Rey-Osterrieth Complex Figure for repeated assessments. The aim of this study was to examine whether serial assessment with different figures of the Medical College of Georgia Complex Figures could attenuate the practice effects. 64 volunteers (M age = 20.0 yr., SD = 1.9) from a Japanese university were randomly assigned to Same or Different figure conditions. Participants in the Same figure condition underwent repeated assessment using Figure 1 of the Medical College of Georgia Complex Figures on both trials, whereas participants in the Different figure condition received Figure 1 on first trials and the Figure 2 on second trials over a 1-mo. test-retest interval. While the Same figure condition showed significant improvements at recall, no practice effect was observed in the Different figure condition. The findings indicated that use of different figures may help attenuate practice effects in repeated testing.

Dimensions and Measurements of Debuncher Band 3 and 4 Waveguide-Coax Launchers

DOE Office of Scientific and Technical Information (OSTI.GOV)

Sun, Ding; /Fermilab

2000-09-13

This note is a document about dimensions and measurement results of waveguide-coax launchers (Band 3 and 4) installed on the arrays in debuncher cooling upgrade. Shown in Figure 1 and 5 are schematic drawings of launchers (pick-up) in the cross section along the longitudinal direction (beam direction) of the arrays. The unit in these drawings is inch. Note: although there are upper band and lower band for pickup arrays, the launchers are the same to avoid possible confusion during installation. Launchers for band 3 and 4 kickers were made by Penn-engineering Inc., therefor no schematic drawings are presented in thismore » note. RF Measurements were made on all launchers (port) and printed in hard copies for future reference. Since the measurement results are similar to each other, only a few plots for each type of launcher/band are presented in this document. There are two types of measured S11 parameters. One is the measurement made at the end of design/tuning stage using a launcher and a straight section of band 3 or 4 waveguide terminated with a cone of absorber. I use 'Original' to denote this kind of measurement. As shown in Figure 2, 6, 9 and 12, the original S11 of all launchers are below or around -20 db over the full band 3 or 4. The other type of measurement is the one made after these launchers were installed onto the array including several type N feedthrough or connectors, elbows, waveguide bends (kicker) and magic Ts (kicker) etc. The kicker arrays were terminated with wedges of absorber. During all measurements (pickup array or kicker array) when one launcher was being measured, all other launchers were terminated with 50 ohm terminator. As shown in Figure 3, 4, 7, 8, 10, 11, 13 and 14 these 'final' S11s are around -15 db.« less

Identifying Dental Anxiety in Children's Drawings and correlating It with Frankl's Behavior Rating Scale.

PubMed

Mathur, Jyoti; Diwanji, Amish; Sarvaiya, Bhumi; Sharma, Dipal

2017-01-01

To develop a simple method to assess the level of anxiety by using children's drawings and correlating them with Frankl's behavior rating scale. A total of 178 patients aged of 3 to 14 years were handed out two-page forms which contained three sections on coloring and drawing, along with general information, and Frankl's behavior rating scale for the visit. The three types of drawing exercises given to the patients were geometric copy drawings, coloring a nonthreatening figure, and an empty sheet for freehand drawing. Out of 178 patients, 60 showed definitely positive behavior, 73 exhibited positive behavior, 37 showed negative behavior, and 8 were definitely negative on Frankl's behavior rating scale; 133 children had none or, 1 stress marker and 45 exhibited 2 or 3 stress markers in their drawings. Chi-square (χ 2 ) analysis was done with a 2 × 2 contingency table. Observed χ 2 value was 46.166, which at 1 degree of freedom was much greater than that at 0.995 percentile. Therefore, the result was highly significant. Children requiring specialized behavioral techniques can be identified by the presence of stress markers in their drawings. This nonverbal activity by itself can have an overall positive effect on the behavior displayed in the dental clinic. Mathur J, Diwanji A, Sarvaiya B, Sharma D. Identifying Dental Anxiety in Children's Drawings and correlating It with Frankl's Behavior Rating Scale. Int J Clin Pediatr Dent 2017;10(1):24-28.

Design of a Helmet Liner for Improved Low Velocity Impact Protection

DTIC Science & Technology

2013-05-01

FIGURE 14. MONORAIL DROP TEST WITH DOT-SIZE C HEADFORM AND HEMISPHERICAL ANVIL ........................... 14  FIGURE 15. ACH PAD CONFIGURATION. LEFT...materials. In this project, the monorail drop test device, used for the helmeted headform drop test, was modified for material testing as shown in Figure...a guided free fall drop test using a monorail drop test apparatus as shown in Figure 14. All helmets tested in this study were ACH-Size Large and

Not Just "Situaciones de la Vida": Professionalization and Indigenous Language Revitalization in the Andes

ERIC Educational Resources Information Center

Hornberger, Nancy H.; Swinehart, Karl F.

2012-01-01

Within discourses of language endangerment, life stages such as child language acquisition, adolescent language shift, and the death of community elders figure prominently, but what of the role of other, intermediate life stages during adulthood and professional life in the course of language obsolescence or revitalization? Drawing from long-term…

49 CFR 572.186 - Abdomen assembly.

Code of Federal Regulations, 2010 CFR

2010-10-01

... part of the dummy assembly shown in drawing 175-0000 including load sensors specified in § 572.189(e... measuring sensor in the abdomen as shown in Figure U5; (5) The impactor impacts the dummy's abdomen at 4.0 m... of the forces of the three abdominal load sensors, specified in 572.189(e), shall be not less than...

Painting a Data-Rich Picture

ERIC Educational Resources Information Center

Earl, Lorna; Katz, Steven

2005-01-01

Using data for school reform is like painting a series of pictures--pictures that are subtle and capture the nuances of the subject. This is a far cry from drawing stick figures or paint-by-numbers. Imagine the experiences of the French painter Claude Monet as he wandered through his garden at Giverny at different times of the day and year,…

Identity and Literacy Practices in a Bilingual Classroom: An Exploration of Leveraging Community Cultural Wealth

ERIC Educational Resources Information Center

Lynch, Anissa Wicktor

2018-01-01

This case study focused on transitional bilingual class and explored connections between the literacy practices co-constructed in this figured world and one student's developing identity. Yanet, a newcomer student from Cuba, was encouraged to draw on community cultural wealth to support her own and her classmates' language, literacy and identity…

Engineering Drawing Practices - Volume I of II: Aerospace and Ground Support Equipment

NASA Technical Reports Server (NTRS)

Schwindt, Paul A.

2015-01-01

This manual establishes the essential requirements and reference documents for the preparation and revision of digital product definition data sets prepared for or by NASA at KSC. This volume is only applicable to KSC in-house programs/projects. These requirements do not apply to the preparation of illustrations, artwork, or figures in technical publications.

Body Image Concerns in College-Aged Male Physical Education Students: A Descriptive Inquiry

ERIC Educational Resources Information Center

Olson, Michele S.; Esco, Michael R.; Willifo, Hank

2009-01-01

The purpose of this study was to examine body image concerns in college-aged male physical education majors. Sixty volunteers completed validated body image instruments including two-dimensional figure drawings. In general, the sample reported that they preferred a larger, more muscular physique reflective of male images that currently abound the…

Heritage Language Education: A Proposal for the Next 50 Years

ERIC Educational Resources Information Center

Carreira, Maria; Kagan, Olga

2018-01-01

This article discusses ideas that will likely figure prominently in the development of the field of heritage language (HL) studies over the next five decades. Drawing on the ideals that prompted the launch of the Heritage Language Initiative 20 years ago and building on the accomplishments of the field since then, we make several proposals for…

40 CFR 89.419 - Dilute gaseous exhaust sampling and analytical system description.

Code of Federal Regulations, 2010 CFR

2010-07-01

...) Continuous HC measurement system. (i) The continuous HC sample system (as shown in Figure 2 or 3 in appendix... this is not required. (ii) No other analyzers may draw a sample from the continuous HC sample probe... continuous HC sampling system shall consist of a probe (which must raise the sample to the specified...

A Creative Approach to the Common Core Standards: The Da Vinci Curriculum

ERIC Educational Resources Information Center

Chaucer, Harry

2012-01-01

"A Creative Approach to the Common Core Standards: The Da Vinci Curriculum" challenges educators to design programs that boldly embrace the Common Core State Standards by imaginatively drawing from the genius of great men and women such as Leonardo da Vinci. A central figure in the High Renaissance, Leonardo made extraordinary contributions as a…

How far can attraction-caused misalignment account for the Morinaga misalignment effect?

PubMed

Hotopf, W H; Brown, S

1990-01-01

When a line (the pointer) is collinear with a dot, the addition of a second line (the induction line) contiguous with the dot or near it may cause the pointer to appear to be collinear with a point further along or nearer to the induction line. The geometrical relations upon which this effect (which we call attraction-caused misalignment) depends, have been studied with the Obonai and Wundt-Loeb (Hotopf, 1981; Hotopf & Brown, 1988) figures. Drawing upon the studies of misalignment in the Morinaga figure carried out by Restle (1976), Day, Bellamy, and Norman (1983), and Day and Kasperczyk (1985), as well as upon two new experiments, we show that misalignment in the Morinaga figure is also attraction-caused misalignment, as previously defined. We conclude with a discussion of a number of theories that aim at accounting for attraction misalignment.

Visuomotor Dissociation in Cerebral Scaling of Size.

PubMed

Potgieser, Adriaan R E; de Jong, Bauke M

2016-01-01

Estimating size and distance is crucial in effective visuomotor control. The concept of an internal coordinate system implies that visual and motor size parameters are scaled onto a common template. To dissociate perceptual and motor components in such scaling, we performed an fMRI experiment in which 16 right-handed subjects copied geometric figures while the result of drawing remained out of sight. Either the size of the example figure varied while maintaining a constant size of drawing (visual incongruity) or the size of the examples remained constant while subjects were instructed to make changes in size (motor incongruity). These incongruent were compared to congruent conditions. Statistical Parametric Mapping (SPM8) revealed brain activations related to size incongruity in the dorsolateral prefrontal and inferior parietal cortex, pre-SMA / anterior cingulate and anterior insula, dominant in the right hemisphere. This pattern represented simultaneous use of a 'resized' virtual template and actual picture information requiring spatial working memory, early-stage attention shifting and inhibitory control. Activations were strongest in motor incongruity while right pre-dorsal premotor activation specifically occurred in this condition. Visual incongruity additionally relied on a ventral visual pathway. Left ventral premotor activation occurred in all variably sized drawing while constant visuomotor size, compared to congruent size variation, uniquely activated the lateral occipital cortex additional to superior parietal regions. These results highlight size as a fundamental parameter in both general hand movement and movement guided by objects perceived in the context of surrounding 3D space.

[Neuropsychological modifications at high altitude: from Pamir to Karakorum].

PubMed

Nardi, Bernardo; Brandoni, Marco; Capecci, Ilaria; Castellani, Simona; Rupoli, Sara; Bellantuono, Cesario

2009-01-01

Neuropsychological modifications and acclimatization processes at over 8000 without auxiliary oxygen were investigated in two climbers, evaluating attentive abilities and matching their performances. During rest in base-camp (4800 m), at other three Resorts - Resort I (5800 m), Resort II (6400 m), Resort III (7200 m) -, and four months after the return at low altitude, were administered: Temporal Orientation Test (TOT), Trail Making Test (TMT), Animal Naming (AN), Verbal Fluency Test (VFT), Arithmetical Judgment Test (AJT), and Drawing Test (DT). Results. At TOT and at AJT, both the climbers demonstrated scores at higher normal levels (Eq = 4) in all the Resorts in which they were performed. They showed an impairment at AN test, especially at Resort III, showing sensitivity of animal naming to hypoxia. At the DT, human figures were reduced in their dimensions and details, as consequence of the tendency to self closure and introversion that occurs at higher altitudes. Neuropsychological functions concerning verbal fluency showed sensitivity to hypoxia, especially at higher altitudes. TMT demonstrated that attentive ability can be preserved if acclimatization is good. Sensitivity to hypoxia and acclimatization processes showed a significant subjective variability. The results of this study show that exposure to high altitude produces some significant neuropsychological changes.

Aerospace Technology: Technical Data and Information on Foreign Test Facilities

DTIC Science & Technology

1990-06-22

effects of an airflow on various active models (nozzles or rotors ) or pas- sive models (airfoils). It is specially dedicated to acoustic testing driven by...Tunnel Figure V.3: Aerospatiale Rotor Test Bench and 99 Microphones Installed Inside Test Chamber of the CEPRA 19 Anechoic Wind Tunnel Figure V.4...Figure V.26: Ground Effect Test on Airbus A320 Model in 127 Test Section of the ONERA S1MA Wind Tunnel Figure V.27: ONERA S3Ch Transonic Wind Tunnel 130

Seabed deposits classification at the Precious Stone Mountain hydrothermal field using MultiBeam sonar data

NASA Astrophysics Data System (ADS)

Tao, C.; Zhang, G.; Li, H.; Zhou, J.; Liu, W.; Deng, X.; Chen, S.

2013-12-01

The seabed deposits type and distribution are very complex at the hydrothermal field. In this paper, we provided an approach to study the seabed deposits classification at the Precious Stone Mountain hydrothermal field (PSMHF) using MultiBeam sonar data (Figure 1). The PSMHF was found in the Galapogas microplate at the Leg 3 of the Chinese COMRA 21st Cruise. Using this approach, the seabed deposits at the PSMHF are mainly classified into three types, which are rock, breccia and sediment, respectively. We can find the distribution of the three types of seabed deposits according to the sonar back-scattering data. The rocks are mostly distributed around the hydrothermal vent. The breccia are located at the foot of the vent. Most sediments are distributed at the southwest to the vent due to bottom current. Combining with seabed video, TV-Grab sample and the backscatter data, we draw the map of the seabed deposits distribution at the PSMHF (Figure 2). Figure 1 The flow chart of the seabed deposits classification approach Figure 2 The seabed deposits distribution of the PSMHF

Nathaniel Everett Green: artist and astronomer

NASA Astrophysics Data System (ADS)

McKim, R. J.

2004-02-01

N. E. Green, a well-known BAA member from the decade of the 1890s, managed to successfully combine his hobby with his profession as a landscape artist and art teacher. One-time drawing master to Queen Victoria, and exhibitor at the Royal Academy, Green became equally famous for his beautiful and realistic drawings of the planets, above all for his expedition to Madeira in 1877 to observe the perihelic opposition of Mars. He inevitably became an important figure in the early martian 'canal debate'. Green was an Original Member of the BAA who twice directed the early Saturn Section, and ultimately served as President in 1896-'98. In this paper Green's life and works are reviewed, together with new details of his instruments and his approach to painting and drawing. Opportunity has been taken to publish some more of his original work, in colour, for the very first time.

Analysis of the effects of overexpression of metallothionein-I in transgenic mice on the reproductive toxicology of cadmium.

PubMed Central

Dalton, T; Fu, K; Enders, G C; Palmiter, R D; Andrews, G K

1996-01-01

Exposure to low levels of cadmium reduces fertility. In male mice spermatogenesis is highly sensitive to cadmium, whereas in females the peri-implantation period of pregnancy is sensitive. To examine the potential roles of the cadmium-binding protein, metallothionein (MT), in the reproductive toxicology of cadmium, we examined a transgenic mouse strain that overexpresses metallothionein-I (MT-I). These mice had dramatically increased steady-state levels of MT-I mRNA and MT in the testes and in the female reproductive tract during the peri-implantation period of pregnancy, and this overexpression occurred in a cell-specific and temporally regulated manner similar to that of the endogenous MT-I gene. Transgenic and control males were injected with cadmium, and the histology of the testes was examined. An injection of 7.5 mumol Cd/kg had no effect on histology of the testes in either transgenic or control mice. In contrast, an injection of 10 mumol Cd/kg caused rapid changes in the histology of the testes and resulted in pronounced testicular necrosis in both control and transgenic mice. Female transgenic and control mice were mated and then injected with cadmium (30-45 mumol Cd/kg) on the day of blastocyst implantation (day 4). In both of these groups, injection of cadmium reduced pregnancy rate, and no dramatic protection was afforded by maternal and/or embryonic overexpression of MT. Thus, overexpression of MT-I does not significantly protect against either of these cadmium-induced effects on fertility. Images Figure 1. A Figure 1. B Figure 2. A Figure 2. B Figure 2. C Figure 3. Figure 4. A Figure 4. A Figure 4. B Figure 4. B Figure 4. B Figure 4. B Figure 4. D4 Figure 4. D4 Figure 4. D6 Figure 4. D6 Figure 4. D8 Figure 5. A Figure 5. B Figure 5. C Figure 5. D Figure 5. E Figure 6. A Figure 6. B Figure 6. C Figure 6. D Figure 6. E Figure 6. F PMID:8834864

HIFiRE 5b Heat Flux and Boundary Layer Transition

DTIC Science & Technology

2017-11-14

contain a detailed description of the HIFiRE-5 configuration. The HIFiRE-5 vehicle is an elliptic cone with a 2:1 aspect ratio. It has a 7-degree half... description of the HIFiRE-5b vehicle and launch. Figure 1 presents a dimensioned drawing of the payload, including nosetip detail. The half-angle of the

"Someone Just Like Me:" Narrative, Figured World, and Uptake in Therapeutic Books for Youths With Mental Health Disorders

ERIC Educational Resources Information Center

Smart, Graham; Thompson, Richard

2017-01-01

This study extends a line of inquiry established by researchers using narrative theory to investigate the discourses of psychiatry. Drawing primarily on theories of narrative and genre, the study analyzes a series of autobiographical books intended for an audience of youth suffering from mental illness. Our research investigates how the rhetorical…

Use an Interactive Whiteboard: Get a Handle on How This Technology Can Spice up the Classroom

ERIC Educational Resources Information Center

Branzburg, Jeffrey

2006-01-01

Interactive whiteboards are desirable peripherals these days. When hooked up to a computer, the whiteboard's screen becomes a "live" computer desktop, which can be tapped to pull down menus, highlight, and move or open files. Users can also circle relevant sections on the projected image, draw geometric figures, and underline. Then they can save…

Body Dissatisfaction and Characteristics of Disordered Eating among Black and White Early Adolescent Girls and Boys

ERIC Educational Resources Information Center

Jung, Jaehee; Forbes, Gordon B.

2013-01-01

Multiple measures of body dissatisfaction and behaviors associated with disordered eating were studied in 258 White girls, 223 White boys, 106 Black girls, and 82 Black boys. All participants were unpaid volunteers between the ages of 12 and 15 attending six middle schools in Delaware and Maryland. On two self-ideal figure drawing discrepancy…

Modest Witness(ing) and Lively Stories: Paying Attention to Matters of Concern in Early Childhood

ERIC Educational Resources Information Center

Blaise, Mindy; Hamm, Catherine; Iorio, Jeanne Marie

2017-01-01

This article considers the role of early childhood education within these uncertain times of human induced climate change. It draws from feminism and environmental humanities to experiment with different ways of becoming-with the world. By bringing together Donna Haraway's figure of the Modest Witness and Deborah Bird Rose's notion of witnessing,…

Impact of the threat of war on children in military families.

PubMed

Ryan-Wenger, Nancy A

2002-01-01

The potential for war is a pervasive threat to the security and family structure of children in military families. This study compared children of active-duty, reserve, and civilian families with respect to their perceptions of war, origin of fears related to war, levels of manifest anxiety, coping strategies, and projection of emotional problems in human figure drawings.

Not Stopping at First: Racial Literacy and the Teaching of Barack Obama

ERIC Educational Resources Information Center

Smith, William L.

2014-01-01

In this article the author speaks to the teaching of Barack Obama in U.S. schools. Drawing from scholarly literature on the heroification of American historical figures in public memory, the author argues that focusing on Obama's firstness as an African American may lead students to have incomplete and misleading understandings of what the…

Knowing Obama: How High School Students of Color Learn about the 44th President

ERIC Educational Resources Information Center

Smith, William

2016-01-01

Drawing from a theory of racial literacy and literature on the post-racial phenomenon after the 2008 election, this case study examines how high school students of color have learned about Barack Obama as a racial and political figure. Findings suggest that schools can be unfriendly spaces for learning about these topics, with history and social…

47 CFR 90.309 - Tables and figures.

Code of Federal Regulations, 2011 CFR

2011-10-01

.... Maps with a scale of 1:250,000 or larger (such as 1:24,000) shall be used. Digital Terrain Data Tapes... sec. 90.307(d). Table “F”—Decibel Reduction/Power Equivalents dB reduction below 1 kW ERP permitted... curve draw a horizontal line to the power reduction scale. (6) The power reduction in dB determines the...

Good Practices for Student Learning: Mixed-Method Evidence from the Wabash National Study

ERIC Educational Resources Information Center

Goodman, Kathleen M.; Magolda, Marcia Baxter; Seifert, Tricia A.; King, Patricia M.

2011-01-01

Since 2006, 19 institutions across the United States have been trying to figure out how to work smarter through their participation in the Wabash National Study of Liberal Arts Education. Drawing on data from the first year of the study, the robust, mixed-methods study the authors report in this article evaluated growth in the first year of…

A Statistical Summary of Selected Characteristics of the Student Population of Southwest Texas Junior College.

