Science.gov

Sample records for helianthus annuus

  1. Sunflower (Helianthus annuus L.).

    PubMed

    Radonic, Laura M; Lewi, Dalia M; López, Nilda E; Hopp, H Esteban; Escandón, Alejandro S; Bilbao, Marisa López

    2015-01-01

    Sunflower (Helianthus annuus L.) is still considered as a recalcitrant species to in vitro culture and transformation in spite of the publication of different protocols. Here we describe a routine transformation system of this crop which requires mature HA89 genotype seeds and Agrobacterium tumefaciens EHA105 strain for gene delivery, being both easily available. Selection of transformed shoots depends on root development in kanamycin-selective media, instead of shoot color, avoiding selection of escapes. The establishment of this protocol proved successful for the incorporation of both reporter and agronomic important genes and also for the evaluation of the specific expression patterns of different promoters in transgenic sunflower plants. Stable expression of the incorporated transgenes was confirmed by RT-PCR and GUS reporter gene visualization. Stable inheritance of transgenes was successfully followed until T2 generation in several independent lines.

  2. Sunflower (Helianthus annuus L.).

    PubMed

    Radonic, Laura M; Lewi, Dalia M; López, Nilda E; Hopp, H Esteban; Escandón, Alejandro S; Bilbao, Marisa López

    2015-01-01

    Sunflower (Helianthus annuus L.) is still considered as a recalcitrant species to in vitro culture and transformation in spite of the publication of different protocols. Here we describe a routine transformation system of this crop which requires mature HA89 genotype seeds and Agrobacterium tumefaciens EHA105 strain for gene delivery, being both easily available. Selection of transformed shoots depends on root development in kanamycin-selective media, instead of shoot color, avoiding selection of escapes. The establishment of this protocol proved successful for the incorporation of both reporter and agronomic important genes and also for the evaluation of the specific expression patterns of different promoters in transgenic sunflower plants. Stable expression of the incorporated transgenes was confirmed by RT-PCR and GUS reporter gene visualization. Stable inheritance of transgenes was successfully followed until T2 generation in several independent lines. PMID:25416248

  3. Sunflower (Helianthus annuus L.).

    PubMed

    Lewi, Dalia M; Hopp, H Esteban; Escandón, Alejandro S

    2006-01-01

    Sunflower (Helianthus annuus L.) is considered one of the recalcitrant species in terms of transformation and regeneration. A routine transformation system of this crop requires competent cell cultures for efficient plant regeneration as well as an effective method for gene delivery. A transformation system was developed by an Agrobacterium tumefaciens-mediated method using split mature embryonic axis explants from the Ha89 genotype. Mean transformation efficiency obtained (measured as PCR+ plants/treated explants) varied from 1 to 5.2% depending on the use of the EHA105 or the C58 strain containing a plasmid with a gene of agronomic interest. The system developed has applicability to several Agrobacterium strains and plasmids with both reporter genes or genes of agronomic interest. Plants obtained with this protocol were confirmed by PCR and Southern blot. Stable inheritance of transgenes was successfully followed until generation T4 in several independent lines. PMID:16988353

  4. Genetic variability in sunflower (Helianthus annuus L.) and in the Helianthus genus as assessed by retrotransposon-based molecular markers.

    PubMed

    Vukich, M; Schulman, A H; Giordani, T; Natali, L; Kalendar, R; Cavallini, A

    2009-10-01

    The inter-retrotransposon amplified polymorphism (IRAP) protocol was applied for the first time within the genus Helianthus to assess intraspecific variability based on retrotransposon sequences among 36 wild accessions and 26 cultivars of Helianthus annuus L., and interspecific variability among 39 species of Helianthus. Two groups of LTRs, one belonging to a Copia-like retroelement and the other to a putative retrotransposon of unknown nature (SURE) have been isolated, sequenced and primers were designed to obtain IRAP fingerprints. The number of polymorphic bands in H. annuus wild accessions is as high as in Helianthus species. If we assume that a polymorphic band can be related to a retrotransposon insertion, this result suggests that retrotransposon activity continued after Helianthus speciation. Calculation of similarity indices from binary matrices (Shannon's and Jaccard's indices) show that variability is reduced among domesticated H. annuus. On the contrary, similarity indices among Helianthus species were as large as those observed among wild H. annuus accessions, probably related to their scattered geographic distribution. Principal component analysis of IRAP fingerprints allows the distinction between perennial and annual Helianthus species especially when the SURE element is concerned.

  5. Complex relationship between growth and circumnutations in Helianthus annuus stem

    PubMed Central

    Krol, Elzbieta; Dziubinska, Halina; Zawadzki, Tadeusz

    2008-01-01

    The growth and circumnutation of the stem of three-week old Helianthus annuus in the 16:8 h light:dark photoperiod were monitored using an angular position-sensing transducer and a time lapse photography system. It was found that the rate of growth and circumnutation reached a high level in the dark stage; in the light stage, however, only the growth rate reached the same high level, whereas the circumnutations were weak. These results showed that in the light stage the stem circumnutation was downregulated more strongly than the growth. Short-term stem responses to darkening and illumination were a further display of the relation between growth and circumnutations. Switching off the light caused an increase in the growth and circumnutation rate. In some cases it was accompanied by changes in the rotation direction. On the other hand, switching the light on caused an immediate transient (several-minute long) decrease in the growth rate resulting in stem contraction, and this was accompanied by an almost complete pause of circumnutation. Additionally, under light, there occurred a subsequent decrease in the magnitude, disturbance of circumnutation trajectory and, in some cases, changes in the direction of rotation. The observed stem contraction and disturbance of circumnutation imply the occurrence of turgor changes in sunflower stem, which may be caused by a non-wounding, darkening or illumination stimulus. Our experiments indicate that the disturbances of the growth rate are accompanied by changes in circumnutation parameters but we have also seen that there is no simple quantitative relation between growth rate and circumnutation rate. PMID:19513225