ERIC Educational Resources Information Center

Southwest Texas Junior Coll., Uvalde.

This report presents statistical data on students at Southwest Texas Junior College in an attempt to provide insight into the characteristics of the student population. The data is presented in tabular form with no effort to draw conclusions or to suggest possible implications. Fall 1974-75 enrollment figures are broken down by class, full-time or…

Socrates, Augustine, and Paul Gauguin on the Reciprocity between Speech and Silence in Education

ERIC Educational Resources Information Center

Caranfa, Angelo

2013-01-01

While most educational practices today place an excessive amount of attention on discourse, this article attaches great importance to the reciprocity between speech and silence by drawing from the writings of Plato's Socrates, Augustine, and Paul Gauguin for whom this reciprocity is of the essence in learning. These three figures teach that…

Finding Weakness in Jihadist Propaganda

DTIC Science & Technology

2007-05-01

propaganda – not the governments24. Of all the communication mediums, none was more influential than the cinema . Charlie Chaplin starred in Shoulder...Ibid. 12 more grotesque caricatures and more frightening images. In Figure 2, we see a Japanese soldier assaulting a helpless American prisoner. It...three separate categories: Agitation, drawing attention to the atrocities being committed by the Japanese ; Integration, calling on the American workforce

From Dot to Line to Plane: Constellating Unconscious Imagery in Art Therapy

ERIC Educational Resources Information Center

Steinhardt, Lenore

2017-01-01

In this article I describe an art-based procedure with a gradual sequence of drawing tasks that guides an art therapy client through graphic stages from point, to line, to plane. The client begins by making random dots, connecting them one to another with an unbroken line that reaches all the dots, perceiving abstract or figurative imagery in the…

Influence of anxiety on memory performance in temporal lobe epilepsy

PubMed Central

Brown, Franklin C.; Westerveld, Michael; Langfitt, John T.; Hamberger, Marla; Hamid, Hamada; Shinnar, Shlomo; Sperling, Michael R.; Devinsky, Orrin; Barr, William; Tracy, Joseph; Masur, David; Bazil, Carl W.; Spencer, Susan S.

2013-01-01

This study examined the degree to which anxiety contributed to inconsistent material-specific memory difficulties among 243 temporal lobe epilepsy patients from the Multisite Epilepsy Study. Visual memory performance on the Rey Complex Figure Test (RCFT) was lower for those with high versus low level of anxiety, but was not found to be related to side of TLE. Verbal memory on the California Verbal Learning Test (CVLT) was significantly lower for left than right TLE patients with low anxiety, but equally impaired for those with high anxiety. These results suggest that we can place more confidence in the ability of verbal memory tests like the CVLT to lateralize to left TLE for those with low anxiety, but that verbal memory will be less likely to produce lateralizing information for those with high anxiety. This suggests that more caution is needed when interpreting verbal memory tests for those with high anxiety. These results indicated that RCFT performance was significantly affected by anxiety and did not lateralize to either side, regardless of anxiety level. This study adds to the existing literature which suggests that drawing-based visual memory tests do not lateralize among TLE patients, regardless of anxiety level. PMID:24291525

Focus groups reveal consumer ambivalence.

PubMed

1983-01-01

According to qualitative research, Salvadoreans are ambivalent about the use of contraceptives. Since complete responsibility for management of the CSM project was accepted by the Association Demografica Salvadorena (ADS), the agency which operates the contraceptive social marketing project in El Salvador, in November 1980, the need for decisions in such areas as product price increases, introduction of new condom brands, promotion of the vaginal foaming tablet, and assessment of product sales performance had arisen. The ICSMP funded market research, completed during 1983, was intended to provide the data on which such decisions by ADS could be based. The qualitative research involved 8 focus groups, comprised of men and women, aged 18-45, contraceptive users and nonusers, from the middle and lower socioeconomic strata of the city of San Salvador and other suburban areas. In each group a moderator led discussion of family planning and probed respondents for specific attitudes, knowledge, and behavior regarding the use of contraceptives. To assess attitudes at a more emotional level, moderators asked respondents to "draw" their ideas on certain issues. A marked discrepancy was revealed between respondents' intellectual responses to the issues raised in group discussion, as opposed to their feelings expressed in the drawings. Intellectually, participants responded very positively to family planning practice, but when they were asked to draw their perceptions, ambivalent feelings emerged. Drawings of both the user and the nonuser convey primarily negative aspects for either choice. The user is tense and moody toward her children; the nonuser loses her attractiveness and "dies." Figures also show drawings of some of the attitudes of single and married male participants. 1 drawing shows an incomplete and a complete circle, symbolizing a sterilized man (incomplete) and a nonsterilized man (complete). Another picture depicts a chained man who has lost his freedom (sterilized) versus a world of abundance and strength enjoyed by a nonsterilized man. The results of the projective drawings are only a small part of the total market research effort in El Salvador, yet they seem to indicate that the development of a CSM project communications strategy is critically important to product sales and continued product use. New advertising messages will need to be carefully tested and much communication expertise will be required to develop a message that will contribute to resolving consumer ambivalences toward product use.

A tool for teaching three-dimensional dermatomes combined with distribution of cutaneous nerves on the limbs.

PubMed

Kooloos, Jan G M; Vorstenbosch, Marc A T M

2013-01-01

A teaching tool that facilitates student understanding of a three-dimensional (3D) integration of dermatomes with peripheral cutaneous nerve field distributions is described. This model is inspired by the confusion in novice learners between dermatome maps and nerve field distribution maps. This confusion leads to the misconception that these two distribution maps fully overlap, and may stem from three sources: (1) the differences in dermatome maps in anatomical textbooks, (2) the limited views in the figures of dermatome maps and cutaneous nerve field maps, hampering the acquisition of a 3D picture, and (3) the lack of figures showing both maps together. To clarify this concept, the learning process can be facilitated by transforming the 2D drawings in textbooks to a 3D hands-on model and by merging the information from the separate maps. Commercially available models were covered with white cotton pantyhose, and borders between dermatomes were marked using the drawings from the students' required study material. Distribution maps of selected peripheral nerves were cut out from color transparencies. Both the model and the cut-out nerve fields were then at the students' disposal during a laboratory exercise. The students were instructed to affix the transparencies in the right place according to the textbook's figures. This model facilitates integrating the spatial relationships of the two types of nerve distributions. By highlighting the spatial relationship and aiming to provoke student enthusiasm, this model follows the advantages of other low-fidelity models. © 2013 American Association of Anatomists.

Armed Forces Institute of Regenerative Medicine Annual Report 2010

DTIC Science & Technology

2011-01-01

manufacture a PDO bioabsorbable stent (Figure II-12) and a fracture -resistant nitinol stent (Figure II-13). 2. Mechanically test tissue following...storage in anhy­ drous fluid (Figure II-14). 3. Conduct fatigue tests on fracture -resistant stents (Figure II-15). 4. Mechanically evaluate the...veloped a fracture -resistant tissue-lined nitinol stent, and mechanically tested both stents. Both designs performed exceptionally well in mechanical

Fabrication of imaging X-ray optics

NASA Astrophysics Data System (ADS)

Catura, R. C.; Joki, E. G.; Brookover, W. J.

The design, fabrication, and performance of optics for X-ray astronomy and laboratory applications are described and illustrated with diagrams, drawings, graphs, photographs, and sample images. Particular attention is given to the Wolter I telescope developed for spectroscopic observation of 8-30-A cosmic X-ray sources from a rocketborne X-ray Objective Grating Spectrometer; this instrument employs three nested paraboloid-hyperboloid mirrors of 5083 Al alloy, figured by diamond turning and covered with a thin coating of acrylic lacquer prior to deposition of a 40-nm-thick layer of Sn. In calibration tests at NASA Marshall, the FWHM of the line-spread function at 1.33 nm was found to be 240 microns, corresponding to 21 arcsec. Also presented are the results of reflectivity measurements on C and W multilayers sputtered on Si and fusion glass substrates.

The ACTS Flight System - Cost-Effective Advanced Communications Technology. [Advanced Communication Technology Satellite

NASA Technical Reports Server (NTRS)

Holmes, W. M., Jr.; Beck, G. A.

1984-01-01

The multibeam communications package (MCP) for the Advanced Communications Technology Satellite (ACTS) to be STS-launched by NASA in 1988 for experimental demonstration of satellite-switched TDMA (at 220 Mbit/sec) and baseband-processor signal routing (at 110 or 27.5 Mbit/sec) is characterized. The developmental history of the ACTS, the program definition, and the spacecraft-bus and MCP parameters are reviewed and illustrated with drawings, block diagrams, and maps of the coverage plan. Advanced features of the MPC include 4.5-dB-noise-figure 30-GHz FET amplifiers and 20-GHz TWTA transmitters which provide either 40-W or 8-W RF output, depending on rain conditions. The technologies being tested in ACTS can give frequency-reuse factors as high as 20, thus greatly expanding the orbit/spectrum resources available for U.S. communications use.

Looking around houses: attention to a model when drawing complex shapes in Williams syndrome and typical development.

PubMed

Hudson, Kerry D; Farran, Emily K

2013-09-01

Drawings by individuals with Williams syndrome (WS) typically lack cohesion. The popular hypothesis is that this is a result of excessive focus on local-level detail at the expense of global configuration. In this study, we explored a novel hypothesis that inadequate attention might underpin drawing in WS. WS and typically developing (TD) non-verbal ability matched groups copied and traced a house figure comprised of geometric shapes. The house was presented on a computer screen for 5-s periods and participants pressed a key to re-view the model. Frequency of key-presses indexed the looks to the model. The order that elements were replicated was recorded to assess hierarchisation of elements. If a lack of attention to the model explained poor drawing performance, we expected participants with WS to look less frequently to the model than TD children when copying. If a local-processing preference underpins drawing in WS, more local than global elements would be produced. Results supported the first, but not second hypothesis. The WS group looked to the model infrequently, but global, not local, parts were drawn first, scaffolding local-level details. Both groups adopted a similar order of drawing and tracing of parts, suggesting typical, although delayed strategy-use in the WS group. Additionally both groups drew larger elements of the model before smaller elements, suggested a size-bias when drawing. Copyright © 2013 Elsevier Ltd. All rights reserved.

Using drawing tests to explore the multidimensional psychological aspects of children with cancer.

PubMed

Hatano, Yutaka; Yamada, Miwa; Nakagawa, Kanae; Nanri, Hiromi; Kawase, Masatoshi; Fukui, Kenji

2014-10-01

In seeking to understand how life-threatening illness affects children psychologically, projective testing may be beneficial, particularly when attempting to identify psychological problems in younger adolescents. The advantages of projective testing are that it does not depend on patients' verbal ability and is not invasive. Three cancer inpatients from Kyoto Prefectural University of Medicine, aged between 10 and 16 years old, participated in the study. Projective testing was used to measure the depth of participants' distress and included a tree-drawing test, a person-drawing test and a free drawing test. Results from the tree- and person-drawing tests indicated energy loss, anxiety and a sense of emptiness. However, results from the free drawing test suggested that the children had hope and a desire to recover from their illness. The combination of drawing tests in this study may increase the understanding of the internal psychological difficulties faced by children hospitalized with cancer. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Suitable Stimuli to Obtain (No) Gender Differences in the Speed of Cognitive Processes Involved in Mental Rotation

ERIC Educational Resources Information Center

Jansen-Osmann, Petra; Heil, Martin

2007-01-01

Gender differences in speed of perceptual comparison, of picture-plane mental rotation, and in switching costs between trials that do and do not require mental rotation, were investigated as a function of stimulus material with a total sample size of N=360. Alphanumeric characters, PMA symbols, animal drawings, polygons and 3D cube figures were…

Rochester Connectionist Papers. 1979-1985

DTIC Science & Technology

1985-12-01

updated and improved version of the thesis account of recent neurolinguistic data. Fanty, M., "Context-free parsing in connectionist networks." TR 174...April 1982. Our first large program in the connectionist paradigm. It simulates a multi- layer network for recognizing line drawings of Origami figures...The program successfully deals with noise and simple occlusion and the thesis incorporates many key ideas on designing and running large models. Small

Nuclear reactor control room construction

DOEpatents

Lamuro, R.C.; Orr, R.

1993-11-16

A control room for a nuclear plant is disclosed. In the control room, objects labelled 12, 20, 22, 26, 30 in the drawing are no less than four inches from walls labelled 10.2. A ceiling contains cooling fins that extend downwards toward the floor from metal plates. A concrete slab is poured over the plates. Studs are welded to the plates and are encased in the concrete. 6 figures.

Methods and Strategies: Beyond the Textbook--But Not Just "Hands On". Using High-Quality Informational Texts to Meet the "Next Generation Science Standards"

ERIC Educational Resources Information Center

Vick, Matthew

2016-01-01

Science teaching continues to move away from teaching science as merely a body of facts and figures to be memorized to a process of exploring and drawing conclusions. The Next Generation Science Standards (NGSS) emphasize eight science and engineering practices that ask students to apply scientific and engineering reasoning and explanation. This…

Demonstrating Biological Principles Efficiently and Effectively: The Overhead Is More than Just a Lighted Chalkboard

ERIC Educational Resources Information Center

Barden-Gabbei, Laura M.

2006-01-01

The overhead projector is an excellent tool for teachers at both the high school and college level. Teachers often use it to display class notes as they monitor students' actions and reactions to the concepts being presented and discussed, to display diagrams and figures too complex to draw on the chalkboard, and more recently to display computer…

An Investigation of the Effectiveness of Visual-Motor Experiences in the Development of the Ability to Conserve Mass.

ERIC Educational Resources Information Center

Champagne, Audrey Ann Briggs

Based on the work of Bruner, Piaget and others that indicates that the child's attention to misleading visual clues is an important factor in his lack of ability to conserve, this study is an attempt to demonstrate the effects of instruction in drawing two-dimensional figures on the ability of children (22 kindergarten children from middle class…

Graphene-Based Wireless Bacteria Detection on Tooth Enamel

DTIC Science & Technology

2012-03-27

synthesized bifunctional peptide, consisting of a dodecapeptide graphene- binding peptide (GBP), a triglycine linker and the AMP odor- ranin-HP ( OHP ...Staphylococcus aureus39. Figure 3a shows a molecular drawing of the resulting 38 amino-acid sequence, HSSYWYAFNNKT-GGG-GLLRASSVWGRKYYVDLAGCAKA (GBP– OHP ...electronic measurements38. Activities of the immobilized GBP– OHP toward S. aureus, H. pylori, and erythrocytes were compared via fluorescent assays

Graphene-based Wireless Bacteria Detection on Tooth Enamel

DTIC Science & Technology

2012-05-27

synthesized bifunctional peptide, consisting of a dodecapeptide graphene- binding peptide (GBP), a triglycine linker and the AMP odor- ranin-HP ( OHP ...Staphylococcus aureus39. Figure 3a shows a molecular drawing of the resulting 38 amino-acid sequence, HSSYWYAFNNKT-GGG-GLLRASSVWGRKYYVDLAGCAKA (GBP– OHP ...electronic measurements38. Activities of the immobilized GBP– OHP toward S. aureus, H. pylori, and erythrocytes were compared via fluorescent assays

Portable Body Temperature Conditioner

DTIC Science & Technology

2013-10-18

disposable PVDF turbine flowmeter that is compact in size and capable of accommodating a volumetric flow rate from 0.03 L/min to 2.0 L/min of water . The...pictorial representation of the flowmeter along with a dimensional drawing. 33 Figure 27. Water flowmeter for PBTC As displayed in the dimensional...suitable for military applications. 15. SUBJECT TERMS Hypothermia, Circulating Water -blanket, Trauma, Hyperthermia, Military, Thermal Manikin 16

16 CFR Figure 7 to Part 1203 - Typical Test Apparatus for Positional Stability Test

Code of Federal Regulations, 2014 CFR

2014-01-01

... 16 Commercial Practices 2 2014-01-01 2014-01-01 false Typical Test Apparatus for Positional Stability Test 7 Figure 7 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 7 Figure 7 to Part 1203—Typical Test Apparatus for Positional...

16 CFR Figure 7 to Part 1203 - Typical Test Apparatus for Positional Stability Test

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Typical Test Apparatus for Positional Stability Test 7 Figure 7 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 7 Figure 7 to Part 1203—Typical Test Apparatus for Positional...

16 CFR Figure 7 to Part 1203 - Typical Test Apparatus for Positional Stability Test

Code of Federal Regulations, 2013 CFR

2013-01-01

... 16 Commercial Practices 2 2013-01-01 2013-01-01 false Typical Test Apparatus for Positional Stability Test 7 Figure 7 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 7 Figure 7 to Part 1203—Typical Test Apparatus for Positional...

Assessment of obesity stigmatization in children and adolescents: modernizing a standard measure.

PubMed

Latner, Janet D; Simmonds, Murray; Rosewall, Juliet K; Stunkard, Albert J

2007-12-01

Stigmatization of overweight children is highly prevalent. However, the measurement of stigma has varied widely across studies. An up-to-date version of a commonly used measure of weight-related stigma is needed. Poser 5 (DAZ software) was used to develop 12 modernized figures, using three-dimensional models rendered as high-resolution images. They depicted one overweight, one non-overweight, and four disabled children of each sex. Children recruited from public and private schools (N = 261; mean age, 11.3 years; median BMI z-score = 0.33; 77.0% white, 11.5% Asian, and 7.7% Maori) ranked these figures in order of liking. Participants also ranked traditionally used line drawings depicting comparable images. Participants rated each new figure on measures of liking and stereotypical attributes on 100-mm visual analog scales (VASs). Rankings of liking of the new figures were highly correlated with rankings of corresponding old figures, especially for overweight figures [boys: rho (77) = 0.72, p < 0.001; girls: rho (153) = 0.68, p < 0.001]. Rankings of overweight and other figures were also highly correlated with VAS assessment of liking and with a composite, internally consistent VAS measure of liking and stereotypical attributes. Only negative stereotypes about the intelligence of overweight boys and girls contributed significantly to the variance in liking. An updated and modernized tool for assessing children's weight stigma was developed and its construct validity supported. The present findings suggest that stereotypes about low intelligence may contribute to weight stigma among children. More research is needed on the causes and components of weight stigma so that it can be effectively reduced.

28. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

28. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. AIR COOLED TEST STAND. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

The threshold signal:noise ratio in the perception of fragmented figures.

PubMed

Merkul'ev, A V; Pronin, S V; Semenov, L A; Foreman, N; Chikhman, V N; Shelepin, Yu E

2006-01-01

Perception thresholds were measured for fragmented outline figures (the Gollin test). A new approach to the question of the perception of incomplete images was developed. In this approach, figure fragmentation consisted of masking with multiplicative texture-like noise--this interference was termed "invisible" masking. The first series of studies established that the "similarity" between the amplitude-frequency spectra of test figures and "invisible" masks, expressed as a linear correlation coefficient, had significant effects on the recognition thresholds of these figures. The second series of experiments showed that progressing formation of the figures was accompanied by increases in the correlation between their spatial-frequency characteristics and the corresponding characteristics of the incomplete figure, while the correlation with the "invisible" mask decreased. It is suggested that the ratio of the correlation coefficients, characterizing the "similarity" of the fragmented figure with the intact figure and the "invisible" mask, corresponds to the signal:noise ratio. The psychophysical recognition threshold for figures for naive subjects not familiar with the test image alphabet was reached after the particular level of fragmentation at which this ratio was unity.

Neurons Forming Optic Glomeruli Compute Figure–Ground Discriminations in Drosophila

PubMed Central

Aptekar, Jacob W.; Keleş, Mehmet F.; Lu, Patrick M.; Zolotova, Nadezhda M.

2015-01-01

Many animals rely on visual figure–ground discrimination to aid in navigation, and to draw attention to salient features like conspecifics or predators. Even figures that are similar in pattern and luminance to the visual surroundings can be distinguished by the optical disparity generated by their relative motion against the ground, and yet the neural mechanisms underlying these visual discriminations are not well understood. We show in flies that a diverse array of figure–ground stimuli containing a motion-defined edge elicit statistically similar behavioral responses to one another, and statistically distinct behavioral responses from ground motion alone. From studies in larger flies and other insect species, we hypothesized that the circuitry of the lobula—one of the four, primary neuropiles of the fly optic lobe—performs this visual discrimination. Using calcium imaging of input dendrites, we then show that information encoded in cells projecting from the lobula to discrete optic glomeruli in the central brain group these sets of figure–ground stimuli in a homologous manner to the behavior; “figure-like” stimuli are coded similar to one another and “ground-like” stimuli are encoded differently. One cell class responds to the leading edge of a figure and is suppressed by ground motion. Two other classes cluster any figure-like stimuli, including a figure moving opposite the ground, distinctly from ground alone. This evidence demonstrates that lobula outputs provide a diverse basis set encoding visual features necessary for figure detection. PMID:25972183

The new system of health accounts in Ireland: what does it all mean?

PubMed

Turner, B

2017-08-01

The Central Statistics Office released new figures on Ireland's health spending in December 2015, based on the System of Health Accounts (SHA2011). These figures differ from previous figures, by virtue of an expanded definition of what constitutes health care. The new figures also provide more detail on health expenditure than the previous figures allowed. This article examines the new figures, drawing out findings of note and discussing the implications of these for the Irish health care system. It also compares Ireland with international health systems, highlighting where Ireland is unusual or comparable to international norms. Healthcare spending in Ireland as a percentage of GDP is higher than in many other countries, having increased during the economic downturn, although this was due more to the contraction in GDP than an increase in spending. While the majority of healthcare expenditure in Ireland comes from the Government, the share of private expenditure on healthcare in Ireland has increased, with implications for equity in the system. Over half of the expenditure is on curative and rehabilitative services, broadly in line with other countries. The proportion of spending going to long-term care facilities is relatively high by international standards. Suggestions that Ireland is over-spending on health need to be tempered by cognisance that the Irish health system is under-resourced in a number of areas (particularly the number of doctors and the number of hospital beds) and has not fully recovered from cutbacks in the late 1980s and early 1990s.

The effect of leg-to-body ratio on male attractiveness depends on the ecological validity of the figures.

PubMed

Versluys, Thomas M M; Skylark, William J

2017-10-01

Leg-to-body ratio (LBR) predicts evolutionary fitness, and is therefore expected to influence bodily attractiveness. Previous investigations of LBR attractiveness have used a wide variety of stimuli, including line drawings, silhouettes, and computer-generated images based on anthropometric data. In two studies, community samples of heterosexual women from the USA rated the attractiveness of male figures presented as silhouettes and as detailed computer-generated images with three different skin tones (white, black, and an artificial grey). The effects of LBR depended on the image format. In particular, a curve-fitting analysis indicated that the optimally-attractive LBR for silhouettes was fractionally below the baseline, whereas the optima for more detailed computer-generated images was approximately 0.5 s.d. above the baseline and was similar for all three skin-tones. In addition, the participants' sensitivity to changes in the LBR was lowest for the silhouettes and highest for the grey figures. Our results add to evidence that the most attractive LBR is close to, but slightly above, the population mean, and caution that the effects of limb proportions on attractiveness depend on the ecological validity of the figures.

16 CFR Figures 3 and 4 to Part 1204 - High Voltage Test Facility and Antenna System Test Setup

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false High Voltage Test Facility and Antenna System Test Setup 3 Figures 3 and 4 to Part 1204 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION... ANTENNAS Pt. 1204, Figs. 3, 4 Figures 3 and 4 to Part 1204—High Voltage Test Facility and Antenna System...

16 CFR Figures 3 and 4 to Part 1204 - High Voltage Test Facility and Antenna System Test Setup

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false High Voltage Test Facility and Antenna System Test Setup 3 Figures 3 and 4 to Part 1204 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION... ANTENNAS Pt. 1204, Figs. 3, 4 Figures 3 and 4 to Part 1204—High Voltage Test Facility and Antenna System...

16 CFR Figures 3 and 4 to Part 1204 - High Voltage Test Facility and Antenna System Test Setup

Code of Federal Regulations, 2013 CFR

2013-01-01

... 16 Commercial Practices 2 2013-01-01 2013-01-01 false High Voltage Test Facility and Antenna System Test Setup 3 Figures 3 and 4 to Part 1204 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION... ANTENNAS Pt. 1204, Figs. 3, 4 Figures 3 and 4 to Part 1204—High Voltage Test Facility and Antenna System...

16 CFR Figures 3 and 4 to Part 1204 - High Voltage Test Facility and Antenna System Test Setup

Code of Federal Regulations, 2014 CFR

2014-01-01

... 16 Commercial Practices 2 2014-01-01 2014-01-01 false High Voltage Test Facility and Antenna System Test Setup 3 Figures 3 and 4 to Part 1204 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION... ANTENNAS Pt. 1204, Figs. 3, 4 Figures 3 and 4 to Part 1204—High Voltage Test Facility and Antenna System...

25. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

25. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. ELEVATIONS, RIGHT AND LEFT PORTIONS, TEST CELLS 5-12. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

24. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

24. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. ELEVATIONS, CENTRAL PORTION AND TEST CELLS 1-4. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

26. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

26. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. CROSS-SECTION, CENTRAL PORTION AND TEST CELLS 1-4. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

40 CFR 92.508 - Calculation and reporting of test results.

Code of Federal Regulations, 2014 CFR

2014-07-01

... expressed to one additional significant figure. (b) Final test results shall be calculated by summing the... contained in the applicable standard expressed to one additional significant figure. (c) Manufacturers and... additional significant figure. (d) If, subsequent to an initial failure of a production line test, the...

40 CFR 92.508 - Calculation and reporting of test results.

Code of Federal Regulations, 2011 CFR

2011-07-01

... expressed to one additional significant figure. (b) Final test results shall be calculated by summing the... contained in the applicable standard expressed to one additional significant figure. (c) Manufacturers and... additional significant figure. (d) If, subsequent to an initial failure of a production line test, the...

9. Credit JPL. Photographic copy of drawing, engineering drawing showing ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

9. Credit JPL. Photographic copy of drawing, engineering drawing showing structure of Test Stand 'A' (Building 4202/E-3) and its relationship to the Monitor Building or blockhouse (Building 4203/E-4) when a reinforced concrete machinery room was added to the west side of Test Stand 'A' in 1955. California Institute of Technology, Jet Propulsion Laboratory, Plant Engineering 'Electrical Layout - Muroc, Test Stand & Refrigeration Equipment Room,' drawing no. E3/7-0, April 6, 1955. - Jet Propulsion Laboratory Edwards Facility, Test Stand A, Edwards Air Force Base, Boron, Kern County, CA

The Implementation and Testing of a Robotic Arm on an Autonomous Vehicle

DTIC Science & Technology

2007-12-01

FIGURES Figure 1. BigFoot . .............................................................................................................2 Figure 2...Arm. ............................................................31 Figure 29. BigFoot launched a shaped charge model on the suspected IED...work with BigFoot . I would also like to thank you to LTCD Kirk Volland for his assistance in the implementation and testing of a robotic arm. I thank

21. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

21. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. SECOND FLOOR PLAN, RIGHT AND LEFT END PORTIONS, TEST CELLS 5-12. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

18. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

18. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. FIRST FLOOR PLAN, CENTRAL PORTION AND TEST CELLS 1-4. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

27. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

27. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. CROSS-SECTION, RIGHT AND LEFT END PORTIONS, TEST CELLS 5-12. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

22. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

22. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. THIRD FLOOR AND ROOF PLAN, CENTRAL PORTION AND TEST CELLS 1-4. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

16. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

16. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. BASEMENT FLOOR PLAN, CENTRAL PORTION AND TEST CELLS 1-4. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

17. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

17. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. BASEMENT FLOOR PLAN, RIGHT AND LEFT END PORTIONS, TEST CELLS 5-12. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

20. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

20. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. SECOND FLOOR PLAN, CENTRAL PORTION AND TEST CELLS 1-4. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

19. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

19. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. FIRST FLOOR PLAN, RIGHT AND LEFT END PORTIONS, TEST CELLS 5-12. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

Projective drawings as measures of psychosocial functioning in siblings of pediatric cancer patients from the Camp Okizu study.

PubMed

Packman, Wendy; Mazaheri, Mary; Sporri, Lisa; Long, Janet K; Chesterman, Beth; Fine, Joselyn; Amylon, Michael D

2008-01-01

This research was conducted at a summer camp for siblings of children with cancer. Participants included 77 siblings (ages 6-17 years) and their parents. Before attending camp, 18 of the siblings had experienced the death of their brother or sister with cancer. Projective measures were administered before attending camp and 3 months after camp. These included the Human Figure Drawing (HFD) and the Kinetic Family Drawing-Revised (KFD-R). Siblings were administered both the HFD and KFD-R; parents were given the KFD-R. On the HFD, siblings' emotional distress scores decreased significantly pre- to postcamp. On the KFD-R, nonbereaved siblings and parents showed significant improvement in family environment scores. Bereaved siblings and parents also showed improvement (although nonsignificant). These results support Camp Okizu's effectiveness in increasing siblings' emotional well-being yet underscore the need to implement interventions to address family communication for both bereaved and nonbereaved families.

Joint Strike Fighter: Additional Costs and Delays Risk Not Meeting Warfighter Requirements on Time

DTIC Science & Technology

2010-03-01

December 2009, only 4 of 13 test aircraft had been delivered and labor hours to build the aircraft had increased more than 50 percent above earlier...Table 7: Changes in Reported JSF Program Costs, Quantities, and Deliveries 40 Figures Figure 1: JSF Labor Hours for Manufacturing Test...Aircraft 15 Figure 2: Wing Station Labor Hours 16 Figure 3: Mate and Delivery Labor Hours 17 Figure 4: Growth in the Number of Engineering Design

Cultural and age differences of three groups of Taiwanese young children's creativity and drawing.

PubMed

Wei, Mei-Hue; Dzeng, Annie

2013-06-01

This study investigated the cultural and age effects on children's overall creativity and drawing. 1,055 children ages 6 to 8 from three groups--urban and rural Taiwanese children and Taiwanese children of immigrant mothers, all in public schools--were given a creativity test, a people-drawing test, and a free-drawing test. The results showed that the older Taiwanese children scored higher than the young Taiwanese children on people-drawing and free-drawing, but not overall creativity. Drawing and creativity scores increased in accordance with age. In the six-year-old group, a group difference was found only on the scale of people-drawing. Urban Taiwanese children in the eight-year-old group scored higher than the other two groups of children on creativity and free-drawing. Results are discussed in terms of educational opportunities.

16 CFR Figures 3 and 4 to Subpart... - Test Specimens

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Test Specimens 3 Figures 3 and 4 to Subpart A of Part 1201 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT... Figures 3 and 4 to Subpart A of Part 1201—Test Specimens EC03OC91.006 ...

16 CFR Figures 3 and 4 to Subpart... - Test Specimens

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Test Specimens 3 Figures 3 and 4 to Subpart A of Part 1201 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT... Figures 3 and 4 to Subpart A of Part 1201—Test Specimens EC03OC91.006 ...

16 CFR Figures 3 and 4 to Subpart... - Test Specimens

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Test Specimens 3 Figures 3 and 4 to Subpart A of Part 1201 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT... Figures 3 and 4 to Subpart A of Part 1201—Test Specimens EC03OC91.006 ...

16 CFR Figure 9 to Part 1203 - Impact Test Apparatus

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Impact Test Apparatus 9 Figure 9 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 9 Figure 9 to Part 1203—Impact Test Apparatus ER10MR98...

16 CFR Figure 9 to Part 1203 - Impact Test Apparatus

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Impact Test Apparatus 9 Figure 9 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 9 Figure 9 to Part 1203—Impact Test Apparatus ER10MR98...

Software Hardware Asset Reuse Enterprise (SHARE) Repository Framework: Related Work and Development Plan

DTIC Science & Technology

2009-08-19

designed to collect the data and assist the analyst in drawing relationships between the data. Palantir Technologies has created one such software...application to support the DoD intelligence community by providing robust capabilities for managing data from various sources10. The Palantir tool...www.palantirtech.com/ - 38 - Figure 17. Palantir Graphical Interface (Gordon-Schlosberg, 2008) Similar examples of the use of ontologies to support data

From Authority Figure to Emotion Worker: Attitudes towards School Discipline in Finnish Schoolteachers' Journals from the 1950s to the 1980s

ERIC Educational Resources Information Center

Anttila, Erkko; Väänänen, Ari

2015-01-01

The article discusses the change in attitudes towards school discipline in Finnish schoolteachers' professional journals from the late 1950s to the early 1980s. In explaining this change, the article draws from the studies of Cas Wouters and Arlie Hochschild. At the beginning of the studied period, the discussions in the schoolteachers'…

46 CFR 160.035-10 - Number of persons allowed in lifeboats.

Code of Federal Regulations, 2010 CFR

2010-10-01

... cubic feet by the factor shown in Table 160.035-10(a). The net cubic capacity shall be determined by § 160.035-9(b). Table 160.035-10(a) Length in feet— Of— But less than— Factor 18 14 18 20 13 20 22 12 22... for which seating space is provided as determined by drawing figures to scale of a size as noted in...

What Do Children Know about the Interior of the Body? A Comparison of Two Methods of Investigation.

ERIC Educational Resources Information Center

Deluca, Paolo

This research compared two methods used to investigate the knowledge of internal body parts by children ages 4 to 9 years. Subjects were 50 Italian children: 18 preschoolers, 21 first graders, and 11 second or third graders. Children performed two tasks, a Drawing Task in which they drew on the outline of a human figure all the body parts they…

Visual Media Reasoning - Terrain-based Geolocation

DTIC Science & Technology

2015-06-01

the drawings, specifications, or other data does not license the holder or any other person or corporation ; or convey any rights or permission to...3.4 Alternative Metric Investigation This section describes a graphics processor unit (GPU) based implementation in the NVIDIA CUDA programming...utilizing 2 concurrent CPU cores, each controlling a single Nvidia C2075 Tesla Fermi CUDA card. Figure 22 shows a comparison of the CPU and the GPU powered

Object memory effects on figure assignment: conscious object recognition is not necessary or sufficient.

PubMed

Peterson, M A; de Gelder, B; Rapcsak, S Z; Gerhardstein, P C; Bachoud-Lévi, A

2000-01-01

In three experiments we investigated whether conscious object recognition is necessary or sufficient for effects of object memories on figure assignment. In experiment 1, we examined a brain-damaged participant, AD, whose conscious object recognition is severely impaired. AD's responses about figure assignment do reveal effects from memories of object structure, indicating that conscious object recognition is not necessary for these effects, and identifying the figure-ground test employed here as a new implicit test of access to memories of object structure. In experiments 2 and 3, we tested a second brain-damaged participant, WG, for whom conscious object recognition was relatively spared. Nevertheless, effects from memories of object structure on figure assignment were not evident in WG's responses about figure assignment in experiment 2, indicating that conscious object recognition is not sufficient for effects of object memories on figure assignment. WG's performance sheds light on AD's performance, and has implications for the theoretical understanding of object memory effects on figure assignment.

Scaling Flight Tests of Unmanned Air Vehicles

DTIC Science & Technology

2006-09-01

Figure Page Figure 1. Scaled Vehicle used to test Roll over propensity of automobiles . .................. 22 Figure 2. “Davicar...propensity of automobiles . In other research carried out at the University of Delft, Netherlands, the project DAVINCI was developed for

Clock-drawing test and unilateral spatial neglect.

PubMed

Ishiai, S; Sugishita, M; Ichikawa, T; Gono, S; Watabiki, S

1993-01-01

We investigated the ability of 25 patients with left unilateral spatial neglect to make a clock face by putting numbers inside a printed circle. Impairment seen in this clock-drawing test did not parallel neglect severity as judged by results of the line-cancellation and line-bisection tests, as well as the copying of a daisy. The score for clock drawing correlated highly with the verbal WAIS score. Most neglect patients with a verbal IQ of 87 or more could draw a clock face fairly well and used planning in placing the numbers 12, 3, 6, and 9 before the others. In clock drawing, verbal intelligence may compensate for left unilateral spatial neglect. We therefore recommend use of the line-cancellation and line-bisection tests, as well as the copying test, but do not recommend use of the clock-drawing test in the diagnosis of left unilateral spatial neglect.

Dimensions and Measurements of Debuncher Band 1 and 2 Waveguide-Coax Launchers (Final Version)

DOE Office of Scientific and Technical Information (OSTI.GOV)

Sun, Ding; /Fermilab

2000-02-15

This note is a document about dimensions and measurement results of waveguide-coax launchers (Band 1 and 2) installed on the arrays in debuncher cooling upgrade. Shown in Figure 1, 5, 8 and 12 are schematic drawings of launchers in the cross section along the longitudinal direction (beam direction) of the arrays. The unit in these drawings is inch. Note: although there are upper band and lower band for pickup arrays, the launchers are the same to avoid possible confusion during installation. RF Measurements were made on all launchers (port) and printed in hard copies for future reference. Since the measurementmore » results are similar to each other, only a few plots for each type of launcher/band are presented in this document. There are two types of measured S11 parameters. One is the measurement made at the end of design/tuning stage using a straight section of band 1 or 2 waveguide terminated with a cone of absorber. I use 'Original' to denote this kind of measurement. As shown in Figure 2, 6, 9 and 13, the original S11 of all launchers are below or around - 20 db over the full band 1 or 2. The other type of measurement is the one made after these launchers were installed onto the array including elbows and several type N feedthrough or connectors. The kicker arrays were terminated with wedges of absorber. During all measurements (pickup array or kicker array) when one launcher was being measured, all other launchers were terminated with 50 ohm terminator. As shown in Figure 3, 4, 7, 10, 11 and 14 these 'final' S11s are around -15 db.« less

16 CFR Figures 3 and 4 to Part 1204 - High Voltage Test Facility and Antenna System Test Setup

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false High Voltage Test Facility and Antenna System Test Setup 3 Figures 3 and 4 to Part 1204 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR OMNIDIRECTIONAL CITIZENS BAND BASE STATION ANTENNAS Pt. 1204, Figs. 3, 4 Figures 3 and 4...

1. Photographic copy of original engineering drawing for Test Stand ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

1. Photographic copy of original engineering drawing for Test Stand 'C.' California Institute of Technology, Jet Propulsion Laboratory, Plant Engineering 'New Test Stand Plan -- Edwards Test Station' drawing no. E18/2-3, 18 January 1957. - Jet Propulsion Laboratory Edwards Facility, Test Stand C, Edwards Air Force Base, Boron, Kern County, CA

The artist's advantage: Better integration of object information across eye movements

PubMed Central

Perdreau, Florian; Cavanagh, Patrick

2013-01-01

Over their careers, figurative artists spend thousands of hours analyzing objects and scene layout. We examined what impact this extensive training has on the ability to encode complex scenes, comparing participants with a wide range of training and drawing skills on a possible versus impossible objects task. We used a gaze-contingent display to control the amount of information the participants could sample on each fixation either from central or peripheral visual field. Test objects were displayed and participants reported, as quickly as possible, whether the object was structurally possible or not. Our results show that when viewing the image through a small central window, performance improved with the years of training, and to a lesser extent with the level of skill. This suggests that the extensive training itself confers an advantage for integrating object structure into more robust object descriptions. PMID:24349697

Modularity and hierarchical organization of action programs in children's acquisition of graphic skills.

PubMed

Manoel, Edison de J; Dantas, Luiz; Gimenez, Roberto; de Oliveira, Dalton Lustosa

2011-10-01

The organization of actions is based on modules in memory as a result of practice, easing the demand of performing more complex actions. If this modularization occurs, the elements of the module must remain invariant in new tasks. To test this hypothesis, 35 children, age 10 yr., practiced a graphic criterion task on a digital tablet and completed a complex graphic task enclosing the previous one. Total movement and pause times to draw the figure indicated skill acquisition. A module was identified by the variability of relative timing, pause time, and sequencing. Total movement to perform the criterion task did not increase significantly when it was embedded in the more complex task. Modularity was evidenced by the stability of relative timing and pause time and sequencing. The spatial position of new elements did not perturb the module, so the grammar of action may still have been forming.

23. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

23. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. THIRD FLOOR AND ROOF PLAN, RIGHT AND LEFT END PORTIONS, TEST CELLS 5-12. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

Movement Timing and Invariance Arise from Several Geometries

PubMed Central

Bennequin, Daniel; Fuchs, Ronit; Berthoz, Alain; Flash, Tamar

2009-01-01

Human movements show several prominent features; movement duration is nearly independent of movement size (the isochrony principle), instantaneous speed depends on movement curvature (captured by the 2/3 power law), and complex movements are composed of simpler elements (movement compositionality). No existing theory can successfully account for all of these features, and the nature of the underlying motion primitives is still unknown. Also unknown is how the brain selects movement duration. Here we present a new theory of movement timing based on geometrical invariance. We propose that movement duration and compositionality arise from cooperation among Euclidian, equi-affine and full affine geometries. Each geometry posses a canonical measure of distance along curves, an invariant arc-length parameter. We suggest that for continuous movements, the actual movement duration reflects a particular tensorial mixture of these canonical parameters. Near geometrical singularities, specific combinations are selected to compensate for time expansion or compression in individual parameters. The theory was mathematically formulated using Cartan's moving frame method. Its predictions were tested on three data sets: drawings of elliptical curves, locomotion and drawing trajectories of complex figural forms (cloverleaves, lemniscates and limaçons, with varying ratios between the sizes of the large versus the small loops). Our theory accounted well for the kinematic and temporal features of these movements, in most cases better than the constrained Minimum Jerk model, even when taking into account the number of estimated free parameters. During both drawing and locomotion equi-affine geometry was the most dominant geometry, with affine geometry second most important during drawing; Euclidian geometry was second most important during locomotion. We further discuss the implications of this theory: the origin of the dominance of equi-affine geometry, the possibility that the brain uses different mixtures of these geometries to encode movement duration and speed, and the ontogeny of such representations. PMID:19593380

Preparation and applicability of a test of speech perception with pictures.