  6. Molecular mapping of three nuclear male sterility mutant genes in cultivated sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The nuclear male sterility (NMS) trait is a useful tool for sunflower (Helianthus annuus L.) breeding and genetic programs. Previously, we induced NMS mutants in cultivated line HA 89. The mutants possessed single recessive genes, ms6, ms7, and ms8, respectively, in NMS HA 89-872, NMS HA 89-552, and...

  7. Phomopsis stem canker: a re-emerging threat to sunflowers (Helianthus annuus) in the United States

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Phomopsis stem canker frequently causes yield reductions on sunflowers (Helianthus annuus L.) on several continents, including Australia, Russia, Europe and North America. Between 2001 and 2012, the incidence of Phomopsis stem canker has increased 16 fold in the Northern Great Plains of the United...

  8. Effect of wild Helianthus cytoplasms on agronomic and oil characteristics of cultivated sunflower (H. annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus L.) productions reliance on a single source of cytoplasmic male-sterility, PET1, derived from H. petiolaris Nutt., makes the crop genetically vulnerable. Twenty diverse cytoplasmic substitution lines from annual and perennial wild species were compared with the inbred li...

  9. Phomopsis Stem Canker: A Reemerging Threat to Sunflower (Helianthus annuus) in the United States

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Phomopsis stem canker causes yield reductions on sunflower (Helianthus annuus L.) on several continents, including Australia, Europe, and North America. In the United States, Phomopsis stem canker incidence has increased 16-fold in the Northern Great Plains between 2001 and 2012. Although Diaporthe ...

  10. Ecogeography and utility to plant breeding of the crop wild relatives of sunflower (Helianthus annuus L.).

    PubMed

    Kantar, Michael B; Sosa, Chrystian C; Khoury, Colin K; Castañeda-Álvarez, Nora P; Achicanoy, Harold A; Bernau, Vivian; Kane, Nolan C; Marek, Laura; Seiler, Gerald; Rieseberg, Loren H

    2015-01-01

    Crop wild relatives (CWR) are a rich source of genetic diversity for crop improvement. Combining ecogeographic and phylogenetic techniques can inform both conservation and breeding. Geographic occurrence, bioclimatic, and biophysical data were used to predict species distributions, range overlap and niche occupancy in 36 taxa closely related to sunflower (Helianthus annuus L.). Taxa lacking comprehensive ex situ conservation were identified. The predicted distributions for 36 Helianthus taxa identified substantial range overlap, range asymmetry and niche conservatism. Specific taxa (e.g., Helianthus deblis Nutt., Helianthus anomalus Blake, and Helianthus divaricatus L.) were identified as targets for traits of interest, particularly for abiotic stress tolerance, and adaptation to extreme soil properties. The combination of techniques demonstrates the potential for publicly available ecogeographic and phylogenetic data to facilitate the identification of possible sources of abiotic stress traits for plant breeding programs. Much of the primary genepool (wild H. annuus) occurs in extreme environments indicating that introgression of targeted traits may be relatively straightforward. Sister taxa in Helianthus have greater range overlap than more distantly related taxa within the genus. This adds to a growing body of literature suggesting that in plants (unlike some animal groups), geographic isolation may not be necessary for speciation. PMID:26500675

  11. Ecogeography and utility to plant breeding of the crop wild relatives of sunflower (Helianthus annuus L.)

    PubMed Central

    Kantar, Michael B.; Sosa, Chrystian C.; Khoury, Colin K.; Castañeda-Álvarez, Nora P.; Achicanoy, Harold A.; Bernau, Vivian; Kane, Nolan C.; Marek, Laura; Seiler, Gerald; Rieseberg, Loren H.

    2015-01-01

    Crop wild relatives (CWR) are a rich source of genetic diversity for crop improvement. Combining ecogeographic and phylogenetic techniques can inform both conservation and breeding. Geographic occurrence, bioclimatic, and biophysical data were used to predict species distributions, range overlap and niche occupancy in 36 taxa closely related to sunflower (Helianthus annuus L.). Taxa lacking comprehensive ex situ conservation were identified. The predicted distributions for 36 Helianthus taxa identified substantial range overlap, range asymmetry and niche conservatism. Specific taxa (e.g., Helianthus deblis Nutt., Helianthus anomalus Blake, and Helianthus divaricatus L.) were identified as targets for traits of interest, particularly for abiotic stress tolerance, and adaptation to extreme soil properties. The combination of techniques demonstrates the potential for publicly available ecogeographic and phylogenetic data to facilitate the identification of possible sources of abiotic stress traits for plant breeding programs. Much of the primary genepool (wild H. annuus) occurs in extreme environments indicating that introgression of targeted traits may be relatively straightforward. Sister taxa in Helianthus have greater range overlap than more distantly related taxa within the genus. This adds to a growing body of literature suggesting that in plants (unlike some animal groups), geographic isolation may not be necessary for speciation. PMID:26500675