PubMed

Souza, Laís Flavia de; Braga, Gabriela Rosito Alvarez Bernardez; Mota, Ana Lúcia Rios; Zamberlan-Amorim, Nelma Ellen; Reis, Ana Cláudia Mirândola Barbosa

2016-01-01

To prepare and apply support material for responses to the Speech Recognition Percentage Index (SRPI) test in children. This is a descriptive, exploratory study conducted in two phases: in the first phase, 31 speech-language pathologists (referees) prepared material composed of regular, frequently used monosyllabic and disyllabic words belonging to the vocabulary of children and figures that could represent these words; the second phase consisted in the application of this material to 30 normal-hearing children aged 2 to 4 years and 11 months. The material consisted of 25 words and six boards with six figures each. The word selection criterion adopted by the referees included the initial phoneme and real, colorful figures familiar to the children. The mean scores of the children in the SRPI test were 93% (SD ± 8%) with the support of figures and 64% (SD ± 25%) without figure support. Comparison between the results obtained with and without the support of figures showed significant difference for 15 of the 25 test words, with higher scores with the use of supporting figures. Comparison between correct and incorrect responses using the support of figures showed significant difference only for the word "dog" ("cão") (p=0.0079). There was agreement among the referees with respect to the words and figures. The SRPI test can be rapidly and easily applied, allowing evaluation and systematic monitoring of speech perception ability regardless of child verbalization capacity.

a Walk Through Earth's Time

NASA Astrophysics Data System (ADS)

Turrin, B. D.; Turrin, M.

2012-12-01

After "What is this rock?" the most common questions that is asked of Geologists is "How old is this rock/fossil?" For geologists considering ages back to millions of years is routine. Sorting and cataloguing events into temporal sequences is a natural tendency for all humans. In fact, it is an everyday activity for humans, i.e., keeping track of birthdays, anniversaries, appointments, meetings, AGU abstract deadlines etc… However, the time frames that are most familiar to the non scientist (seconds, minutes, hours, days, years) generally extend to only a few decades or at most centuries. Yet the vast length of time covered by Earth's history, 4.56 billion years, greatly exceeds these timeframes and thus is commonly referred to as "Deep Time". This is a challenging concept for most students to comprehend as it involves temporal and abstract thinking, yet it is key to their successful understanding of numerous geologic principles. We have developed an outdoor learning activity for general Introductory Earth Science courses that incorporates several scientific and geologic concepts such as: linear distance or stratigraphic thickness representing time, learning about major events in Earth's history and locating them in a scaled temporal framework, field mapping, abstract thinking, scaling and dimensional analysis, and the principles of radio isotopic dating. The only supplies needed are readily available in local hardware stores i.e. a 300 ft. surveyor's tape marked in feet, and tenths and hundredths of a foot, and the student's own introductory geology textbook. The exercise employs a variety of pedagogical learning modalities, including traditional lecture-based, the use of Art/Drawing, use of Visualization, Collaborative learning, and Kinesthetic and Experiential learning. Initially the students are exposed to the concept of "Deep Time" in a short conventional introductory lecture; this is followed by a 'field day'. Prior to the field exercise, students work with their textbook selecting events is Earth History that they find interesting. Using the textbook and online resources they then draw figures that represent these events. The drawing exercise reinforces the learning by having students visualize (imprinting an image) of these geologic events. Once the students have produced their drawings, the outdoor field exercise follows. Working collaboratively, the students measure and lay out a scaled linear model representing 4.56 billion years of geologic time. They then organize and place their drawings in the proper sequence on the temporal model that they have created. Once all the drawings are in place they are able to visualize the expanse of time in Earth's history. Through comparing results from a pre-test to those from a post-test we can show the gains in student understanding of Deep Time, a concept that is central to many of our geologic understandings.

[Closing-in phenomena observed in patients with Alzheimer's disease--analysis of drawing behavior and eye movements].

PubMed

Midorikawa, Y; Fukatsu, R; Takahata, N

1996-01-01

'Closing-in' symptom is defined as a tendency to close-in on the model while performing constructive tasks. This unique symptom is one of the constructional apraxia often observed in Alzheimer's disease (AD), which is considered to be involved in visuospatial dysfunctions. However, little is known about the nature of the symptom and pathophysiology underlying the symptom. In this study, we examined drawing behavior, eye movements of AD (n = 19), multi-infarct dementia (n = 8) and age matched healthy subjects (n = 10). 1) In AD, contrary to age matched healthy subjects, the patients drew slowly with apparent difficulty and drawing behavior was disorganized. The copied figures were incomplete and often fragmented. The spatial relationships of the parts were lost each other during copying a Necker's cube. 2) The characteristic eye movements were observed in AD patients with apraxia, and closing-in symptom. These were consisted of gaze apraxia, and disorders of visual attention appeared similar to Bàlint's syndrome. 3) The eye movements of the AD patients with closing-in symptoms were classified into wandering of fixation, locking of fixation, and mixed types. The 'closing-in' symptoms in copied figures were classified into three types, overlap, adherent, and near types. Then, the wandering type was seen both in near and adherent types, whereas the fixation type was only found in the overlap type. 4) SPECTs showed reduced RI activities in the parieto-occipital and in the frontal regions of AD patients with apraxia and closing-in symptoms. Our results suggest that AD patients may have a difficulty to create abstract space from concrete space. This may also imply regression to a primitive undifferentiated stage where gnostic and practic behavior is not differentiated in terms of space appreciation.

Visual Processing in Adolescents with Autism Spectrum Disorder: Evidence from Embedded Figures and Configural Superiority Tests

ERIC Educational Resources Information Center

Dillen, Claudia; Steyaert, Jean; Op de Beeck, Hans P.; Boets, Bart

2015-01-01

The embedded figures test has often been used to reveal weak central coherence in individuals with autism spectrum disorder (ASD). Here, we administered a more standardized automated version of the embedded figures test in combination with the configural superiority task, to investigate the effect of contextual modulation on local feature…

16 CFR Figure 1 to Part 1633 - Test Assembly, Shown in Furniture Calorimeter (Configuration A)

Code of Federal Regulations, 2014 CFR

2014-01-01

... 16 Commercial Practices 2 2014-01-01 2014-01-01 false Test Assembly, Shown in Furniture Calorimeter (Configuration A) 1 Figure 1 to Part 1633 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION.... 1 Figure 1 to Part 1633—Test Assembly, Shown in Furniture Calorimeter (Configuration A) ER15MR06.000 ...

16 CFR Figure 1 to Part 1633 - Test Assembly, Shown in Furniture Calorimeter (Configuration A)

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Test Assembly, Shown in Furniture Calorimeter (Configuration A) 1 Figure 1 to Part 1633 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION.... 1 Figure 1 to Part 1633—Test Assembly, Shown in Furniture Calorimeter (Configuration A) ER15MR06.000 ...

16 CFR Figure 1 to Part 1633 - Test Assembly, Shown in Furniture Calorimeter (Configuration A)

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Test Assembly, Shown in Furniture Calorimeter (Configuration A) 1 Figure 1 to Part 1633 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION.... 1 Figure 1 to Part 1633—Test Assembly, Shown in Furniture Calorimeter (Configuration A) ER15MR06.000 ...

16 CFR Figure 1 to Part 1633 - Test Assembly, Shown in Furniture Calorimeter (Configuration A)

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Test Assembly, Shown in Furniture Calorimeter (Configuration A) 1 Figure 1 to Part 1633 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION.... 1 Figure 1 to Part 1633—Test Assembly, Shown in Furniture Calorimeter (Configuration A) ER15MR06.000 ...

16 CFR Figure 2 to Part 1513 - Test Probe for Neck Entrapment

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Test Probe for Neck Entrapment 2 Figure 2 to Part 1513 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL HAZARDOUS SUBSTANCES ACT REGULATIONS REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 2 Figure 2 to Part 1513—Test Probe for Neck Entrapment...

16 CFR Figure 2 to Part 1513 - Test Probe for Neck Entrapment

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Test Probe for Neck Entrapment 2 Figure 2 to Part 1513 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL HAZARDOUS SUBSTANCES ACT REGULATIONS REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 2 Figure 2 to Part 1513—Test Probe for Neck Entrapment...

16 CFR Figure 2 to Part 1513 - Test Probe for Neck Entrapment

Code of Federal Regulations, 2014 CFR

2014-01-01

... 16 Commercial Practices 2 2014-01-01 2014-01-01 false Test Probe for Neck Entrapment 2 Figure 2 to Part 1513 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL HAZARDOUS SUBSTANCES ACT REGULATIONS REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 2 Figure 2 to Part 1513—Test Probe for Neck Entrapment...

16 CFR Figure 2 to Part 1513 - Test Probe for Neck Entrapment

Code of Federal Regulations, 2013 CFR

2013-01-01

... 16 Commercial Practices 2 2013-01-01 2013-01-01 false Test Probe for Neck Entrapment 2 Figure 2 to Part 1513 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL HAZARDOUS SUBSTANCES ACT REGULATIONS REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 2 Figure 2 to Part 1513—Test Probe for Neck Entrapment...

16 CFR Figure 2 to Part 1513 - Test Probe for Neck Entrapment

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Test Probe for Neck Entrapment 2 Figure 2 to Part 1513 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL HAZARDOUS SUBSTANCES ACT REGULATIONS REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 2 Figure 2 to Part 1513—Test Probe for Neck Entrapment...

Influence of anxiety on memory performance in temporal lobe epilepsy.

PubMed

Brown, Franklin C; Westerveld, Michael; Langfitt, John T; Hamberger, Marla; Hamid, Hamada; Shinnar, Shlomo; Sperling, Michael R; Devinsky, Orrin; Barr, William; Tracy, Joseph; Masur, David; Bazil, Carl W; Spencer, Susan S

2014-02-01

This study examined the degree to which anxiety contributed to inconsistent material-specific memory difficulties among 243 patients with temporal lobe epilepsy from the Multisite Epilepsy Study. Visual memory performance on the Rey Complex Figure Test (RCFT) was poorer for those with high versus low levels of anxiety but was not found to be related to the TLE side. The verbal memory score on the California Verbal Learning Test (CVLT) was significantly lower for patients with left-sided TLE than for patients with right-sided TLE with low anxiety levels but equally impaired for those with high anxiety levels. These results suggest that we can place more confidence in the ability of verbal memory tests like the CVLT to lateralize to left-sided TLE for those with low anxiety levels, but that verbal memory will be less likely to produce lateralizing information for those with high anxiety levels. This suggests that more caution is needed when interpreting verbal memory tests for those with high anxiety levels. These results indicated that RCFT performance was significantly affected by anxiety and did not lateralize to either side, regardless of anxiety levels. This study adds to the existing literature which suggests that drawing-based visual memory tests do not lateralize among patients with TLE, regardless of anxiety levels. © 2013.

Comparing apples and pears: women's perceptions of their body size and shape.

PubMed

Thoma, Marie E; Hediger, Mary L; Sundaram, Rajeshwari; Stanford, Joseph B; Peterson, C Matthew; Croughan, Mary S; Chen, Zhen; Buck Louis, Germaine M

2012-10-01

Obesity is a growing public health problem among reproductive-aged women, with consequences for chronic disease risk and reproductive and obstetric morbidities. Evidence also suggests that body shape (i.e., regional fat distribution) may be independently associated with risk, yet it is not known if women adequately perceive their shape. This study aimed to assess the validity of self-reported body size and shape figure drawings when compared to anthropometric measures among reproductive-aged women. Self-reported body size was ascertained using the Stunkard nine-level figures and self-reported body shape using stylized pear, hourglass, rectangle, and apple figures. Anthropometry was performed by trained researchers. Body size and body mass index (BMI) were compared using Spearman's correlation coefficient. Fat distribution indicators were compared across body shapes for nonobese and obese women using analysis of variance (ANOVA) and Fisher's exact test. Percent agreement and kappa statistics were computed for apple and pear body shapes. The 131 women studied were primarily Caucasian (81%), aged 32 years, with a mean BMI of 27.1 kg/m(2) (range 16.6-52.8 kg/m(2)). The correlation between body size and BMI was 0.85 (p<0.001). Among nonobese women, waist-to-hip ratios (WHR) were 0.75, 0.75, 0.80, and 0.82 for pear, hourglass, rectangle, and apple, respectively (p<0.001). Comparing apples and pears, the percent agreement (kappa) for WHR≥0.80 was 83% (0.55). Self-reported size and shape were consistent with anthropometric measures commonly used to assess obesity and fat distribution, respectively. Self-reported body shape may be a useful proxy measure in addition to body size in large-scale surveys.

Hypothesis regarding the transformation of the intended direction of movement during the production of graphic trajectories: a study of drawing movements in 8- to 12-year-old children.

PubMed

Pellizzer, Giuseppe; Zesiger, Pascal

2009-03-01

Children from 8 to 12 years of age drew figure-eights and ellipses at a self-chosen tempo on a digitizing tablet. Global aspects (perimeter and average speed) and local aspects (relation between instantaneous speed and curvature) of performance were analyzed across age groups and types of figures. We tested the predictions of the transformation model, which is based on the hypothesis that changing the intended direction of movement is a time-consuming process that affects the evolution in time of the movement trajectory, and compared how well it fitted the data relative to the power law. We found that the relation between speed and curvature was typically better described by the transformation model than by the power law. However, the power law provided a better description when ellipses were drawn at a fast speed. The analyses of the parameters of the transformation model indicate that processing speed increased linearly with age. In addition, the results suggest that the effects of the spring-like properties of the arm were noticeable when ellipses were drawn at a fast speed. This study indicates that both biomechanical properties and central processes have an effect on the kinematics of continuous movements and particularly on the relation between speed and curvature. However, their relative importance varies with the type of figure and average movement speed. In conclusion, the results support the hypothesis that a time-consuming process of transformation of the intended direction of movement is operating during the production of continuous movements and that this process increases in speed between 8 to 12 years of age.

The role of shape recognition in figure/ground perception in infancy.

PubMed

White, Hannah; Jubran, Rachel; Heck, Alison; Chroust, Alyson; Bhatt, Ramesh S

2018-04-30

In this study we sought to determine whether infants, like adults, utilize previous experience to guide figure/ground processing. After familiarization to a shape, 5-month-olds preferentially attended to the side of an ambiguous figure/ground test stimulus corresponding to that shape, suggesting that they were viewing that portion as the figure. Infants' failure to exhibit this preference in a control condition in which both sides of the test stimulus were displayed as figures indicated that the results in the experimental condition were not due to a preference between two figure shapes. These findings demonstrate for the first time that figure/ground processing in infancy is sensitive to top-down influence. Thus, a critical aspect of figure/ground processing is functional early in life.

Assessing the Use of Game-Based Exercises in the Staff Attack-the-Network Course

DTIC Science & Technology

2015-06-01

B-1 vi CONTENTS (continued) Page LIST OF FIGURES FIGURE 1. EDGE PLAYER AVATAR ...players to control an in-game avatar (see Figure 1), navigate terrain, and use vehicles, 3 equipment, and tools for a variety of social-cultural task... Avatar . Figure 2. EDGE Operational Environment. Method The basic methodology consisted of collecting pre-test and post-test knowledge

Predictions of Helmet Pad Suspension System Performance using Isolated Pad Impact Results

DTIC Science & Technology

2010-09-13

Equation 2 and Equation 3, respectively. 3. METHOD The primary method of data collection for this report is detailed in the 2008 Joint Live Fire ...tests and the helmet system tests (see Figure 3). All testing was performed with a monorail drop tower (see Figure 4) at three conditioning...right) and system test setup (right and center left) Figure 5. MEP monorail drop test setup with a hemispherical impactor (left and center left

TSP Symposium 2013 Proceedings

DTIC Science & Technology

2014-01-01

test and Post - test Results of the Experimental Group Our results show that the experimental group improved on the post - test compared...4.3.4 Design of the Learning Strategy 27 4.4 Results 28 4.4.1 Post - test 28 4.4.2 Analysis of the Results 28 4.4.3 Analysis of the Results from the...Estimation Accuracy) 17 Figure 5: Methodology for the Research 24 Figure 6: Question 1, Time Control for Post - test 28 Figure 7:

Saccadic velocity measurements in strabismus.

PubMed Central

Metz, H S

1983-01-01

Traditional evaluation of strabismus has included cover test measurements, evaluation of the range of ocular rotations, and an array of subjective sensory tests. These studies could not always differentiate paresis of an extraocular muscle from restrictions and from various neuro-ophthalmic motility disorders. The measurement of horizontal and vertical saccadic movements can provide an objective test of rectus muscle function. Using EOG, saccades can be recorded easily, inexpensively, and repeatably at any age. In ocular muscle paresis or paralysis, saccadic speed is reduced mildly to markedly and can be used to monitor recovery. Assessment of saccadic velocity does not appear useful in evaluating superior oblique palsy, although it is valuable in sixth nerve palsy, Duane's syndrome, and third nerve palsy. When restrictions are the major cause of limited rotation, as in thyroid ophthalmopathy and orbital floor fracture, saccadic speed is unaffected. The induction of OKN or vestibular nystagmus is helpful in the study of children too young to perform voluntary saccadic movements. In patients with limitation of elevation or depression, this technique can separate innervational from mechanical causes of diminished rotation. The specific saccadic velocity pattern in myasthenia gravis, progressive external ophthalmoplegia, internuclear ophthalmoplegia, and Möbius' syndrome is helpful in differentiating these disorders from other neuroophthalmic motility problems. Transposition surgery of the rectus muscle is effective because of an increase in force, seen as an improvement in saccadic velocity and resulting from the change of insertion of the muscles. Saccadic velocities can also be of assistance in diagnosing a lost or disinserted muscle following surgery for strabismus. Although analysis of saccadic velocity is not required for the proper evaluation of all problems in strabismus and motility, it can be of inestimable value in the diagnosis of many complex and confusing disorders. Together with forced duction testing, a clinical profile can be obtained concerning muscle force and muscle and orbital restrictions, which are required information for appropriate surgical planning. Images FIGURE 25 FIGURE 1 FIGURE 2 FIGURE 5 FIGURE 6 FIGURE 10 FIGURE 11 FIGURE 12 FIGURE 13 FIGURE 16 FIGURE 18 FIGURE 19 FIGURE 28 FIGURE 29 FIGURE 43 FIGURE 44 PMID:6676980

Exploratory study of the relations between spatial ability and drawing from memory.

PubMed

Czarnolewski, Mark Y; Eliot, John

2012-04-01

Test scores of 119 students, attending either a public four-year college or a technical school, were related to their proportionality and detail drawing scores on the Memory for Designs Test. In regression models, the ETS Maze Tracing, Eliot-Price Mental Rotations, and Bender-Gestalt tests were consistent predictors of proportionality scores, with the latter two tests uniquely related to these. The ETS Shapes Memory Test and the Form Board Test were the strongest predictors for detail accuracy scores. The Shapes test predicted proportionality when the CTY Visual Memory Test BB was excluded. The models then provided support for the hypothesis that drawing designs from memory, a critical skill in drawing, regardless of whether one focuses on accuracy for proportionality scores or for detail scores, is jointly related to the measures of recognition, production, and traditional spatial ability measures. This study identified multifaceted skills in drawing from memory.

Silver Drawing Test of Cognitive Skills and Adjustment. Drawing What You Predict, What You See, and What You Imagine.

ERIC Educational Resources Information Center

Silver, Rawley

This manual is a revision of the manual originally published in 1983. Since then it has been discovered that stimulus drawing tasks, like the Drawing from Imagination subtest of the Silver Drawing Test of Cognitive and Creative Skills (SDT), can be used to screen for depression and emotional adjustment. New research findings are the basis for…

Molecular Ecology of Bacterial Populations in Environmental Hazardous Chemical Control

DTIC Science & Technology

1991-11-30

Reactor Figure 1. A schematic drawing of the bioreactor system for on-line studies of naphthalene degradation and light production by bioluminescent...the bioluminescent monitoring section. The reactor system consisted of a L. H. Fermentation Series 500 continuous flow bioreactor with a 1 L glass... studied the expression of the upper pathway operon of NAH7. Light induction in response to naphthalene in the strain HK44 was comparable in both

[About a fortuitous representation of a case of intestinal malrotation by Wilhem His (1880)].

PubMed

Louryan, S

2011-06-01

In a textbook published in 1882, His exhibits drawings devoted to intestine development. The last figure depicts a typical case of gut malrotation, but there is no comment about this in the text. It could be possible that this omission should be due to the fact that mechanisms of gut development were not totally elucidated at this time. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

Possible Gravitational Anomalies in Quantum Materials. Phase 1: Experiment Definition and Design

DTIC Science & Technology

2007-02-01

temperature achievable with the experiment at liquid nitrogen . The signal of the superconducting ring when decelerating from a mean rotational speed...temperatures below 50 K (see Figure 2.2-5). This experiments would require liquid He, as nitrogen solidifies at 63 K, therefore a temperature lowering... Using Government drawings, specifications, or other data included in this document for any purpose other than Government procurement does not in any way

Hybrid Warfare: Preparing for Future Conflict

DTIC Science & Technology

2015-02-17

of our allies will draw us into these wars, as we seek to maintain international order and prevent the spillover effects of war. The strategic...order and prevent the spillover effects of war, such as international terrorism and the mass flow of refugees. Figure 1 (see previous page) depicts...remain and have to be dealt with at the same time and in the same space, stressing the resources and overloading the systems of western militaries

JPRS Report, Proliferation Issues

DTIC Science & Technology

1993-04-23

talks with nator of Faction Fatherland, General Lieutenant Gen - Ukraine. nadiy Benov declared that the START-2 Treaty "is draw- "Recently," he noted...borders were in English 13 Apr 93 p 13 recently equipped with radioactive detectors, although, [Report by Matthias Lifkens in Vilnius: "Safety Fear...members." Now for some figures: by 1933, when our chemical gen - Fedorov on Abuses in Secrecy on CW erals took over all the experience from the Germans, a

Psychological differentiation in Nigerian children.

PubMed

Jegede, R

1976-11-01

The human figure drawings of 646 male and female Nigerian primary school children were analyzed with the use of Witkin's Articulation of Body Concept (ABC) scale. There was a significant association between age and ABC scores for the Ss as a group. The correlation between age and ABC scores was significant with male Ss and almost so with female Ss. These findings are on the whole consistent with the results of previous research conducted in different sociocultural settings.

Visuoconstructional Impairment in Subtypes of Mild Cognitive Impairment

PubMed Central

Ahmed, Samrah; Brennan, Laura; Eppig, Joel; Price, Catherine C.; Lamar, Melissa; Delano-Wood, Lisa; Bangen, Katherine J.; Edmonds, Emily C.; Clark, Lindsey; Nation, Daniel A.; Jak, Amy; Au, Rhoda; Swenson, Rodney; Bondi, Mark W.; Libon, David J.

2018-01-01

Clock Drawing Test performance was examined alongside other neuropsychological tests in mild cognitive impairment (MCI). We tested the hypothesis that clock-drawing errors are related to executive impairment. The current research examined 86 patients with MCI for whom, in prior research, cluster analysis was used to sort patients into dysexecutive (dMCI, n=22), amnestic (aMCI, n=13), and multi-domain (mMCI, n=51) subtypes. First, principal components analysis (PCA) and linear regression examined relations between clock-drawing errors and neuropsychological test performance independent of MCI subtype. Second, between-group differences were assessed with analysis of variance (ANOVA) where MCI subgroups were compared to normal controls (NC). PCA yielded a 3-group solution. Contrary to expectations, clock-drawing errors loaded with lower performance on naming/lexical retrieval, rather than with executive tests. Regression analyses found increasing clock-drawing errors to command were associated with worse performance only on naming/lexical retrieval tests. ANOVAs revealed no differences in clock-drawing errors between dMCI versus mMCI or aMCI versus NCs. Both the dMCI and mMCI groups generated more clock-drawing errors than the aMCI and NC groups in the command condition. In MCI, language-related skills contribute to clock-drawing impairment. PMID:26397732

An Approach to Analyze Personnel Injury of Reflective Spall from Small-Arms Protective Body Armor

DTIC Science & Technology

2011-07-01

2  Figure 2. Protective plate system on the ORCA human anatomy . .................................................2  Figure 3...stature and is fitted with a medium size protective plate. Representation of the ORCA human anatomy wearing the protective plate system is shown in...Figure 1. Gelatin block placement for experimental testing. Figure 2. Protective plate system on the ORCA human anatomy . Ballistic Gelatin Test

Screening for cognitive dysfunction in Huntington's disease with the clock drawing test.

PubMed

Terwindt, Paul W; Hubers, Anna A M; Giltay, Erik J; van der Mast, Rose C; van Duijn, Erik

2016-09-01

The aim of the study is to investigate the performance of the clock drawing test as a screening tool for cognitive impairment in Huntington's disease (HD) mutation carriers. The performance of the clock drawing test was assessed in 65 mutation carriers using the Shulman and the Freund scoring systems. The mini-mental state examination, the Symbol Digit Modalities Test, the Verbal Fluency Test, and the Stroop tests were used as comparisons for the evaluation of cognitive functioning. Correlations of the clock drawing test with various cognitive tests (convergent validity), neuropsychiatric characteristics (divergent validity) and clinical characteristics were analysed using the Spearman's rank correlation coefficient. Receiver-operator characteristic analyses were performed for the clock drawing test against both the mini-mental state examination and against a composite variable for executive cognitive functioning to assess optimal cut-off scores. Inter-rater reliability was high for both the Shulman and Freund scoring systems (ICC = 0.95 and ICC = 0.90 respectively). The clock drawing tests showed moderate to high correlations with the composite variable for executive cognitive functioning (mean ρ = 0.75) and weaker correlations with the mini-mental state examination (mean ρ = 0.62). Mean sensitivity of the clock drawing tests was 0.82 and mean specificity was 0.79, whereas the mean positive predictive value was 0.66 and the mean negative predictive value was 0.87. The clock drawing test is a suitable screening instrument for cognitive dysfunction in HD, because it was shown to be accurate, particularly so with respect to executive cognitive functioning, and is easy and quick to use. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

Body image, perceived physical ability, and motor performance in nonoverweight and overweight Italian children.

PubMed

Colella, Dario; Morano, Milena; Robazza, Claudio; Bortoli, Laura

2009-02-01

The purpose was to examine body image, perceived physical ability, and motor performance in nonoverweight (n=105, 53 boys and 52 girls) and overweight (n=105, 52 boys and 53 girls) children, ranging in age from 8 to 10 years and attending elementary schools in southeastern Italy. Body image was measured on Collins' Child Figure Drawings, while self-efficacy was assessed by the Perceived Physical Ability Scale for Children. Age-appropriate field-based tests of standing long jump, 1-kg medicine-ball throw, basketball throw, and 10-m and 20-m sprint from a standing position were also administered to gauge motor performance. Univariate analyses of variance [2 (group) x 2 (sex) x 3 (8, 9, 10 yr.)] showed that overweight children reported larger body-dissatisfaction scores, lower self-efficacy scores, and poorer performance on weight-bearing tasks than nonoverweight peers. In addition, boys had higher mean scores on physical self-efficacy and better performance on all motor tests. The correlation between Body Mass Index and body dissatisfaction was positive for boys and girls.

59. Historic elevation and detail drawing of Building 202 test ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

59. Historic elevation and detail drawing of Building 202 test cell, June 29, 1955. NASA GRC drawing no. CE-101341 (On file at NASA Glenn Research Center). - Rocket Engine Testing Facility, GRC Building No. 202, NASA Glenn Research Center, Cleveland, Cuyahoga County, OH

The Development of Barrier Materials for Flexible Aircraft Engine Containers

DTIC Science & Technology

1977-05-01

niif ^»imi,ii ^WMM 1 i...ÄWMHWÜippHI ■" ’ " ■ " -" I—i»*f^^ MM^Mimai ^m t Figure 7. Figure 8. Figure 9 . Figure 10. Figure 11. Figure 12. Figure 13. Figure 14. Figure...Evaluation Program 8 Barrier Material Test Data 9 iv % •■■~v’ ■ ■Ä’ ■" mam --"■- ——,«. ms"-- «r MlMiafhf^ - ■"’ ^-g^aaa--^-^^"’^-’

Experimental Life Cycle of Hypoderaeum conoideum (Block, 1872) Diez, 1909(Trematoda: Echinostomatidae) Parasite from the North of Iran

PubMed Central

AZIZI, Hekmat; FARAHNAK, Ali; MOBEDI, Iraj; MOLAEI RAD, MohamadBagher

2015-01-01

Background: Human Echinostomiasis is an intestinal disease caused by the members of family Echinostomatidae parasites. The aim of present research was to identify echinostomatidae cercariae emitted by Lymnaea palustris snails from Mazandaran province in the north of Iran based on the morphological and morphometrical characteristics of the different stages of experimental parasite life cycle. Methods: Echinostomatidae cercariae were collected from L. palustris (Gastropoda: Lymnaeidae) of the north of Iran. To collect metacercaria, 50 healthy snails were infected with cercariae experimentally (50 cercariae for each). To obtain the adult stage, 9 laboratory animals (3 ducks, 2 rats, 2 mice and 2 quails) were fed with 60 metacercaria for each. To identify parasite, the different stages of worm were examined using light microscope and then the figures were draw under camera Lucida microscope and measures were determined. Results: Averagely, 15metacercaria were obtained from each snail that had been previously exposed with cercariae. Ducks presented worm eggs in feces after 10–15 days post-infection. Intestinal worms were collected and identified as Hypoderaeum conoideum on the bases of figures and measures of cephalic collar, the number of collar spine, suckers diameter ratio, testes arrangement, etc. Conclusion: H. conoideum cercariae and adult worm are described. This is the first report of the different stages of the experimental life cycle of this parasite in Iran. PMID:25904952

Experimental Life Cycle of Hypoderaeum conoideum (Block, 1872) Diez, 1909(Trematoda: Echinostomatidae) Parasite from the North of Iran.

PubMed

Azizi, Hekmat; Farahnak, Ali; Mobedi, Iraj; Molaei Rad, MohamadBagher

2015-01-01

Human Echinostomiasis is an intestinal disease caused by the members of family Echinostomatidae parasites. The aim of present research was to identify echinostomatidae cercariae emitted by Lymnaea palustris snails from Mazandaran province in the north of Iran based on the morphological and morphometrical characteristics of the different stages of experimental parasite life cycle. Echinostomatidae cercariae were collected from L. palustris (Gastropoda: Lymnaeidae) of the north of Iran. To collect metacercaria, 50 healthy snails were infected with cercariae experimentally (50 cercariae for each). To obtain the adult stage, 9 laboratory animals (3 ducks, 2 rats, 2 mice and 2 quails) were fed with 60 metacercaria for each. To identify parasite, the different stages of worm were examined using light microscope and then the figures were draw under camera Lucida microscope and measures were determined. Averagely, 15metacercaria were obtained from each snail that had been previously exposed with cercariae. Ducks presented worm eggs in feces after 10-15 days post-infection. Intestinal worms were collected and identified as Hypoderaeum conoideum on the bases of figures and measures of cephalic collar, the number of collar spine, suckers diameter ratio, testes arrangement, etc. H. conoideum cercariae and adult worm are described. This is the first report of the different stages of the experimental life cycle of this parasite in Iran.

The Effect of Cartooning Instruction in a Full-Inclusive Setting on Rural Children's Performances on the Goodenough-Harris Drawing Test: Selected Case Studies.

ERIC Educational Resources Information Center

Elrod, G. Franklin; Obringer, S. John

Many researchers have attempted to link children's drawings to intelligence. The Goodenough-Harris Draw-a-Man (DAM) and Draw-a-Woman (DAW) test has been accepted as an indicator of intelligence. This study, via examination of specific cases, explored the effect that instruction in drawing cartoons had on the DAM and DAW performance of 16…

13. Historic drawing of rocket engine test facility layout, including ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

13. Historic drawing of rocket engine test facility layout, including Buildings 202, 205, 206, and 206A, February 3, 1984. NASA GRC drawing number CF-101539. On file at NASA Glenn Research Center. - Rocket Engine Testing Facility, NASA Glenn Research Center, Cleveland, Cuyahoga County, OH

Preschool visual acuity screening tests.

PubMed Central

Friendly, D S

1978-01-01

The purpose of the study was to evaluate the relative merits of two screening tests used for visual acuity assessment of preschool children. The tests that were compared were the Good-Lite Company versions of the E-Test and of the STYCAR (Screening Test for Young Children and Retardates). The former is the most popular method for evaluating central acuity in young children in this nation; the STYCAR is a relatively new letter-matching-test developed in England, where it is widely employed. The E-Test poses left-right orientation problems which are eliminated by the symmetrical letters H, T, O and V utilized in the Letter-Matching-Test. Both visual acuity tests were administered on two separate occasions by personnel from the Prevention of Blindness Society of Metropolitan Washington to 633 preschool children in Washington, D.C. By random selection, 150 of the children received the E-Test at both sessions, 162 children received the Letter-Matching-Test at both sessions, 160 chilt athe the second session, and 161 children received the Letter-Matching-Test at the first session and the E-Test at the second session. The author medically examined the eyes of 408 of the 633 children without knowledge of which test had been initially administered. Statistical analysis of the data obtained from the study indicated that the Letter-Matching-Test was significantly better in terms of testability rates, group and individual instruction time, and performance time. The E-Test was more reliable in terms of test-retest acuity scores and was also more valid in terms of agreement between pass-fail results obtained at the first screening session and two levels of pass-fail refraction criteria. Images FIGURE 4 FIGURE 5 FIGURE 7 A FIGURE 7 B FIGURE 9 A FIGURE 9 B PMID:754379

The Effect of Malathion on the Activity and Performance of Activated Sludge

DTIC Science & Technology

2015-03-26

33 and 59 µg O2 min-1. The oxygen consumption curves were similar in each case, beginning with rapid oxygen AFIT-ENV-MS-15-M-197 v...3: Respirometry Test 6 – Cumulative Oxygen Consumption ............................... 45 Figure 4: SOUR for Malathion Concentrations in Activated...76 Figure 20: Respirometry Test 1 – Cumulative Oxygen Consumption ............................. 86 Figure 21: Respirometry Test 1

Older age relates to worsening of fine motor skills: a population-based study of middle-aged and elderly persons.

PubMed

Hoogendam, Yoo Young; van der Lijn, Fedde; Vernooij, Meike W; Hofman, Albert; Niessen, Wiro J; van der Lugt, Aad; Ikram, M Arfan; van der Geest, Jos N

2014-01-01

In a population-based study of 1,912 community-dwelling persons of 45 years and older, we investigated the relation between age and fine motor skills using the Archimedes spiral-drawing test. Also, we studied the effect of brain volume on fine motor skills. Participants were required to trace a template of a spiral on an electronic drawing board. Clinical scores from this test were obtained by visual assessment of the drawings. Quantitative measures were objectively determined from the recorded data of the drawings. As tremor is known to occur increasingly with advancing age, we also rated drawings to assess presence of tremor. We found presence of a tremor in 1.3% of the drawings. In the group without tremor, we found that older age was related to worse fine motor skills. Additionally, participants over the age of 75 showed increasing deviations from the template when drawing the spiral. Larger cerebral volume and smaller white matter lesion volume were related to better spiral-drawing performance, whereas cerebellar volume was not related to spiral-drawing performance. Older age is related to worse fine motor skills, which can be captured by clinical scoring or quantitative measures of the Archimedes spiral-drawing test. Persons with a tremor performed worse on almost all measures of the spiral-drawing test. Furthermore, larger cerebral volume is related to better fine motor skills.

Ethnic Differences in the Goodenough-Harris Draw-a-Man and Draw-a-Woman Tests.

ERIC Educational Resources Information Center

Dugdale, A. E.; Chen, S. T.

1979-01-01

The draw-a-man (DAM) and draw-a-woman (DAW) tests were given to 307 school children in Petaling Jaya, Malaysia. The children were ethnically Malay, Chinese, or Indian (Tamil), and all came from lower socioeconomic groups. Journal availability: British Medical Journal, 1172 Commonwealth Ave., Boston, MA 02134. (Author)

41. INDEX OF ALL TAN 629 HANGAR DRAWINGS IN THE ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

41. INDEX OF ALL TAN 629 HANGAR DRAWINGS IN THE RALPH M. PARSONS SERIES OF DRAWINGS OF THE FLIGHT ENGINE TEST FACILITY. RALPH M. PARSONS DRAWING NUMBER: 1229-2 ANP/GE 5-100. DATED MARCH 15, 1957. - Idaho National Engineering Laboratory, Test Area North, Hangar No. 629, Scoville, Butte County, ID

29. Photocopy of engineering drawing, May, 1941 (original drawing located ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

29. Photocopy of engineering drawing, May, 1941 (original drawing located at Fairchild Air Force Base, Civil Engineering Building, Civil Engineering vault). ENGINE TEST CELL BUILDING. 19508 RENOVATION OF FIRST FLOOR, CENTRAL PORTION. - Fairchild Air Force Base, Engine Test Cell Building, Near intersection of Arnold Street & George Avenue, Spokane, Spokane County, WA

Experimental postoperative endophthalmitis.

PubMed Central

Forster, R K

1992-01-01

Various inocula of vancomycin-sensitive E faecalis (EF01), S aureus (SA02), S epidermidis (SE03), and B cereus (BC04), were intravitreally inoculated into an aphakic rabbit model with and without vancomycin, with or without vitrectomy. A summation average of the clinical response mean scores of various inocula (10(3), 10(5), 10(7) cfu) in the absence of therapy ranked these etiologic agents in the order of severity as SE03 (1.4), BC04 (1.8), EF01 (2.3), and SA02 (2.8). These favorably compared with the histopathology cavitary/noncavitary mean scores in increasing order of severity: SE03 (1.7/0.6), BC04 (1.7/0.9), EF01 (2.4/1.1), and SA02 (2.5/1.5), compared with control eyes (1.1/0.4). If the inoculum was increased to 10(7) cfu, SE03 (2.4/0.9) and BC04 (2.8/2.0) could equate EF01 and SA02. Treatment with 1 mg of vancomycin, with or without vitrectomy, did not significantly alter the overall inflammatory response to these four endophthalmitis isolates. No treatment was necessary to achieve > 99.9% killing effect by 72 hours when testing BC04, while any of the treatment modalities during 72 hours achieved 99.9% killing effect when testing SE03. No treatment modality achieved a 99.9% killing effect when testing EF01 or SA02. No single in vitro result could predict the in vivo microbiologic behavior of this model. Further research is needed to better understand the role of antiinflammatory agents, multiple drug therapy, and multiple-injection single-drug therapy with or without vitrectomy, and their impact on the inflammatory response in the aphakic model, to better treat endophthalmitis and thus improve visual prognosis. Images FIGURE 17 A FIGURE 17 B FIGURE 17 C FIGURE 18 A FIGURE 18 B FIGURE 18 C FIGURE 19 A FIGURE 19 B FIGURE 19 C FIGURE 20 A FIGURE 20 B FIGURE 20 C FIGURE 31 A FIGURE 31 B FIGURE 32 A FIGURE 32 B FIGURE 33 A FIGURE 33 B FIGURE 34 A FIGURE 34 B PMID:1494833

Challenging stereotypes? The older woman in the TV series Brothers & Sisters.

PubMed

Oró-Piqueras, Maricel

2014-12-01

The TV series, Brothers & Sisters, broadcast from 2006 to 2011 by ABC (USA) and a year later by Channel 4 (UK) with quite high audience rates, starts when the patriarchal figure, William Walker, dies of a heart attack and two female figures around their sixties come center stage: his wife, Nora Walker, and his long-term lover, Holly Harper. Once the patriarchal figure disappears, the female characters regain visibility by entering the labor market and starting relationships with other men. In that sense, both protagonists experience aging as a time in which they are increasingly freed from social and family constraints. However, their roles as nurturers keep on bringing them back to the domestic space in which they are safe from being involved in uncomfortable and unsuitable situations. Drawing on previous studies on the representation of the older woman in fictional media, this article intends to discern to what extent stereotypes related to the older woman are challenged through the two main protagonists of a contemporary TV series. Copyright © 2014 Elsevier Inc. All rights reserved.

4. This photographic copy of an engineering drawing shows the ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

4. This photographic copy of an engineering drawing shows the plan and details for Test Stand "G" and the placement of the vibrator. California Institute of Technology, Jet Propulsion Laboratory, Plant Engineering: "Vibration Test Facility-Bldg E-72, Floor & Roof Plans, Sections, Details & Door Schedule," drawing no. E72/2-5, 21 May 1964. California Institute of Technology, Jet Propulsion Laboratory, Plant Engineering: engineering drawings of structures at JPL Edwards Facility. Drawings on file at JPL Plant Engineering, Pasadena, California. - Jet Propulsion Laboratory Edwards Facility, Test Stand G, Edwards Air Force Base, Boron, Kern County, CA

Persistent negative illness perceptions despite long-term biochemical control of acromegaly: novel application of the drawing test.

PubMed

Tiemensma, Jitske; Pereira, Alberto M; Romijn, Johannes A; Broadbent, Elizabeth; Biermasz, Nienke R; Kaptein, Adrian A

2015-05-01

Patients with acromegaly have persistent complaints despite long-term biochemical control. Drawings can be used to assess patients' perceptions about their disease. We aimed to explore the utility of the drawing test and its relation to illness perceptions and quality of life (QoL) in patients after long-term remission of acromegaly. A cross-sectional study was conducted to evaluate the utility of the drawing test. A total of 50 patients after long-term remission (mean±s.e.m., 16±1.2 years) of acromegaly were included in this study. Patients completed the drawing test (two retrospective drawings of their body perception before acromegaly and during the active phase of acromegaly, and one drawing on the current condition after long-term remission), Illness Perception Questionnaire-Revised, Physical Symptom Checklist, EuroQoL-5D, and AcroQoL. Patients perceived a dramatic change in body size during the active state of the disease compared with the healthy state before the awareness of acromegaly. Patients reported that their body did not completely return to the original proportions after long-term remission. In addition, larger drawings indicated more negative consequences (P<0.05), a higher score on emotional representations (P<0.05), and more perceived symptoms that were attributed to acromegaly (P<0.01). Larger drawings also indicated more impaired QoL, especially disease-specific QoL (all P<0.05). There are strong correlations among the drawing test, illness perceptions, and QoL. The drawing test appears to be a novel and relatively easy tool to assess the perception of patients after long-term remission of acromegaly. The assessment of drawings may enable health care providers to appreciate the perceptions of patients with long-term remission of acromegaly, and enable discussion of symptoms and remission. © 2015 European Society of Endocrinology.