  12. Ecogeography and utility to plant breeding of the crop wild relatives of sunflower (Helianthus annuus L.).

    PubMed

    Kantar, Michael B; Sosa, Chrystian C; Khoury, Colin K; Castañeda-Álvarez, Nora P; Achicanoy, Harold A; Bernau, Vivian; Kane, Nolan C; Marek, Laura; Seiler, Gerald; Rieseberg, Loren H

    2015-01-01

    Crop wild relatives (CWR) are a rich source of genetic diversity for crop improvement. Combining ecogeographic and phylogenetic techniques can inform both conservation and breeding. Geographic occurrence, bioclimatic, and biophysical data were used to predict species distributions, range overlap and niche occupancy in 36 taxa closely related to sunflower (Helianthus annuus L.). Taxa lacking comprehensive ex situ conservation were identified. The predicted distributions for 36 Helianthus taxa identified substantial range overlap, range asymmetry and niche conservatism. Specific taxa (e.g., Helianthus deblis Nutt., Helianthus anomalus Blake, and Helianthus divaricatus L.) were identified as targets for traits of interest, particularly for abiotic stress tolerance, and adaptation to extreme soil properties. The combination of techniques demonstrates the potential for publicly available ecogeographic and phylogenetic data to facilitate the identification of possible sources of abiotic stress traits for plant breeding programs. Much of the primary genepool (wild H. annuus) occurs in extreme environments indicating that introgression of targeted traits may be relatively straightforward. Sister taxa in Helianthus have greater range overlap than more distantly related taxa within the genus. This adds to a growing body of literature suggesting that in plants (unlike some animal groups), geographic isolation may not be necessary for speciation.

  13. Allelotoxicity of Parthenium leaf extracts on cytomorphological behaviour of sunflower (Helianthus annuus).

    PubMed

    Kumar, G; Gautam, Neelam

    2008-03-01

    In recent decades allelopathy has gained much attention in the sustainable agricultural systems. It is necessary to trace out the mechanism of action of allelochemicals of plants on other plants. Allelochemicals of different plants interact differently with each other. In the present context an attempt has been made to study the influence of allelochemicals released by Parthenium on the growth, morphology and cytology of Helianthus annuus, both being strong allelopathic plants. The lower concentration of decomposed Parthenium leaves showed enhancing effect while higher doses depicted suppressive effect on growth and morphology of Helianthus annuus. However, cytological studies of pollen mother cells (PMCs) revealed increase in abnormality percentage with increasing concentration of allelochemicals. This study suggests better understanding of allelochemicals interaction and their incorporation into the betterment of crop.

  14. Differences between Helianthus winteri and Helianthus annuus are deeper than physiology

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Winter’s sunflower (Helianthus winteri, Hw), a new sunflower species, is found on rocky, un-grazed, south facing slopes of the Southern Sierra Nevada foothills between the valley edge and several hundred feet upslope. This study characterized physiological differences between Helianthus winteri (Hw)...

  15. The tolerance efficiency of Panicum maximum and Helianthus annuus in TNT-contaminated soil and nZVI-contaminated soil.

    PubMed

    Jiamjitrpanich, Waraporn; Parkpian, Preeda; Polprasert, Chongrak; Laurent, François; Kosanlavit, Rachain

    2012-01-01

    This study was designed to compare the initial method for phytoremediation involving germination and transplantation. The study was also to determine the tolerance efficiency of Panicum maximum (Purple guinea grass) and Helianthus annuus (Sunflower) in TNT-contaminated soil and nZVI-contaminated soil. It was found that the transplantation of Panicum maximum and Helianthus annuus was more suitable than germination as the initiate method of nano-phytoremediation potting test. The study also showed that Panicum maximum was more tolerance than Helianthus annuus in TNT and nZVI-contaminated soil. Therefore, Panicum maximum in the transplantation method should be selected as a hyperaccumulated plant for nano-phytoremediation potting tests. Maximum tolerance dosage of Panicum maximum to TNT-concentration soil was 320 mg/kg and nZVI-contaminated soil was 1000 mg/kg in the transplantation method.

  16. Genotoxic effects of the insecticide cypermethrin on the root meristem cells of sunflowers (Helianthus annuus L.).

    PubMed

    Inceer, Huseyin; Hayirlioglu-Ayaz, Sema; Ozcan, Melahat

    2009-11-01

    In this study, the genotoxic effects of the insecticide cypermethrin on the root meristem cells of sunflowers (Helianthus annuus L.) were investigated. The roots were treated with 10- 25- 50- and 100-ppm concentrations of cypermethrin for 6, 12 and 24 h. The mitotic index and mitotic abnormalities were determined in both control and test groups. The cypermethrin showed a marked mitodepressive action on mitosis. The types of mitotic abnormalities included disturbed metaphase, c-mitosis, stickiness, laggards and chromatid bridges. A pronounced toxic effect was observed at the 50-ppm concentration. Cypermethrin may have genotoxic effects on sunflowers.