Novel Robotic Tools for Piping Inspection and Repair, Phase 1

DTIC Science & Technology

2014-02-13

35 Figure 57 - Accowle ODVS cross section and reflective path ......................................... 36 Figure 58 - Leopard Imaging HD...mounted to iPhone ............................................................................. 39 Figure 63 - Kogeto mounted to Leopard Imaging HD...40 Figure 65 - Leopard Imaging HD camera pipe test (letters) ............................................. 40 Figure 66 - Leopard Imaging HD camera

40 CFR 90.709 - Calculation and reporting of test results.

Code of Federal Regulations, 2014 CFR

2014-07-01

... expressed to one additional significant figure. (b) Final test results are calculated by summing the initial... applicable standard expressed to one additional significant figure. (c) The final deteriorated test results...

40 CFR 90.709 - Calculation and reporting of test results.

Code of Federal Regulations, 2011 CFR

2011-07-01

... expressed to one additional significant figure. (b) Final test results are calculated by summing the initial... applicable standard expressed to one additional significant figure. (c) The final deteriorated test results...

50 CFR Figure 7 to Part 679 - Location of Trawl Gear Test Areas in the GOA and the BSAI

Code of Federal Regulations, 2010 CFR

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Location of Trawl Gear Test Areas in the GOA and the BSAI 7 Figure 7 to Part 679 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT... EXCLUSIVE ECONOMIC ZONE OFF ALASKA Pt. 679, Fig. 7 Figure 7 to Part 679—Location of Trawl Gear Test Areas in...

Real-Time Parallel Software Design Case Study: Implementation of the RASSP SAR Benchmark on the Intel Paragon.

DTIC Science & Technology

1996-01-01

Real-Time 19 5 Conclusion 23 List of References 25 ii LIST OF FIGURES FIGURE PAGE 3-1 Test Bench Pseudo Code 7 3-2 Fast Convolution...3-1 shows pseudo - code for a test bench with two application nodes. The outer test bench wrapper consists of three functions: pipeline_init, pipeline...exit_func); Figure 3-1. Test Bench Pseudo Code The application wrapper is contained in the pipeline routine and similarly consists of an

16 CFR Figure 7 to Part 1203 - Typical Test Apparatus for Positional Stability Test

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Typical Test Apparatus for Positional Stability Test 7 Figure 7 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER...—Typical Test Apparatus for Positional Stability Test ER10MR98.007 ...

16 CFR Figure 7 to Part 1203 - Typical Test Apparatus for Positional Stability Test

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Typical Test Apparatus for Positional Stability Test 7 Figure 7 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER...—Typical Test Apparatus for Positional Stability Test ER10MR98.007 ...

Psychobiography and the Psychology of Religion: A Tribute to the Work of Donald Capps.

PubMed

Jacobs, Janet

2018-04-01

This article examines Donald Capps's work on the psychology of major religious figures and the social forces that informed their psychic lives, spiritual worldviews, and teachings. Drawing on four texts that were published between 2000 and 2014, the essay explores Capps's views on the importance of psychobiography to the study of religion and the specific contributions his thinking has made to a greater understanding of the historical Jesus. The article considers Capps's analysis of Jesus's illegitimacy and his role as healer within the society in which he lived and preached. Building on Capps's work, the article also expands on feminist and postcolonial theories that offer insight into the psychosocial development of religious figures whose teachings and beliefs emerged out of their individual life circumstances and the larger socio-political culture in which they lived.

Early Detection of Prostate Cancer

DTIC Science & Technology

2007-01-01

pads and the external traces. Figure 13 shows the copper board with SMA connectors which were used to test the SH-SAW devices. The frequency...Figure 11. 3-dimensional view of the final device. Figure 12. Fabricated SH-SAW devices cut on blue tape. Figure 13. SH-SAW devices on copper board...Figure 12. Fabricated SH-SAW devices cut on blue tape. 46 Figure 13. SH-SAW devices on copper board with SMA connectors. 47 Figure 14

Examining the Return on Investment of Test and Evaluation

DTIC Science & Technology

2015-03-26

Problem Discovery Cases Observed in DOT&E Oversight Programs ............... 4 Figure 2. DoD T&E Organizational Structure...11 Figure 3. Product Maturity Levels Commercial Firms Seek to Validate ........................ 23 Figure 4 ...beginning in its fiscal year (FY) 2011 report, the Director, Operational Test and Evaluation (DOT&E), started reporting significant issues observed

Testing of a Stacked Core Mirror for UV Applications

NASA Technical Reports Server (NTRS)

Matthews, Gary W.; Kirk, Charles S.; Maffett, Steven P.; Abplanalp, Calvin E.; Stahl, H. Philip; Eng, Ron; Arnold, William R. Sr.

2013-01-01

Advanced Ultraviolet, Optical, Near-Infrared (UVOIR) Mirror Technology Development (AMTD) Testing Summary: (1) Processing of the stacked core mirror converged very quickly using ion figuring. (2) Results show no significant PSD change due to ion figuring in spatial periods smaller than 20mm. (3) Global surface figure limited by mount repeatability

49 CFR Appendix - Figures to Subpart T of Part 572

Code of Federal Regulations, 2012 CFR

2012-10-01

... 49 Transportation 7 2012-10-01 2012-10-01 false Figures to Subpart T of Part 572 Appendix Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) ANTHROPOMORPHIC TEST DEVICES Hybrid III 10-Year-Old Child Test Dummy (HIII-10C) Appendix—Figures...

49 CFR Appendix - Figures to Subpart T of Part 572

Code of Federal Regulations, 2013 CFR

2013-10-01

... 49 Transportation 7 2013-10-01 2013-10-01 false Figures to Subpart T of Part 572 Appendix Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) ANTHROPOMORPHIC TEST DEVICES Hybrid III 10-Year-Old Child Test Dummy (HIII-10C) Appendix—Figures...

Development of Self-Lubricating Composites Utilizing Carbonized Phenolic Matrix. Part II. A Summary Report.

DTIC Science & Technology

1976-04-01

see Figure 4) or three can be machined and press-fit into the metal sleeves. Lower pressures have been used in molding the larger specimens because of...ing pressure , and method of forming the journal liners are addi- tional variables that enter into the data presentation . These are all grouped for...NOTICE When Government drawings, specifications, or other data are used for any purpose other than in connection with a definitely related Government

Role of NF-Kappa B Signaling in X-Box Binding Protein 1 (XBP1)-Mediated Antiestrogen Resistance in Breast Cancer

DTIC Science & Technology

2013-10-01

experiments, a statistically significant data is not yet available. Additional experiments are needed for us to be able to draw   conclu comb Figure...well-defined stress pathways, UPR and autophagy, are involved breast involution regulation. Using published gene expression array datasets from...performed involution time-course experiments using both low-dose drug interventions and an autophagy-related gene 7 (ATG7) deletion mouse model

Direct Digital Control of HVAC (Heating, Ventilating, and Air Conditioning Equipment (User’s Guide)

DTIC Science & Technology

1985-01-01

reset, load shedding, chiller optimization , VAV fan synchronization, and optimum start/stop. The prospective buyer of a DDC system should investigate...current and accurate drawings for a conventional, built-up control system such as that illustrated in Fig- ure 4. Data on setpoints , reset schedules, and...are always available in the form of the computer program code (Figure 7). In addition to the control logic, setpoint and other data are readily

Development of Biodegradable Implants for Use in Maxillofacial Surgery

DTIC Science & Technology

1988-09-23

Previous edit,ons are obsolete EC1_4 ’ Y C ,S ’iCAT ON OF 7±5S aGE I"L{..-. { ~; ABBREVIATIONS poly(DL-lactide) (DL-PLA) poly(L-lactide) (L-PLA...modulus of L-PLA plates ........... ......................... 53 13 Non-coated hydroxyapatite particles after drying .............. 59 14 Hydroxyapatite ...77 (continued) ix LIST OF FIGURES (continued) Fieure age 23 Drawing No. 1 scale: 1/2" - 1" iaterial:alumina (99.7% A1203

Floating Heavy Oil Recovery: Current State Analysis

DTIC Science & Technology

2006-07-27

recovered oil to a chute cause some build-up of oil, but the retained amount was not considered substantial enough to warrant any design changes. The GT...unit was the Lamor Brush Conveyor (shown in Figure 7) which uses a yellow V- brush design to recover oils and uses a propeller to draw water through...deals with the transfer of product that has already been collected and contained (Moffatt et al., 2004). The Coast Guard Research and Development

Investigation of Performance Improvements Including Application of Inlet Guide Vanes to a Cross-flow Fan

DTIC Science & Technology

2009-09-01

25 Figure 17. IGV Cut Out from Fluid Domain...Figure 22. Installed IGVS as Viewed from the CFF Inlet.................................................30 Figure 23. Schematic of Turbine Test Rig (TTR...44 Figure 28. Close In View of Velocity Vector Plot Near IGVS for 6IGV Model..............45 Figure 29

Older Age Relates to Worsening of Fine Motor Skills: A Population-Based Study of Middle-Aged and Elderly Persons

PubMed Central

Hoogendam, Yoo Young; van der Lijn, Fedde; Vernooij, Meike W.; Hofman, Albert; Niessen, Wiro J.; van der Lugt, Aad; Ikram, M. Arfan; van der Geest, Jos N.

2014-01-01

Introduction: In a population-based study of 1,912 community-dwelling persons of 45 years and older, we investigated the relation between age and fine motor skills using the Archimedes spiral-drawing test. Also, we studied the effect of brain volume on fine motor skills. Methods: Participants were required to trace a template of a spiral on an electronic drawing board. Clinical scores from this test were obtained by visual assessment of the drawings. Quantitative measures were objectively determined from the recorded data of the drawings. As tremor is known to occur increasingly with advancing age, we also rated drawings to assess presence of tremor. Results: We found presence of a tremor in 1.3% of the drawings. In the group without tremor, we found that older age was related to worse fine motor skills. Additionally, participants over the age of 75 showed increasing deviations from the template when drawing the spiral. Larger cerebral volume and smaller white matter lesion volume were related to better spiral-drawing performance, whereas cerebellar volume was not related to spiral-drawing performance. Conclusion: Older age is related to worse fine motor skills, which can be captured by clinical scoring or quantitative measures of the Archimedes spiral-drawing test. Persons with a tremor performed worse on almost all measures of the spiral-drawing test. Furthermore, larger cerebral volume is related to better fine motor skills. PMID:25309436

40 CFR 90.509 - Calculation and reporting of test results.

Code of Federal Regulations, 2014 CFR

2014-07-01

... contained in the applicable emission standard expressed to one additional significant figure. ASTM E29-93a... additional significant figure. (2) Final deteriorated test results (for Phase 2 test engines only) are...

[Illustrations of of alchemy vessels in a manuscript of Pseudo-Geber].

PubMed

Kurzmann, Peter

2011-01-01

Manuscript ric. 933 "Geber de investigatione perfectionis magisterii", kept in the Libreria Riccardiana in Florence, is a 13th century Latin version of the "Book of the Secret of the Secrets" ("kitab sirr al-asrar") by the Arabian alchemist al-Razi (865-925). The manuscript shows on page 25r a series of drawings of alchemistic vessels and apparatus which do not figure in the Arabian original but which are of particular interest as they date from as early as the 13th century and are numbered amongst the earliest drawings of this kind which we possess. The publication of the manuscript by Julius Ruska in 1935 shows only copied drawings with his interpretations of the legends. There was considerable interest in the publication of the original page 25r and in the course of further study it became clear that these interpretations had to be revised. These new interpretations presented in detail in this paper are justified and put into an alchemistic context. In some cases they give a new understanding and differ considerably from Ruska's versions.

The coal deposits of the Alkali Butte, the Big Sand Draw, and the Beaver Creek fields, Fremont County, Wyoming

USGS Publications Warehouse

Thompson, Raymond M.; White, Vincent L.

1952-01-01

Large coal reserves are present in three areas located between 12 and 20 miles southeast of Riverton, Fremont County, central Wyoming. Coal in two of these areas, the Alkali Butte coal field and the Big Sand Draw coal field, is exposed on the surface and has been developed to some extent by underground mining. The Beaver Creek coal field is known only from drill cuttings and cores from wells drilled for oil and gas in the Beaver Creek oil and gas field.These three coal areas can be reached most readily from Riverton, Wyo. State Route 320 crosses Wind River about 1 mile south of Riverton. A few hundred yards south of the river a graveled road branches off the highway and extends south across the Popo Agie River toward Sand Draw oil and gas field. About 8 miles south of the highway along the Sand Draw road, a dirt road bears east and along this road it is about 12 miles to the Bell coal mine in the Alkali Butte coal field. Three miles southeast of the Alkali Butte turn-off, 3 miles of oiled road extends southwest into the Beaver Creek oil and gas field. About 6 miles southeast of the Beaver Creek turn-off, in the valley of Little Sand Draw Creek, a dirt road extends east 1. mile and then southeast 1 mile to the Downey mine in the Big Sand Draw coal field. Location of these coal fields is shown on figure 1 with their relationship to the Wind River basin and other coal fields, place localities, and wells mentioned in this report. The coal in the Alkali Butte coal field is exposed partly on the Wind River Indian Reservation in Tps. 1 and 2 S., R. 6 E., and partly on public land. Coal in the Beaver Creek and Big Sand Draw coal fields is mainly on public land. The region has a semiarid climate with rainfall averaging less than 10 in. per year. When rain does fall the sandy-bottomed stream channels fill rapidly and are frequently impassable for a few hours. Beaver Creek, Big Sand Draw, Little Sand Draw, and Kirby Draw and their smaller tributaries drain the area and flow northwestward to the Wind River. This report is based almost entirely upon geologic investigations made in 1949 as a part of the program of the Department of the Interior for development of the Missouri River basin. Some coal sections were measured in 1950 and the additional information on the Big Sand Draw coal field was obtained in 1951. A geologic map of the Beaver Creek field was not prepared for this report because most of the significant coal occurs below a depth of 1,400 ft and is not exposed on the surface. Mr. George Downey, Lander, Wyo. , supplied much helpful information on the Big Sand Draw coal field and the area in general. Topographic contours shown on figures 11, 12, 13, and 14 are from unpublished plane-table sheets made by E. D. Woodruff in 1912. Previous geologic investigations of the region have been made by E. G. Woodruff and D. E. Winchester (1912), by C. J. Hares (1916), by A. J. Collier (1920), and C. M. Bauer (1934). Except for the work of Woodruff and Winchester, which was an areal examination for the purpose of classifying the public lands, the geological investigatiohs were of a general nature and give little detail of the coal beds. Berryhill (1950) summarizes Woodruff and Winchester's work.

Clock Drawing Test and the diagnosis of amnestic mild cognitive impairment: can more detailed scoring systems do the work?

PubMed

Rubínová, Eva; Nikolai, Tomáš; Marková, Hana; Siffelová, Kamila; Laczó, Jan; Hort, Jakub; Vyhnálek, Martin

2014-01-01

The Clock Drawing Test is a frequently used cognitive screening test with several scoring systems in elderly populations. We compare simple and complex scoring systems and evaluate the usefulness of the combination of the Clock Drawing Test with the Mini-Mental State Examination to detect patients with mild cognitive impairment. Patients with amnestic mild cognitive impairment (n = 48) and age- and education-matched controls (n = 48) underwent neuropsychological examinations, including the Clock Drawing Test and the Mini-Mental State Examination. Clock drawings were scored by three blinded raters using one simple (6-point scale) and two complex (17- and 18-point scales) systems. The sensitivity and specificity of these scoring systems used alone and in combination with the Mini-Mental State Examination were determined. Complex scoring systems, but not the simple scoring system, were significant predictors of the amnestic mild cognitive impairment diagnosis in logistic regression analysis. At equal levels of sensitivity (87.5%), the Mini-Mental State Examination showed higher specificity (31.3%, compared with 12.5% for the 17-point Clock Drawing Test scoring scale). The combination of Clock Drawing Test and Mini-Mental State Examination scores increased the area under the curve (0.72; p < .001) and increased specificity (43.8%), but did not increase sensitivity, which remained high (85.4%). A simple 6-point scoring system for the Clock Drawing Test did not differentiate between healthy elderly and patients with amnestic mild cognitive impairment in our sample. Complex scoring systems were slightly more efficient, yet still were characterized by high rates of false-positive results. We found psychometric improvement using combined scores from the Mini-Mental State Examination and the Clock Drawing Test when complex scoring systems were used. The results of this study support the benefit of using combined scores from simple methods.

1. Photographic copy of engineering drawing showing structure of Test ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

1. Photographic copy of engineering drawing showing structure of Test Stand 'B' (4215/E-16), also known as the 'Short Snorter.' California Institute of Technology, Jet Propulsion Laboratory, Plant Engineering 'Structural Addition - Bldg. E-12, Edwards Test Station,' drawing no. E12/1-1, 8 August 1957. - Jet Propulsion Laboratory Edwards Facility, Test Stand B, Edwards Air Force Base, Boron, Kern County, CA

26. "TEST STAND, STRUCTURAL, FOUNDATION PLAN." Specifications No. ENG043535572; Drawing ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

26. "TEST STAND, STRUCTURAL, FOUNDATION PLAN." Specifications No. ENG-04-353-55-72; Drawing No. 60-0912; sheet 25 of 148; file no. 1320/76. Stamped: RECORD DRAWING - AS CONSTRUCTED. Below stamp: Contract no. 4338, no change. - Edwards Air Force Base, Air Force Rocket Propulsion Laboratory, Test Stand 1-A, Test Area 1-120, north end of Jupiter Boulevard, Boron, Kern County, CA

16 CFR Figure 5 to Part 1203 - Location of Test Lines for Helmets Intended for Persons Ages 1 and Older

Code of Federal Regulations, 2014 CFR

2014-01-01

... 16 Commercial Practices 2 2014-01-01 2014-01-01 false Location of Test Lines for Helmets Intended for Persons Ages 1 and Older 5 Figure 5 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 5 Figure 5 to Part 1203—Location of Test Lines fo...

16 CFR Figure 5 to Part 1203 - Location of Test Lines for Helmets Intended for Persons Ages 1 and Older

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Location of Test Lines for Helmets Intended for Persons Ages 1 and Older 5 Figure 5 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 5 Figure 5 to Part 1203—Location of Test Lines fo...

16 CFR Figure 5 to Part 1203 - Location of Test Lines for Helmets Intended for Persons Ages 1 and Older

Code of Federal Regulations, 2013 CFR

2013-01-01

... 16 Commercial Practices 2 2013-01-01 2013-01-01 false Location of Test Lines for Helmets Intended for Persons Ages 1 and Older 5 Figure 5 to Part 1203 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS SAFETY STANDARD FOR BICYCLE HELMETS Pt. 1203, Fig. 5 Figure 5 to Part 1203—Location of Test Lines fo...

Support for a Link between the Local Processing Bias and Social Deficits in Autism: An Investigation of Embedded Figures Test Performance in Non-Clinical Individuals

ERIC Educational Resources Information Center

Russell-Smith, Suzanna N.; Maybery, Murray T.; Bayliss, Donna M.; Sng, Adelln A. H.

2012-01-01

The aim of this investigation was to explore the degree to which specific subsets of autistic-like traits relate to performance on the Embedded Figures Test (Witkin et al. in A manual for the embedded figures test. Consulting Psychologists Press, Palo Alto, CA, 1971). In the first group-based investigation with this focus, students were selected…

Statistical tests for whether a given set of independent, identically distributed draws comes from a specified probability density.

PubMed

Tygert, Mark

2010-09-21

We discuss several tests for determining whether a given set of independent and identically distributed (i.i.d.) draws does not come from a specified probability density function. The most commonly used are Kolmogorov-Smirnov tests, particularly Kuiper's variant, which focus on discrepancies between the cumulative distribution function for the specified probability density and the empirical cumulative distribution function for the given set of i.i.d. draws. Unfortunately, variations in the probability density function often get smoothed over in the cumulative distribution function, making it difficult to detect discrepancies in regions where the probability density is small in comparison with its values in surrounding regions. We discuss tests without this deficiency, complementing the classical methods. The tests of the present paper are based on the plain fact that it is unlikely to draw a random number whose probability is small, provided that the draw is taken from the same distribution used in calculating the probability (thus, if we draw a random number whose probability is small, then we can be confident that we did not draw the number from the same distribution used in calculating the probability).

Development and Testing of an Engineering Prototype for a Marine Version of the Berkeley Unexploded Ordnance Discriminator (BUD)

DTIC Science & Technology

2013-06-01

on the laminated waterproof platform as shown in Figures 29 and 30. 35 Figure 29 Figure 30 36 The receiver coils, and transmitter...mounted on a flatbed trailer, transported to the Richmond Marina, and launched from the boat launch ramp, Figure 32. 37 Figure 32 Once in

Characteristics of the tree-drawing test in chronic schizophrenia.

PubMed

Kaneda, Ayako; Yasui-Furukori, Norio; Saito, Manabu; Sugawara, Norio; Nakagami, Taku; Furukori, Hanako; Kaneko, Sunao

2010-04-01

A tree-drawing test acts as both a projective psychological examination as well as a supplementary psychodiagnostic tool. There is little information relating the characteristics of schizophrenia and the tree-drawing test. The present study compared the structural and morphological differences in the results of the tree-drawing test between schizophrenic patients and healthy individuals, as well as between schizophrenic patients who responded well to treatment and those who responded poorly. The subjects included 202 chronic schizophrenic patients and 113 healthy individuals. The schizophrenic patients were categorized as 'good responders' or 'poor responders' based on their response to medical treatments. The tree-drawing test was performed on all subjects. The tree drawn by each subject was analyzed structurally and morphologically. There were significant differences between the trunk and branches drawn by schizophrenic patients and those drawn by healthy controls. There were no significant differences between the good responders and the poor responders in any aspect of the tree drawings. Multiple regression models showed that the ratio of the tree area to the total area of the drawing paper, the width of the trunk, the trunk base opening, and the size of the branch ends were significantly associated with schizophrenia. The present study suggests that the trees drawn by schizophrenic patients are significantly different from those drawn by healthy individuals, but among schizophrenic patients, it is difficult to distinguish between good responders and poor responders using the tree-drawing test.

The significance of mouse liver tumor formation for carcinogenic risk assessment: results and conclusions from a survey of ten years of testing by the agrochemical industry.

PubMed Central

Carmichael, N G; Enzmann, H; Pate, I; Waechter, F

1997-01-01

A survey was performed on the results of 138 carcinogenicity studies conducted in various mouse strains by the agrochemical industry over the period 1983-1993. Data for liver tumor incidence, liver weight, and histopathology were collected along with data on genotoxicity. Studies were judged positive or negative for liver tumor formation on the basis of apparent dose response, malignancy, and difference from historical control values using a weight of evidence approach. Thirty-seven studies were judged to be positive for liver tumorigenicity in one or both sexes. There was no evidence showing an influence of the mouse strain and the duration of the study on the proportion of positive studies. Although 8 of the chemicals tested in the 138 studies were positive in the Ames test, only one of these was judged positive for carcinogenicity. Only 6 of the 37 positive chemicals had any other reported positive genotoxicity findings. A clear relationship between hepatomegaly at 1 year after exposure and a positive tumorigenic outcome at 18 months or 2 years after exposure was demonstrated. Whereas the average relative liver weight of top dose animals was 110% of control in negative studies, it was 150% in positive studies. Likewise, very few negative studies demonstrated significant pathological findings after 1 year, whereas the majority of positive studies had significant liver pathology. The implications of these findings for extrapolation to humans are discussed. Images p1196-a Figure 1. A Figure 1. B Figure 1. C Figure 1. D Figure 2. A Figure 2. B Figure 2. C Figure 2. D Figure 3. Figure 3. Figure 4. Figure 4. PMID:9370513

Diagnosis of the OCD Patients using Drawing Features of the Bender Gestalt Shapes

PubMed Central

Boostani, R.; Asadi, F.; Mohammadi, N.

2017-01-01

Background: Since psychological tests such as questionnaire or drawing tests are almost qualitative, their results carry a degree of uncertainty and sometimes subjectivity. The deficiency of all drawing tests is that the assessment is carried out after drawing the objects and lots of information such as pen angle, speed, curvature and pressure are missed through the test. In other words, the psychologists cannot assess their patients while running the tests. One of the famous drawing tests to measure the degree of Obsession Compulsion Disorder (OCD) is the Bender Gestalt, though its reliability is not promising. Objective: The main objective of this study is to make the Bender Gestalt test quantitative; therefore, an optical pen along with a digital tablet is utilized to preserve the key drawing features of OCD patients during the test. Materials and Methods: Among a large population of patients who referred to a special clinic of OCD, 50 under therapy subjects voluntarily took part in this study. In contrast, 50 subjects with no sign of OCD performed the test as a control group. This test contains 9 shapes and the participants were not constraint to draw the shapes in a certain interval of time; consequently, to classify the stream of feature vectors (samples through drawing) Hidden Markov Model (HMM) is employed and its flexibility increased by incorporating the fuzzy technique into its learning scheme. Results: Applying fuzzy HMM classifier to the data stream of subjects could classify two groups up to 95.2% accuracy, whereas the results by applying the standard HMM resulted in 94.5%. In addition, multi-layer perceptron (MLP), as a strong static classifier, is applied to the features and resulted in 86.6% accuracy. Conclusion: Applying the pair of T-test to the results implies a significant supremacy of the fuzzy HMM to the standard HMM and MLP classifiers. PMID:28462208

Diagnosis of the OCD Patients using Drawing Features of the Bender Gestalt Shapes.

PubMed

Boostani, R; Asadi, F; Mohammadi, N

2017-03-01

Since psychological tests such as questionnaire or drawing tests are almost qualitative, their results carry a degree of uncertainty and sometimes subjectivity. The deficiency of all drawing tests is that the assessment is carried out after drawing the objects and lots of information such as pen angle, speed, curvature and pressure are missed through the test. In other words, the psychologists cannot assess their patients while running the tests. One of the famous drawing tests to measure the degree of Obsession Compulsion Disorder (OCD) is the Bender Gestalt, though its reliability is not promising. The main objective of this study is to make the Bender Gestalt test quantitative; therefore, an optical pen along with a digital tablet is utilized to preserve the key drawing features of OCD patients during the test. Among a large population of patients who referred to a special clinic of OCD, 50 under therapy subjects voluntarily took part in this study. In contrast, 50 subjects with no sign of OCD performed the test as a control group. This test contains 9 shapes and the participants were not constraint to draw the shapes in a certain interval of time; consequently, to classify the stream of feature vectors (samples through drawing) Hidden Markov Model (HMM) is employed and its flexibility increased by incorporating the fuzzy technique into its learning scheme. Applying fuzzy HMM classifier to the data stream of subjects could classify two groups up to 95.2% accuracy, whereas the results by applying the standard HMM resulted in 94.5%. In addition, multi-layer perceptron (MLP), as a strong static classifier, is applied to the features and resulted in 86.6% accuracy. Applying the pair of T-test to the results implies a significant supremacy of the fuzzy HMM to the standard HMM and MLP classifiers.

The reliability and clinical correlates of figure-ground perception in schizophrenia.

PubMed

Malaspina, Dolores; Simon, Naomi; Goetz, Raymond R; Corcoran, Cheryl; Coleman, Eliza; Printz, David; Mujica-Parodi, Lilianne; Wolitzky, Rachel

2004-01-01

Schizophrenia subjects are impaired in a number of visual attention paradigms. However, their performance on tests of figure-ground visual perception (FGP), which requires subjects to visually discriminate figures embedded in a rival background, is relatively unstudied. We examined FGP in 63 schizophrenia patients and 27 control subjects and found that the patients performed the FGP test reliably and had significantly lower FGP scores than the control subjects. Figure-ground visual perception was significantly correlated with other neuropsychological test scores and was inversely related to negative symptoms. It was unrelated to antipsychotic medication treatment. Figure-ground visual perception depends on "top down" processing of visual stimuli, and thus this data suggests that dysfunction in the higher-level pathways that modulate visual perceptual processes may also be related to a core defect in schizophrenia.

Evaluation of Minimum Asphalt Concrete Thickness Criteria

DTIC Science & Technology

2008-10-01

9 Figure 6. Dry density versus moisture content for CH material... density measurements. ............................ 24 Figure 18. EPC installation in a crushed gravel base course layer...Construction Materials Materials Characterization Laboratory Testing Field Testing Test Section Construction Hydrometer, Modified Proctor , Specific

Predicting Software Assurance Using Quality and Reliability Measures

DTIC Science & Technology

2014-12-01

errors are not found in unit testing . The rework effort to correct requirement and design problems in later phases can be as high as 300 to 1,000...Literature 31 Appendix B: Quality Cannot Be Tested In 35 Bibliography 38 CMU/SEI-2014-TN-026 | ii CMU/SEI-2014-TN-026 | iii List of Figures...Removal Densities During Development 10 Figure 8: Quality and Security-Focused Workflow 14 Figure 9: Testing Reliability Results for the Largest Project

16 CFR Figure 3 to Part 1513 - Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of “A” Section of Probe and...

Code of Federal Regulations, 2013 CFR

2013-01-01

... 16 Commercial Practices 2 2013-01-01 2013-01-01 false Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of âAâ Section of Probe and Boundaries of Opening 3 Figure 3 to Part 1513... REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 3 Figure 3 to Part 1513—Motion of Test Probe Arrested by Simultaneous...

16 CFR Figure 3 to Part 1513 - Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of “A” Section of Probe and...

Code of Federal Regulations, 2014 CFR

2014-01-01

... 16 Commercial Practices 2 2014-01-01 2014-01-01 false Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of âAâ Section of Probe and Boundaries of Opening 3 Figure 3 to Part 1513... REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 3 Figure 3 to Part 1513—Motion of Test Probe Arrested by Simultaneous...

16 CFR Figure 3 to Part 1513 - Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of “A” Section of Probe and...

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of âAâ Section of Probe and Boundaries of Opening 3 Figure 3 to Part 1513... REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 3 Figure 3 to Part 1513—Motion of Test Probe Arrested by Simultaneous...

16 CFR Figure 3 to Part 1513 - Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of “A” Section of Probe and...

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of âAâ Section of Probe and Boundaries of Opening 3 Figure 3 to Part 1513... REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 3 Figure 3 to Part 1513—Motion of Test Probe Arrested by Simultaneous...

16 CFR Figure 3 to Part 1513 - Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of “A” Section of Probe and...

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Motion of Test Probe Arrested by Simultaneous Contact With Both Sides of âAâ Section of Probe and Boundaries of Opening 3 Figure 3 to Part 1513... REQUIREMENTS FOR BUNK BEDS Pt. 1513, Fig. 3 Figure 3 to Part 1513—Motion of Test Probe Arrested by Simultaneous...

12. Historic plot plan and drawings index for rocket engine ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

12. Historic plot plan and drawings index for rocket engine test facility, June 28, 1956. NASA GRC drawing number CE-101810. On file at NASA Glenn Research Center. - Rocket Engine Testing Facility, NASA Glenn Research Center, Cleveland, Cuyahoga County, OH

Grounding the figure.

PubMed

Calis, G; Leeuwenberg, E

1981-12-01

Coding rules can be formulated in which the shortest description of a figure-ground pattern exhibits a hierarchical structure, with the ground playing a primary and the figure a secondary role. We hypothesized that the process of perception involves and assimilation phase followed by a test phase in which the ground is tested before the figure. Experiments are described in which pairs of consecutive, superimposed patterns are presented in rapid succession, resulting in a subjective impression of seeing one pattern only. In these presentations, the second pattern introduces some deliberate distortion of the figure or ground displayed in the first pattern. Maximal distortions of the ground occur at shorter stimulus onset asynchronies than maximal distortions of the figure, suggesting that the ground codes are processed before figure codes. Moreover, patterns presenting the ground first are more likely to be perceived as ground, regardless of the distortions, than patterns presenting the figure first. This quasi masking or microgenetic approach might be relevant to theories on :mediations of immediate, or direct" perception.

Evaluation of a six-DOF electrodynamic shaker system.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gregory, Danny Lynn; Smallwood, David Ora

2009-03-01

The paper describes the preliminary evaluation of a 6 degree of freedom electrodynamic shaker system. The 8 by 8 inch (20.3 cm) table is driven by 12 electrodynamic shakers producing motion in all 6 rigid body modes. A small electrodynamic shaker system suitable for small component testing is described. The principal purpose of the system is to demonstrate the technology. The shaker is driven by 12 electrodynamic shakers each with a force capability of about 50 lbs (220 N). The system was developed through an informal cooperative agreement between Sandia National Laboratories, Team Corp. and Spectral Dynamics Corporation. Sandia providedmore » the laboratory space and some development funds. Team provided the mechanical system, and Spectral Dynamics provided the control system. Spectral Dynamics was chosen to provide the control system partly because of their experience in MIMO control and partly because Sandia already had part of the system in house. The shaker system was conceived and manufactured by TEAM Corp. Figure 1 shows the overall system. The vibration table, electrodynamic shakers, hydraulic pumps, and amplifiers are all housed in a single cabinet. Figure 2 is a drawing showing how the electrodynamic shakers are coupled to the table. The shakers are coupled to the table through a hydraulic spherical pad bearing providing 5 degrees of freedom and one stiff degree of freedom. The pad bearing must be preloaded with a static force as they are unable to provide any tension forces. The horizontal bearings are preloaded with steel springs. The drawing shows a spring providing the vertical preload. This was changed in the final design. The vertical preload is provided by multiple strands of an O-ring material as shown in Figure 4. Four shakers provide excitation in each of the three orthogonal axes. The specifications of the shaker are outlined in Table 1. Four shakers provide inputs in each of the three orthogonal directions. By choosing the phase relationships between the shakers all six rigid body modes (three translation, and three rotations) can be excited. The system is over determined. There are more shakers than degrees of freedom. This provided an interesting control problem. The problem was approached using the input-output transformation matrices provided in the Spectral control system. Twelve accelerometers were selected for the control accelerometers (a tri-axial accelerometer at each corner of the table (see Figure 5). Figure 6 shows the nomenclature used to identify the shakers and control accelerometers. A fifth tri-axial accelerometer was placed at the center of the table, but it was not used for control. Thus we had 12 control accelerometers and 12 shakers to control a 6-dof shaker. The 12 control channels were reduced to a 6-dof control using a simple input transformation matrix. The control was defined by a 6x6 spectral density matrix. The six outputs in the control variable coordinates were transformed to twelve physical drive signals using another simple output transformation matrix. It was assumed that the accelerometers and shakers were well matched such that the transformation matrices were independent of frequency and could be deduced from rigid body considerations. The input/output transformations are shown in Equations 1 and 2.« less

Baseline Assessment of TREAT for Modeling and Analysis Needs

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bess, John Darrell; DeHart, Mark David

2015-10-01

TREAT is an air-cooled, graphite moderated, thermal, heterogeneous test facility designed to evaluate reactor fuels and structural materials under conditions simulating various types of nuclear excursions and transient undercooling situations that could occur in a nuclear reactor. After 21 years in a standby mode, TREAT is being re-activated to revive transient testing capabilities. Given the time elapsed and the concurrent loss of operating experience, current generation and advanced computational methods are being applied to begin TREAT modeling and simulation prior to renewed at-power operations. Such methods have limited value in predicting the behavior of TREAT without proper validation. Hence, themore » U.S. DOE has developed a number of programs to support development of benchmarks for both critical and transient operations. Extensive effort has been expended at INL to collect detailed descriptions, drawings and specifications for all aspects of TREAT, and to resolve conflicting data found through this process. This report provides a collection of these data, with updated figures that are significantly more readable than historic drawings and illustrations, compositions, and dimensions based on the best available sources. This document is not nor should it be considered to be a benchmark report. Rather, it is intended to provide one-stop shopping, to the extent possible, for other work that seeks to prepare detailed, accurate models of the core and its components. Given the nature of the variety of historic documents available and the loss of institutional memory, the only completely accurate database of TREAT data is TREAT itself. Unfortunately, disassembly of TREAT for inspection, assay, and measurement is highly unlikely. Hence the data provided herein is intended serve as a best-estimate substitute.« less

Transfer of Movement Control in Motor Skill Learning

DTIC Science & Technology

1986-04-01

e.g., fatigue, druas, " moods ," and so on), the effects disaDpearinq as soon as the variable is removed, these influences should probably not be...common example is the parameter of movement size’ revealed particularly well in handwriting . Consider one’s signature, written on a check versus on a...extensively early n this ntury using tasKs liKe handwriting , drawing and figure production, maze 1 earning, and the like (Cook, 193-4; Weig, 1932; see

Impact of the threat of war on children in military families.

PubMed

Ryan-Wenger, N A

2001-04-01

The potential for war is a pervasive threat to the security and family structure of children in military families. This study compared children of active-duty, reserve, and civilian families with respect to their perceptions of war, origin of fears related to war, levels of manifest anxiety, coping strategies, and projection of emotional problems in human figure drawings. Findings regarding the adaptation of children in military families are discussed, and the need for further research from children's perspectives is highlighted.

Riparian Buffers for Runoff Control and Sensitive Species Habitat on U.S. Army Corps of Engineers Lake and Reservoir Projects

DTIC Science & Technology

2016-10-01

Fischer 2004). The use of soil amendments and/or irrigation may be necessary to establish plants . Commercial fertilizers can often help with...closer to shore Aquatic plants Aquatic zone Figure 1. Conceptual Drawing of Riparian Zone. ERDC WQTN-16-1 October 2016 2 Benefits of Riparian...Bell’s Vireo is a small, migratory, insectivorous bird (Brown 2010) that breeds in the central and southwestern U.S. and winters in southern Mexico and

Human Factors Guidelines for Command and Control Systems: Battlefield and Decision Graphics Guidelines

DTIC Science & Technology

1989-03-01

detail in a small area, use achromatic colors ( black , white, and grey) and use chromatic colors for larger panels or for attracting attention. b. Blues...purposes (e.g., to draw the users attention to a total, a broken bar or other important data element). b. Black and white should be used with caution. They...enough to set the bars or columns off from the background and define figure and ground relationships. (2) Use black in small areas and for certain

Japan Report, Science and Technology.

DTIC Science & Technology

1987-04-17

suspended cells by using the microinjection method. Figure 2. Typical Drawing of Inject Scope _ # [Extracted from M . Furusawa , et. al.: "Erythropoiesis...yf-’n-uyx 7. •> t - \\y 8. fctftll’VX 1212 Injectoscope^iCE! M . Furusawa , et- ai ’. " Erythropoiesis and differentiation in Friend...34 o °f p -*K2) / DNA»* (1) V i = ^P’f vyi^i/3 > m ®f7v •y*’sym®<Di&&. m Key: 1. DNA molecule 2. Injector needle As previously mentioned, this

Mrg: A Magnitude Scale for 1 s Rayleigh Waves at Local Distances with Focus on Yield Estimation

DTIC Science & Technology

2016-08-23

typical of “hard” rock emplacement media. The MRg estimates using Eq. 5 are shown in Figure 3c. The network average MRg, which is estimated after...MATERIEL COMMAND KIRTLAND AIR FORCE BASE, NM 87117-5776 DTIC COPY NOTICE AND SIGNATURE PAGE Using Government drawings, specifications, or other...convey any rights or permission to manufacture, use , or sell any patented invention that may relate to them. This report was cleared for public

The Predictive Validity of the Torrance Figural Test (Form B) of Creative Thinking in the College of Fine and Applied Arts.

ERIC Educational Resources Information Center

Stallings, William M.

In an effort to improve the predictability of course grades in the College of Fine and Applied Arts the Torrance Figural Test (Form B) of Creative Thinking was administered to entering 1968 freshmen. Four figural creativity variables (Fluency, Flexibility, Originality, and Elaboration) were correlated with course grades, American College Testing…

Erratum: Simple Seismic Tests of the Solar Core

NASA Astrophysics Data System (ADS)

Kennedy, Dallas C.

2000-12-01

In the article ``Simple Seismic Tests of the Solar Core'' by Dallas C. Kennedy (ApJ, 540, 1109 [2000]), Figures 1, 2, and 3 in the print edition of the Journal were unreadable because of problems with the electronic file format. The figures in the electronic edition were unaffected. The figures should have appeared as below. The Press sincerely regrets this error.

Pseudo-Duane's retraction syndrome.

PubMed Central

Duane, T D; Schatz, N J; Caputo, A R

1976-01-01

Five patients presented with signs that were similar to but opposite from Duane's retraction syndrome. Most had a history of orbital trauma. On attempted abduction a narrowing of the palpebral fissure and retraction of the globe was observed. Diplopia with lateral gaze was present. Roentgenograms (polytomograms) showed involvement of the medial orbital wall. Forced ductuin tests were positive. Surgical repair of the fracture and release of the entrapped muscle as determined by forced duction tests and by postoperative motility led to successful results. Images FIGURE 1 A FIGURE 1 B FIGURE 2 FIGURE 3 PMID:867622

AGARD Flight Test Series. Volume 10. Weapon Delivery Analysis and Ballistic Flight Testing (L’Analyse du Largage d’Armes et les en Vol Balistique).