  17. A morphometric analysis of cellular differentiation in caps of primary and lateral roots of Helianthus annuus

    NASA Technical Reports Server (NTRS)

    Moore, R.

    1985-01-01

    In order to determine if patterns of cell differentiation are similar in primary and lateral roots, I performed a morphometric analysis of the ultrastructure of calyptrogen, columella, and peripheral cells in primary and lateral roots of Helianthus annuus. Each cell type is characterized by a unique ultrastructure, and the ultrastructural changes characteristic of cellular differentiation in root caps are organelle specific. No major structural differences exist in the structures of the composite cell types, or in patterns of cell differentiation in caps of primary vs. lateral roots.

  18. Identification of molecular markers linked to a new nuclear male-sterility gene ms7 in sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Nuclear male sterility (NMS) is an important alternative system to the cytoplasm male sterility (CMS) in hybrid breeding programs because of its stable male sterility and abundant available restorer resources. For sunflower (Helianthus annuus L.), NMS 89-552, a nuclear male-sterile mutant induced by...

  19. A survey of the foliar and soil arthropod communities in sunflower (Helianthus annuus) fields in central and eastern South Dakota

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The long coevolutionary history between sunflowers (Helianthus annuus, Asterales: Asteraceae) and arthropods in the Northern Great Plains has resulted in a commonly grown oilseed crop that harbors a large diversity of insects. A bioenventory of foliar and subterranean arthropods was performed in 22 ...

  20. Natural variation in gene expression between wild and weedy populations of Helianthus annuus.

    PubMed

    Lai, Zhao; Kane, Nolan C; Zou, Yi; Rieseberg, Loren H

    2008-08-01

    The molecular genetic changes underlying the transformation of wild plants into agricultural weeds are poorly understood. Here we use a sunflower cDNA microarray to detect variation in gene expression between two wild (non-weedy) Helianthus annuus populations from Utah and Kansas and four weedy H. annuus populations collected from agricultural fields in Utah, Kansas, Indiana, and California. When grown in a common growth chamber environment, populations differed substantially in their gene expression patterns, indicating extensive genetic differentiation. Overall, 165 uni-genes, representing approximately 5% of total genes on the array, showed significant differential expression in one or more weedy populations when compared to both wild populations. This subset of genes is enriched for abiotic/biotic stimulus and stress response proteins, which may underlie niche transitions from the natural sites to agricultural fields for H. annuus. However, only a small proportion of the differentially expressed genes overlapped in multiple wild vs. weedy comparisons, indicating that most of the observed expression changes are due to local adaptation or neutral processes, as opposed to parallel genotypic adaptation to agricultural fields. These results are consistent with an earlier phylogeographic study suggesting that weedy sunflowers have evolved multiple times in different regions of the United States and further indicate that the evolution of weedy sunflowers has been accompanied by substantial gene expression divergence in different weedy populations.

  1. Data on mass spectrometry based identification of allergens from sunflower (Helianthus annuus L.) pollen proteome.

    PubMed

    Ghosh, Nandini; Sircar, Gaurab; Saha, Bodhisattwa; Pandey, Naren; Bhattacharya, Swati Gupta

    2016-06-01

    Allergy is a type of abnormal immune reactions, which is triggered by environmental antigens or allergens and mediated by IgE antibodies. Now-a-days mass spectrometry is the method of choice for allergen identification based on homology searching. Here, we provide the mass spectrometry dataset associated with our previously published research article on identification of sunflower pollen allergens (Ghosh et al., 2015 [1]). In this study allergenicity of sunflower (Helianthus annuus) pollen grains were primarily investigated by clinical studies followed by detailed immunobiochemical and immunoproteomic analyses. The mass spectrometry data for the identification of allergens were deposited to ProteomeXchange Consortium via PRIDE partner repository with the dataset identifier PXD002397. PMID:27054187

  2. Metal contamination effects on sunflower (Helianthus annuus L.) growth and protein expression in leaves during development.

    PubMed

    Garcia, Jerusa Simone; Gratão, Priscila Lupino; Azevedo, Ricardo Antunes; Arruda, Marco Aurélio Zezzi

    2006-11-01

    Metal-ion contamination (Cd, Cu, Pb, and Zn) on sunflower (Helianthus annuus L.) growth and total leaf protein expression were studied in the present work. The height, mass production, and metal distribution (Ca, K, Fe, Mg, Na, and P) in all plant fractions (roots, stems, and leaves) were evaluated. Sunflowers plants contaminated with four metal ions decreases height and mass by 35% and 40%, respectively, compared to control. Significant differences of total protein composition were noted after SDS-PAGE separation. Sunflower proteomics were more affected when 500 mg L(-1) of metal ion was added as contaminant of both zinc and mixed ions solution. In these cases, proteins having a molar mass of 14.5, 34.5, and 54.0 kDa were present at a lower level and alterations in enzymatic activities (SOD and GR) were found. Sunflowers plants contaminated with zinc and the mixed ions solution showed some degree of oxidative stress.

  3. Isolation of Bioactive Compounds from Sunflower Leaves (Helianthus annuus L.) Extracted with Supercritical Carbon Dioxide.