DTIC Science & Technology

1992-07-01

Figure 24 Type 29 Telereader System 38 Figure 25 Contraves Semi-Automatic Film Reader 38 Figure 26 Typical Impact Plot 41 Figure 27 Delta Range...But they were at a loss as to how to account for the very observable and unpre- dictable pitching and yawing motions of bombs as they separated...nique. Just as had occurred during World War I, aircrews were forced to high altitudes to minimize aircraft losses from enemy defensive fire. And

Dynamic Camouflage in Benthic and Pelagic Cephalopods: An Interdisciplinary Approach to Crypsis Based on Color, Reflection, and Bioluminescence

DTIC Science & Technology

2011-09-30

the holodeck to test predation responses (left) and the optomotor response (right) We also studied the basic principles octopuses use to camouflage...the specific background the animal was on (Figure 6). Figure 4: An octopus settled in the test arena. Figure 5: Left) test arena; center) result of...separate photonic structures in nine evolutionarily diverse species of open-ocean squid and an octopus . RESULTS Objective 1, Light measurements: The most

Final Report of the Rifling Profile Push Test

DTIC Science & Technology

2007-06-01

barrel lands through the copper alloy jacket, as shown in figure 6. As a result, compression of the jacket material above the steel core will occur...resistance pressure of the M855 projectile in an M16A2 barrel section. The M855 test projectiles were tested in a 2 × 2 matrix, two different M16A2 barrel ...1 Figure 2. M16A2 barrel machined section. The units of measure are in cm.................................2 Figure 3

Evaluation of Precast Portland Cement Concrete Panels for Airfield Pavement Repairs

DTIC Science & Technology

2015-05-01

3 1.3 Research approach ...Figure 1.1. Research approach schematic. ................................................................................................ 4 Figure 2.1...220 Figure D.10. Locations of HWD tests pre-repair and posttest

R2R--software to speed the depiction of aesthetic consensus RNA secondary structures.

PubMed

Weinberg, Zasha; Breaker, Ronald R

2011-01-04

With continuing identification of novel structured noncoding RNAs, there is an increasing need to create schematic diagrams showing the consensus features of these molecules. RNA structural diagrams are typically made either with general-purpose drawing programs like Adobe Illustrator, or with automated or interactive programs specific to RNA. Unfortunately, the use of applications like Illustrator is extremely time consuming, while existing RNA-specific programs produce figures that are useful, but usually not of the same aesthetic quality as those produced at great cost in Illustrator. Additionally, most existing RNA-specific applications are designed for drawing single RNA molecules, not consensus diagrams. We created R2R, a computer program that facilitates the generation of aesthetic and readable drawings of RNA consensus diagrams in a fraction of the time required with general-purpose drawing programs. Since the inference of a consensus RNA structure typically requires a multiple-sequence alignment, the R2R user annotates the alignment with commands directing the layout and annotation of the RNA. R2R creates SVG or PDF output that can be imported into Adobe Illustrator, Inkscape or CorelDRAW. R2R can be used to create consensus sequence and secondary structure models for novel RNA structures or to revise models when new representatives for known RNA classes become available. Although R2R does not currently have a graphical user interface, it has proven useful in our efforts to create 100 schematic models of distinct noncoding RNA classes. R2R makes it possible to obtain high-quality drawings of the consensus sequence and structural models of many diverse RNA structures with a more practical amount of effort. R2R software is available at http://breaker.research.yale.edu/R2R and as an Additional file.

40 CFR 89.509 - Calculation and reporting of test results.

Code of Federal Regulations, 2014 CFR

2014-07-01

... applicable emission standard expressed to one additional significant figure. This procedure has been... additional significant figure. (c) Within five working days after completion of testing of all engines...

58. Historic plan, section, and detail drawing of Building 202 ...

Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

58. Historic plan, section, and detail drawing of Building 202 test cell, June 29, 1955. NASA GRC drawing no. CE-101340 (On file at NASA Glenn Research Center). - Rocket Engine Testing Facility, GRC Building No. 202, NASA Glenn Research Center, Cleveland, Cuyahoga County, OH

HIFiRE-1 and HIFiRE-5 Test Results

DTIC Science & Technology

2014-02-01

From AFRL and NASA BETs ....................................................................................................... 12 Figure 10 Roll ...34 Figure 31 Roll Angle and PLBW3 Pressure Trace Versus Flight Time During Reentry ........................... 34 Figure...vehicle orientation in flight is described by the velocity-referenced coordinate system shown in Figure 10. Roll angle, Φ, is defined as the angle

Online handwritten mathematical expression recognition

NASA Astrophysics Data System (ADS)

Büyükbayrak, Hakan; Yanikoglu, Berrin; Erçil, Aytül

2007-01-01

We describe a system for recognizing online, handwritten mathematical expressions. The system is designed with a user-interface for writing scientific articles, supporting the recognition of basic mathematical expressions as well as integrals, summations, matrices etc. A feed-forward neural network recognizes symbols which are assumed to be single-stroke and a recursive algorithm parses the expression by combining neural network output and the structure of the expression. Preliminary results show that writer-dependent recognition rates are very high (99.8%) while writer-independent symbol recognition rates are lower (75%). The interface associated with the proposed system integrates the built-in recognition capabilities of the Microsoft's Tablet PC API for recognizing textual input and supports conversion of hand-drawn figures into PNG format. This enables the user to enter text, mathematics and draw figures in a single interface. After recognition, all output is combined into one LATEX code and compiled into a PDF file.

[Healthy Life Years: a very promising indicator to be handled with caution].

PubMed

Zauli Sajani, Stefano; Battista, Alessandra; Frova, Luisa; Lauriola, Paolo

2014-01-01

In several public debates, scientific conferences and, recently, also in the scientific literature, some figures from EUROSTAT have been presented; they show a relevant decrease in the healthy life expectancy in Italy. This idea is based on the analysis of the trend of Healthy Life Years (HLY), an indicator synthesizing the grade of functional limitation of individuals based on the answers to a self-completed questionnaire. In particular, the dramatic decrease of HLY in Italy from 2005 to 2007 raised concerns. This paper analyses the reasons suggesting caution in interpreting these data considering first and foremost the changes across years in the formulation of questions and answers. Even though HLY and the other indicators selected by the European Union have a great potential in terms of communication and synthetic view, caution is needed in using these data and in drawing conclusions from figures and instruments of recent application that are still evolving.

Clock Drawing as a Screen for Impaired Driving in Aging and Dementia: Is It Worth the Time?

PubMed Central

Manning, Kevin J.; Davis, Jennifer D.; Papandonatos, George D.; Ott, Brian R.

2014-01-01

Clock drawing is recommended by medical and transportation authorities as a screening test for unsafe drivers. The objective of the present study was to assess the usefulness of different clock drawing systems as screening measures of driving performance in 122 healthy and cognitively impaired older drivers. Clock drawing was measured using four different scoring systems. Driving outcomes included global ratings of safety and the error rate on a standardized on-road test. Findings revealed that clock drawing was significantly correlated with the driving score on the road test for each of the scoring systems. However, receiver operator curve analyses showed limited clinical utility for clock drawing as a screening instrument for impaired on-road driving performance with the area under the curve ranging from 0.53 to 0.61. Results from this study indicate that clock drawing has limited utility as a solitary screening measure of on-road driving, even when considering a variety of scoring approaches. PMID:24296110

Clock drawing as a screen for impaired driving in aging and dementia: is it worth the time?

PubMed

Manning, Kevin J; Davis, Jennifer D; Papandonatos, George D; Ott, Brian R

2014-02-01

Clock drawing is recommended by medical and transportation authorities as a screening test for unsafe drivers. The objective of the present study was to assess the usefulness of different clock drawing systems as screening measures of driving performance in 122 healthy and cognitively impaired older drivers. Clock drawing was measured using four different scoring systems. Driving outcomes included global ratings of safety and the error rate on a standardized on-road test. Findings revealed that clock drawing was significantly correlated with the driving score on the road test for each of the scoring systems. However, receiver operator curve analyses showed limited clinical utility for clock drawing as a screening instrument for impaired on-road driving performance with the area under the curve ranging from 0.53 to 0.61. Results from this study indicate that clock drawing has limited utility as a solitary screening measure of on-road driving, even when considering a variety of scoring approaches.

10kW TWT Transition to GaN IRE

DTIC Science & Technology

2015-03-31

tubes in high power radar and Electronic Warfare (EW) applications. GaN transistors, using evaluation boards, were tested and analyzed, supplementing...29 Appendix B. High Power Amplifier Testing Data...19 Figure 11. High Power RF Amplifier Test Set ............................................................................. 22 Figure 12

Experimental Evaluations of Selected Immersion Hypothermia Protection Equipment.

DTIC Science & Technology

1979-10-12

Temperature Response ............... 30 Figure 1-3 Estimated Survival Times for Average Men ..... 49 Figure 1-4 Metabolic Rate Response :Subject BS...51 Figure 1-5 Metabolic Rate Response : Subject GE ............... 52 Figure 1-6 Selected Elementary Movements ............... 58 Figure 1-7 Fatigue... responses to cold-Immersion, while wearing the test articles, could be observed or-vs over a narrow range of body core temperatures Involving the mildest

16 CFR Figure 10 to Subpart A of... - Insulation Radiant Panel Test Data Log Format

Code of Federal Regulations, 2014 CFR

2014-01-01

... 16 Commercial Practices 2 2014-01-01 2014-01-01 false Insulation Radiant Panel Test Data Log Format 10 Figure 10 to Subpart A of Part 1209 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INTERIM SAFETY STANDARD FOR CELLULOSE INSULATION The Standard Pt. 1209, Subpt. A, Fig. 10 Figure 10 to Subpart A...

16 CFR Figure 10 to Subpart A of... - Insulation Radiant Panel Test Data Log Format

Code of Federal Regulations, 2013 CFR

2013-01-01

... 16 Commercial Practices 2 2013-01-01 2013-01-01 false Insulation Radiant Panel Test Data Log Format 10 Figure 10 to Subpart A of Part 1209 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INTERIM SAFETY STANDARD FOR CELLULOSE INSULATION The Standard Pt. 1209, Subpt. A, Fig. 10 Figure 10 to Subpart A...

16 CFR Figure 10 to Subpart A of... - Insulation Radiant Panel Test Data Log Format

Code of Federal Regulations, 2010 CFR

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Insulation Radiant Panel Test Data Log Format 10 Figure 10 to Subpart A of Part 1209 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INTERIM SAFETY STANDARD FOR CELLULOSE INSULATION The Standard Pt. 1209, Subpt. A, Fig. 10 Figure 10 to Subpart A...

16 CFR Figure 10 to Subpart A of... - Insulation Radiant Panel Test Data Log Format

Code of Federal Regulations, 2011 CFR

2011-01-01

... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Insulation Radiant Panel Test Data Log Format 10 Figure 10 to Subpart A of Part 1209 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INTERIM SAFETY STANDARD FOR CELLULOSE INSULATION The Standard Pt. 1209, Subpt. A, Fig. 10 Figure 10 to Subpart A...

16 CFR Figure 10 to Subpart A of... - Insulation Radiant Panel Test Data Log Format

Code of Federal Regulations, 2012 CFR

2012-01-01

... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Insulation Radiant Panel Test Data Log Format 10 Figure 10 to Subpart A of Part 1209 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INTERIM SAFETY STANDARD FOR CELLULOSE INSULATION The Standard Pt. 1209, Subpt. A, Fig. 10 Figure 10 to Subpart A...

Test Bias in the Intermediate Mental Alertness, Mechanical Comprehension, Blox and High Level Figure Classification Tests. An NTB/HSRC Report.

ERIC Educational Resources Information Center

Holburn, P. T.

Research is reported on four tests commonly used in South Africa to select apprentices, the Intermediate Mental Alertness Test, the High Level Figure Classification Test, the Blox Test, and the Mechanical Comprehension Test. Samples were as follows: (1) 206 Asian, 208 Black, 102 Coloured, and 99 White mostly male applicants for sugar industry…

The Draw-an-Archaeologist Test

ERIC Educational Resources Information Center

Renoe, Susan

2003-01-01

The Draw-an-Archaeologist Test (DART) is an easy way to elicit students' conceptions about archaeology and can be adapted to other subject matter. When implemented as the first activity of an archaeology unit, it provides a starting point for introducing archaeology and addressing students' misconceptions about it. In this drawing activity,…

The micropolitics of responsibility vis-à-vis autonomy: parental accounts of childhood genetic testing and (non)disclosure.

PubMed

Arribas-Ayllon, Michael; Sarangi, Srikant; Clarke, Angus

2008-03-01

Genetic testing and (non)disclosure of genetic information present ethical and moral dilemmas for the management of parental responsibility vis-à-vis the child's autonomy. Ethical guidelines aimed at professionals currently seek to defer childhood testing where there is no clear medical or psychosocial benefit. This version of autonomy is derived from a bioethical paradigm which brackets the individual rights and capacities of the child. In this paper we focus on situated parental accounts of responsibility/autonomy to understand the complex forms of relational work -i.e. the micropolitics of balancing rights and responsibilities - involving a range of inherited genetic disorders. Interviews (n= 20) were conducted with parents whose genetic condition may have had consequences for their children. Using rhetorical discourse analysis, we show how parents draw upon a number of rhetorical/discoursal devices to produce accounts where genetic responsibility is actually or potentially transmitted to the child. We identify three kinds of accounting practice: (1) aligned responsibility; (2) deferred responsibility; and (3) misaligned responsibility. Each of these practices demonstrates how parents position themselves responsibly by foregrounding figures and events onto which the child's autonomy is selectively mapped. Rather than simple representations, we regard these accounts as complex moral performances that seek alignment with broader bioethical discourses.

Children's Drawings.

ERIC Educational Resources Information Center

Burgess, Ann W.; Hartman, Carol R.

1993-01-01

This paper reviews the literature on projective drawing tests and child sexual abuse, focusing on children's drawings as an associative tool for memory. The use of the event drawing series, which is a series of seven drawings by a child that graphically present the child's thinking about a specific event, is discussed. (JDD)

A new principle of figure-ground segregation: The accentuation.

PubMed

Pinna, Baingio; Reeves, Adam; Koenderink, Jan; van Doorn, Andrea; Deiana, Katia

2018-02-01

The problem of perceptual organization was studied by Gestalt psychologists in terms of figure-ground segregation. In this paper we explore a new principle of figure-ground segregation: accentuation. We demonstrate the effectiveness of accentuation relative to other Gestalt principles, and also consider it autonomous as it can agree with or oppose them. We consider three dynamic aspects of the principle, namely: attraction, accentuation and assignment. Each creature needs to attract, fascinate, seduce, draw attention (e.g., a mate or a prey animal) or distract, refuse, dissuade, discourage, repulse (e.g., a predator). Similarly, each organism needs to accentuate, highlight, stress, underline, emphasize or distract from another. Thus, accentuation assigns meaning to a visual pattern such as a coat, a plumage or a flower. False eyes (ocelli) and dots (diematic patterns) demonstrate "deceiving camouflage by accentuation" that confuses predators/preys and hides or highlights vital body parts (butterflies/flowers). They also display the deceiving appearance and exhibition of biological fitness. The same accents may serve different or even opposite goals. We conclude that accentuation improves the adaptive fitness of organisms in multifarious ways. Copyright © 2017 Elsevier Ltd. All rights reserved.

Child-feeding practices and child overweight perceptions of family day care providers caring for preschool-aged children.

PubMed

Brann, Lynn S

2010-01-01

The purpose of this study was to evaluate the attitudes, feeding practices, and child overweight perceptions of family day-care providers caring for preschool-aged children and to examine whether child feeding practices differ based on child weight perceptions. One hundred twenty-three family day-care providers participated in this cross-sectional exploratory study and completed a self-administered survey measuring feeding attitudes and practices from the Child Feeding Questionnaire, demographic information, and self-reported height and weight. Participants selected a cut point to identify childhood overweight using male and female child figure drawings. Participants reported a high level of responsibility in feeding and monitoring of children's food intake. Differences were found in child feeding practices between family day-care providers based on their child weight perceptions for girls. Providers who selected the smaller girl figures as the cut point for overweight were more concerned about the children becoming overweight and used more restriction in child feeding compared with the providers who selected the larger girl figures. Health professionals should continue working with this population to promote positive feeding environments. Copyright 2010 National Association of Pediatric Nurse Practitioners. Published by Mosby, Inc. All rights reserved.

Adaptive psychological structure in childhood hearing impairment: audiological correlations.

PubMed

Serra, A; Spinato, G; Cocuzza, S; Licciardello, L; Pavone, P; Maiolino, L

2017-06-01

The present research deals with the clinical and social problems present during linguistic and cognitive development of deaf children. Currently, the development of Theory of Mind represents an important research field in deafness studies. These international studies highlighted a significant alteration in the development of Theory of Mind in deaf children compared to normal hearing children, especially in cases of congenital or preverbal hearing loss. In particular, the research focuses on the skills of deaf children in recognising emotions and desires, through both perceptive and cognitive methods, by evaluation of psycho-cognitive skills of children with severe hearing loss using a set of questions to be administered to hearing loss patients. The experiment was performed on a group composed of 10 children (5 males and 5 females) aged 4 to 9 years and 54 to 108 months, affected by bilateral congenital hearing loss (severe to total), or hearing loss that developed in preverbal children the year before entering elementary school, or during the fourth year of elementary school. The selection criteria were based on: audiologic evaluation, neuro-psychological tests administered to assess general, cognitive as well as praxis and perceptive abilities, and clinical observations performed to assess psychopathology using tests that assess development of both visual perceptive (Coloured Progressive Matrices) and graphic representational abilities (Test of Human Figure Drawings and the Family Drawing Test). The instrument "cognitive" was the "Deaf Children Series", arranged by us, that consists of a mental status examination (MSE) that evaluates: level of cognitive (knowledge-related) ability, emotional mood, and speech and thought patterns at the time of evaluation. Deaf children show a reduced responsiveness to the expressions of sadness on the perceptive side. Through the test, we observed a psychodynamic defense mechanism considering perceptive understanding performance. On the contrary, in normal hearing children, the emotion 'fear' is the most difficult to identify. Deaf children seem to be more susceptible to recognition of visual emotions. Furthermore, deaf children present significant problem-solving skills and emotional recognition skills, possibly as a result of their hearing impairment. © Copyright by Società Italiana di Otorinolaringologia e Chirurgia Cervico-Facciale, Rome, Italy.

The collaboration of grouping laws in vision.

PubMed

Grompone von Gioi, Rafael; Delon, Julie; Morel, Jean-Michel

2012-01-01

Gestalt theory gives a list of geometric grouping laws that could in principle give a complete account of human image perception. Based on an extensive thesaurus of clever graphical images, this theory discusses how grouping laws collaborate, and conflict toward a global image understanding. Unfortunately, as shown in the bibliographical analysis herewith, the attempts to formalize the grouping laws in computer vision and psychophysics have at best succeeded to compute individual partial structures (or partial gestalts), such as alignments or symmetries. Nevertheless, we show here that a never formalized clever Gestalt experimental procedure, the Nachzeichnung suggests a numerical set up to implement and test the collaboration of partial gestalts. The new computational procedure proposed here analyzes a digital image, and performs a numerical simulation that we call Nachtanz or Gestaltic dance. In this dance, the analyzed digital image is gradually deformed in a random way, but maintaining the detected partial gestalts. The resulting dancing images should be perceptually indistinguishable if and only if the grouping process was complete. Like the Nachzeichnung, the Nachtanz permits a visual exploration of the degrees of freedom still available to a figure after all partial groups (or gestalts) have been detected. In the new proposed procedure, instead of drawing themselves, subjects will be shown samples of the automatic Gestalt dances and required to evaluate if the figures are similar. Several numerical preliminary results with this new Gestaltic experimental setup are thoroughly discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.

A multi-factor Rasch scale for artistic judgment.

PubMed

Bezruczko, Nikolaus

2002-01-01

Measurement properties are reported for a combined scale of abstract and figurative artistic judgment aptitude items. Abstract items are synthetic, rule-based images from Visual Designs Test which implements a statistical algorithm to control design complexity and redundancy, and figurative items are canvas paintings in five styles, Fauvism, Post-Impressionism, Surrealism, Renaissance, and Baroque especially created for this research. The paintings integrate syntactic structure from VDT Abstract designs with thematic content for each style at four levels of complexity while controlling redundancy. Trained test administrators collected preference for synthetic abstract designs and authentic figurative art from 462 examinees in Johnson O'Connor Research Foundation testing offices in Boston, New York, Chicago, and Dallas. The Rasch model replicated measurement properties for VDT Abstract items and identified an item hierarchy that was statistically invariant between genders and generally stable across age for new, authentic figurative items. Further examination of the figurative item hierarchy revealed that complexity interacts with style and meaning. Sound measurement properties for a combined VDT Abstract and Figurative scale shows promise for a comprehensive artistic judgment construct.

The artist emerges: visual art learning alters neural structure and function.

PubMed

Schlegel, Alexander; Alexander, Prescott; Fogelson, Sergey V; Li, Xueting; Lu, Zhengang; Kohler, Peter J; Riley, Enrico; Tse, Peter U; Meng, Ming

2015-01-15

How does the brain mediate visual artistic creativity? Here we studied behavioral and neural changes in drawing and painting students compared to students who did not study art. We investigated three aspects of cognition vital to many visual artists: creative cognition, perception, and perception-to-action. We found that the art students became more creative via the reorganization of prefrontal white matter but did not find any significant changes in perceptual ability or related neural activity in the art students relative to the control group. Moreover, the art students improved in their ability to sketch human figures from observation, and multivariate patterns of cortical and cerebellar activity evoked by this drawing task became increasingly separable between art and non-art students. Our findings suggest that the emergence of visual artistic skills is supported by plasticity in neural pathways that enable creative cognition and mediate perceptuomotor integration. Copyright © 2014 Elsevier Inc. All rights reserved.