    PubMed

    El Marsni, Zouhir; Torres, Ascension; Varela, Rosa M; Molinillo, José M G; Casas, Lourdes; Mantell, Casimiro; Martinez de la Ossa, Enrique J; Macias, Francisco A

    2015-07-22

    The work described herein is a continuation of our initial studies on the supercritical fluid extraction (SFE) with CO2 of bioactive substances from Helianthus annuus L. var. Arianna. The selected SFE extract showed high activity in the wheat coleoptile bioassay, in Petri dish phytotoxicity bioassays, and in the hydroponic culture of tomato seeds. Chromatographic fractionations of the extracts and a spectroscopic analysis of the isolated compounds showed 52 substances belonging to 10 different chemical classes, which were mainly sesquiterpene lactones, diterpenes, and flavonoids. Heliannuol M (31), helivypolides K and L (36, 37), and helieudesmanolide B (38) are described for the first time in the literature. Metabolites have been tested in the etiolated wheat coleoptile bioassay with good results in a noteworthy effect on germination. The most active compounds were also tested on tomato seeds, heliannuol A (30) and leptocarpin (45) being the most active, with values similar to those of the commercial herbicide.

  4. Data on mass spectrometry based identification of allergens from sunflower (Helianthus annuus L.) pollen proteome

    PubMed Central

    Ghosh, Nandini; Sircar, Gaurab; Saha, Bodhisattwa; Pandey, Naren; Bhattacharya, Swati Gupta

    2016-01-01

    Allergy is a type of abnormal immune reactions, which is triggered by environmental antigens or allergens and mediated by IgE antibodies. Now-a-days mass spectrometry is the method of choice for allergen identification based on homology searching. Here, we provide the mass spectrometry dataset associated with our previously published research article on identification of sunflower pollen allergens (Ghosh et al., 2015 [1]). In this study allergenicity of sunflower (Helianthus annuus) pollen grains were primarily investigated by clinical studies followed by detailed immunobiochemical and immunoproteomic analyses. The mass spectrometry data for the identification of allergens were deposited to ProteomeXchange Consortium via PRIDE partner repository with the dataset identifier PXD002397. PMID:27054187

  5. Isolation of Bioactive Compounds from Sunflower Leaves (Helianthus annuus L.) Extracted with Supercritical Carbon Dioxide.

    PubMed

    El Marsni, Zouhir; Torres, Ascension; Varela, Rosa M; Molinillo, José M G; Casas, Lourdes; Mantell, Casimiro; Martinez de la Ossa, Enrique J; Macias, Francisco A

    2015-07-22

    The work described herein is a continuation of our initial studies on the supercritical fluid extraction (SFE) with CO2 of bioactive substances from Helianthus annuus L. var. Arianna. The selected SFE extract showed high activity in the wheat coleoptile bioassay, in Petri dish phytotoxicity bioassays, and in the hydroponic culture of tomato seeds. Chromatographic fractionations of the extracts and a spectroscopic analysis of the isolated compounds showed 52 substances belonging to 10 different chemical classes, which were mainly sesquiterpene lactones, diterpenes, and flavonoids. Heliannuol M (31), helivypolides K and L (36, 37), and helieudesmanolide B (38) are described for the first time in the literature. Metabolites have been tested in the etiolated wheat coleoptile bioassay with good results in a noteworthy effect on germination. The most active compounds were also tested on tomato seeds, heliannuol A (30) and leptocarpin (45) being the most active, with values similar to those of the commercial herbicide. PMID:26151222

  6. Patterns of microsatellite evolution inferred from the Helianthus annuus (Asteraceae) transcriptome.

    PubMed

    Pramod, Sreepriya; Perkins, Andy D; Welch, Mark E

    2014-08-01

    The distribution of microsatellites in exons, and their association with gene ontology (GO) terms is explored to elucidate patterns of microsatellite evolution in the common sunflower, Helianthus annuus. The relative position, motif, size and level of impurity were estimated for each microsatellite in the unigene database available from the Compositae Genome Project (CGP), and statistical analyses were performed to determine if differences in microsatellite distributions and enrichment within certain GO terms were significant. There are more translated than untranslated microsatellites, implying that many bring about structural changes in proteins. However, the greatest density is observed within the UTRs, particularly 5'UTRs. Further, UTR microsatellites are purer and longer than coding region microsatellites. This suggests that UTR microsatellites are either younger and under more relaxed constraints, or that purifying selection limits impurities, and directional selection favours their expansion. GOs associated with response to various environmental stimuli including water deprivation and salt stress were significantly enriched with microsatellites. This may suggest that these GOs are more labile in plant genomes, or that selection has favoured the maintenance of microsatellites in these genes over others. This study shows that the distribution of transcribed microsatellites in H. annuus is nonrandom, the coding region microsatellites are under greater constraint compared to the UTR microsatellites, and that these sequences are enriched within genes that regulate plant responses to environmental stress and stimuli.

  7. Biologically active antimicrobial and antioxidant substances in the Helianthus annuus L. bee pollen.

    PubMed

    Fatrcová-Šramková, Katarína; Nôžková, Janka; Máriássyová, Magda; Kačániová, Miroslava

    2016-01-01

    The objective of this study was to measure the content of flavonoids, polyphenols, and carotenoids in the Helianthus annuus L. bee pollen. It was also to evaluate the ability of the dried, frozen, and freeze-dried extracts of sunflower (H. annuus) pollen, its scavenged free radicals and reducing action. Another aim of this study was to investigate the antimicrobial in vitro action of the H. annuus pollen extracts against the Gram-positive and Gram-negative bacteria and fungi. All pollen extracts showed medium antiradical activity and reductive ability. The most effective was the freeze-dried extract in both evaluation systems. The evaluation of the protective effects of DNA using a biosensor showed an opposite trending-frozen ˃ dried ˃ freeze-dried pollen. For the evaluation of antiradical activity, the DPPH method was used, and reductive ability was assessed by means of phosphomolybdic complex formation. The comparison of the polyphenols content shows higher values in freeze-dried bee pollen than in the dried and frozen pollen. The highest content of flavonoids was found in the frozen samples and the most carotenoids were present in the dried samples. In our study, the best antibacterial effects of the dried sunflower bee pollen extracts were found against Paenibacillus larvae, Pseudomonas aeruginosa, and Enterococcus raffinosus. The best inhibitory properties of the frozen sunflower bee pollen extracts were found against Escherichia coli, Pseudomonas aeruginosa, and Paenibacillus larvae. Very good inhibitory effects of freeze-dried sunflower bee pollen were found against Paenibacillus larvae, Brochotrix thermosphacta, and Enterococcus raffinosus. The best antifungal activity of the sunflower bee pollen was found in the frozen bee pollen extracts against Aspergillus ochraceus and freeze-dried bee pollen extracts against Aspergillus niger. PMID:26674447

  8. Biologically active antimicrobial and antioxidant substances in the Helianthus annuus L. bee pollen.

    PubMed

    Fatrcová-Šramková, Katarína; Nôžková, Janka; Máriássyová, Magda; Kačániová, Miroslava

    2016-01-01

    The objective of this study was to measure the content of flavonoids, polyphenols, and carotenoids in the Helianthus annuus L. bee pollen. It was also to evaluate the ability of the dried, frozen, and freeze-dried extracts of sunflower (H. annuus) pollen, its scavenged free radicals and reducing action. Another aim of this study was to investigate the antimicrobial in vitro action of the H. annuus pollen extracts against the Gram-positive and Gram-negative bacteria and fungi. All pollen extracts showed medium antiradical activity and reductive ability. The most effective was the freeze-dried extract in both evaluation systems. The evaluation of the protective effects of DNA using a biosensor showed an opposite trending-frozen ˃ dried ˃ freeze-dried pollen. For the evaluation of antiradical activity, the DPPH method was used, and reductive ability was assessed by means of phosphomolybdic complex formation. The comparison of the polyphenols content shows higher values in freeze-dried bee pollen than in the dried and frozen pollen. The highest content of flavonoids was found in the frozen samples and the most carotenoids were present in the dried samples. In our study, the best antibacterial effects of the dried sunflower bee pollen extracts were found against Paenibacillus larvae, Pseudomonas aeruginosa, and Enterococcus raffinosus. The best inhibitory properties of the frozen sunflower bee pollen extracts were found against Escherichia coli, Pseudomonas aeruginosa, and Paenibacillus larvae. Very good inhibitory effects of freeze-dried sunflower bee pollen were found against Paenibacillus larvae, Brochotrix thermosphacta, and Enterococcus raffinosus. The best antifungal activity of the sunflower bee pollen was found in the frozen bee pollen extracts against Aspergillus ochraceus and freeze-dried bee pollen extracts against Aspergillus niger.

  9. Can arsenic-phytochelatin complex formation be used as an indicator for toxicity in Helianthus annuus?

    PubMed

    Raab, Andrea; Ferreira, Katia; Meharg, Andrew A; Feldmann, Jörg

    2007-01-01

    The formation of arsenic-phytochelatin (As-PC) complexes is thought to be part of the plant detoxification strategy for arsenic. This work examines (i) the arsenic (As) concentration-dependent formation of As-PC complex formation and (ii) redistribution and metabolism of As after arrested As uptake in Helianthus annuus. HPLC with parallel ICP-MS/ES-MS detection was used to identify and quantify the species present in plant extracts exposed to arsenate (As(V)) (between 0 and 66.7 micromol As l-1 for 24 h). At As concentrations below the EC50 value for root growth (22 micromol As l-1) As uptake is exponential, but it is reduced at concentrations above. Translocation between root and shoot seemed to be limited to the uptake phase of arsenic. No redistribution of As between root and shoot was observed after arresting As exposure. The formation of As-PC complexes was concentration-dependent. The amount and number of As-PC complexes increased exponentially with concentration up to 13.7 micromol As l-1. As(III)-PC3 and GS-As(III)-PC2 complexes were the dominant species in all samples. The ratio of PC-bound As to unbound As increased up to 1.3 micromol As l-1 and decreased at higher concentrations. Methylation of inorganic As was only a minor pathway in H. annuus with about 1% As methylated over a 32 d period. The concentration dependence of As-PC complex formation, amount of unbound reduced and oxidized PC2, and the relative uptake rate showed that As starts to influence the cellular metabolism of H. annuus negatively at As concentrations well below the EC50 value determined by more traditional means. Generally, As-PC complexes and PC-synthesis rate seem to be the more sensitive parameters to be studied when As toxicity values are to be estimated. PMID:17283372

  10. Can arsenic-phytochelatin complex formation be used as an indicator for toxicity in Helianthus annuus?

    PubMed

    Raab, Andrea; Ferreira, Katia; Meharg, Andrew A; Feldmann, Jörg

    2007-01-01

    The formation of arsenic-phytochelatin (As-PC) complexes is thought to be part of the plant detoxification strategy for arsenic. This work examines (i) the arsenic (As) concentration-dependent formation of As-PC complex formation and (ii) redistribution and metabolism of As after arrested As uptake in Helianthus annuus. HPLC with parallel ICP-MS/ES-MS detection was used to identify and quantify the species present in plant extracts exposed to arsenate (As(V)) (between 0 and 66.7 micromol As l-1 for 24 h). At As concentrations below the EC50 value for root growth (22 micromol As l-1) As uptake is exponential, but it is reduced at concentrations above. Translocation between root and shoot seemed to be limited to the uptake phase of arsenic. No redistribution of As between root and shoot was observed after arresting As exposure. The formation of As-PC complexes was concentration-dependent. The amount and number of As-PC complexes increased exponentially with concentration up to 13.7 micromol As l-1. As(III)-PC3 and GS-As(III)-PC2 complexes were the dominant species in all samples. The ratio of PC-bound As to unbound As increased up to 1.3 micromol As l-1 and decreased at higher concentrations. Methylation of inorganic As was only a minor pathway in H. annuus with about 1% As methylated over a 32 d period. The concentration dependence of As-PC complex formation, amount of unbound reduced and oxidized PC2, and the relative uptake rate showed that As starts to influence the cellular metabolism of H. annuus negatively at As concentrations well below the EC50 value determined by more traditional means. Generally, As-PC complexes and PC-synthesis rate seem to be the more sensitive parameters to be studied when As toxicity values are to be estimated.

  11. Genetics of species differences in the wild annual sunflowers, Helianthus annuus and H. petiolaris.

    PubMed

    Lexer, Christian; Rosenthal, David M; Raymond, Olivier; Donovan, Lisa A; Rieseberg, Loren H

    2005-04-01

    Much of our knowledge of speciation genetics stems from quantitative trait locus (QTL) studies. However, interpretations of the size and distribution of QTL underlying species differences are complicated by differences in the way QTL magnitudes are estimated. Also, many studies fail to exploit information about QTL directions or to compare inter- and intraspecific QTL variation. Here, we comprehensively analyze an extensive QTL data set for an interspecific backcross between two wild annual sunflowers, Helianthus annuus and H. petiolaris, interpret different estimates of QTL magnitudes, identify trait groups that have diverged through selection, and compare inter- and intraspecific QTL magnitudes. Our results indicate that even minor QTL (in terms of backcross variance) may be surprisingly large compared to levels of standing variation in the parental species or phenotypic differences between them. Morphological traits, particularly flower morphology, were more strongly or consistently selected than life history or physiological traits. Also, intraspecific QTL were generally smaller than interspecific ones, consistent with the prediction that larger QTL are more likely to spread to fixation across a subdivided population. Our results inform the genetics of species differences in Helianthus and suggest an approach for the simultaneous mapping of inter- and intraspecific QTL.

  12. Helikaurolides A-D with a Diterpene-Sesquiterpene Skeleton from Supercritical Fluid Extracts of Helianthus annuus L. var. Arianna.

    PubMed

    Torres, Ascensión; Molinillo, José M G; Varela, Rosa M; Casas, Lourdes; Mantell, Casimiro; Martínez de la Ossa, Enrique J; Macías, Francisco A

    2015-10-01

    Four novel compounds (1-4) with an unprecedented skeleton that combines a sesquiterpene lactone and a kaurane diterpene acid were isolated from Helianthus annuus L. var. Arianna extract, which was obtained under supercritical conditions. The structures of 1-4 were elucidated by NMR and MS analyses. The biosynthetic routes involve sesquiterpene lactones and kauranic acid, both of which were previously isolated from this species.

  13. Light intensity alters the extent of arsenic toxicity in Helianthus annuus L. seedlings.

    PubMed

    Yadav, Geeta; Srivastava, Prabhat Kumar; Singh, Vijay Pratap; Prasad, Sheo Mohan

    2014-06-01

    The present study is aimed at assessing the extent of arsenic (As) toxicity under three different light intensities-optimum (400 μmole photon m(-2) s(-1)), sub-optimum (225 μmole photon m(-2) s(-1)), and low (75 μmole photon m(-2) s(-1))-exposed to Helianthus annuus L. var. DRSF-113 seedlings by examining various physiological and biochemical parameters. Irrespective of the light intensities under which H. annuus L. seedlings were grown, there was an As dose (low, i.e., 6 mg kg(-1) soil, As1; and high, i.e., 12 mg kg(-1) soil, As2)-dependent decrease in all the growth parameters, viz., fresh mass, shoot length, and root length. Optimum light-grown seedlings exhibited better growth performance than the sub-optimum and low light-grown seedlings; however, low light-grown plants had maximum root and shoot lengths. Accumulation of As in the plant tissues depended upon its concentration used, proximity of the plant tissue, and intensity of the light. Greater intensity of light allowed greater assimilation of photosynthates accompanied by more uptake of nutrients along with As from the medium. The levels of chlorophyll a, b, and carotenoids declined with increasing concentrations of As. Seedlings acquired maximum Chl a and b under optimum light which were more compatible to face As1 and As2 doses of As, also evident from the overall status of enzymatic (SOD, POD, CAT, and GST) and non-enzymatic antioxidant (Pro).

  14. Bioaugmentation with cadmium-resistant plant growth-promoting rhizobacteria to assist cadmium phytoextraction by Helianthus annuus.

    PubMed

    Prapagdee, Benjaphorn; Chanprasert, Maesinee; Mongkolsuk, Skorn

    2013-07-01

    Micrococcus sp. MU1 and Klebsiella sp. BAM1, the cadmium-resistant plant growth-promoting rhizobacteria (PGPR), produce high levels of indole-3-acetic acid (IAA) during the late stationary phase of their growth. The ability of PGPR to promote root elongation, plant growth and cadmium uptake in sunflowers (Helianthus annuus) was evaluated. Both species of bacteria were able to remove cadmium ions from an aqueous solution and enhanced cadmium mobilization in contaminated soil. Micrococcus sp. and Klebsiella sp. use aminocyclopropane carboxylic acid as a nitrogen source to support their growth, and the minimum inhibitory concentrations of cadmium for Micrococcus sp. and Klebsiella sp. were 1000 and 800mM, respectively. These bacteria promoted root elongation in H. annuus seedlings in both the absence and presence of cadmium compared to uninoculated seedlings. Inoculation with these bacteria was found to increase the root lengths of H. annuus that had been planted in cadmium-contaminated soil. An increase in dry weight was observed for H. annuus inoculated with Micrococcus sp. Moreover, Micrococcus sp. enhanced the accumulation of cadmium in the root and leaf of H. annuus compared to untreated plants. The highest cadmium accumulation in the whole plant was observed when the plants were treated with EDTA following the treatment with Micrococcus sp. In addition, the highest translocation of cadmium from root to the above-ground tissues of H. annuus was found after treatment with Klebsiella sp. in the fourth week after planting. Our results show that plant growth and cadmium accumulation in H. annuus was significantly enhanced by cadmium-resistant PGPRs, and these bacterial inoculants are excellent promoters of phytoextraction for the rehabilitation of heavy metal-polluted environments.

  15. Catalase degradation in sunflower cotyledons during peroxisome transition from glyoxysomal to leaf peroxisomal function. [Helianthus annuus

    SciTech Connect

    Eising, R.; Gerhardt, B.

    1987-06-01

    First order rate constant for the degradation (degradation constants) of catalase in the cotyledons of sunflower (Helianthus annuus L.) were determined by measuring the loss of catalase containing /sup 14/C-labeled heme. During greening of the cotyledons, a period when peroxisomes change from glyoxysomal to leaf peroxisomal function, the degradation of glyoxysomal catalase is significantly slower than during all other stages of cotyledon development in light or darkness. The degradation constant during the transition stage of peroxisome function amounts to 0.205 day/sup -1/ in contrast to the constants ranging from 0.304 day/sup -1/ to 0.515 day/sup -1/ during the other developmental stages. Density labeling experiments comprising labeling of catalase with /sup 2/H/sub 2/O and its isopycnic centrifugation on CsCl gradients demonstrated that the determinations of the degradation constants were not substantially affected by reutilization of /sup 14/C-labeled compounds for catalase synthesis. The degradation constants for both glyoxysomal catalase and catalase synthesized during the transition of peroxisome function do not differ. This was shown by labeling the catalases with different isotopes and measuring the isotope ratio during the development of the cotyledons. The results are inconsistent with the concept that an accelerated and selective degradation of glyoxysomes underlies the change in peroxisome function. The data suggest that catalase degradation is at least partially due to an individual turnover of catalase and does not only result from a turnover of the whole peroxisomes.

  16. Cytomorphological and molecular diversity in backcross-derived inbred lines of sunflower (Helianthus annuus L.).

    PubMed

    Sujatha, M; Prabakaran, A J; Dwivedi, Sangam L; Chandra, S

    2008-04-01

    A set of 250 distinct, stable, and uniform backcross-derived inbred lines were developed in sunflower through 5 interspecific cross combinations involving 4 wild diploid annual species (Helianthus argophyllus, H. petiolaris, H. annuus, and H. debilis). The presence of the wild-species genome in these inbred lines was confirmed through higher chromosome associations (tri- and quadrivalents) at diakinesis. Maximum structural rearrangements of chromosomes were observed in lines derived from H. petiolaris. Forty morphologically diverse inbred lines along with 2 controls were subjected to measurements of phenotypic and genetic distance using 118 simple sequence repeat (SSR) markers of known map location. A total of 204 alleles were identified and the number of alleles per locus varied between 2 and 5. There were 46 unique alleles and the number of unique alleles was highest in the lines derived from the cross involving H. petiolaris. The polymorphism information content (PIC) values ranged from 0.05 to 0.575. The pair-wise comparison values based on genetic dissimilarity estimates computed using molecular marker data varied between 0.143 and 0.486 among the 42 lines. The results indicate that the sunflower gene pool could benefit from introgression of novel alleles from the latent genetic diversity present in the wild species and particularly through exploitation of the diploid annual H. petiolaris.

  17. HACRE1, a recently inserted copia-like retrotransposon of sunflower (Helianthus annuus L.).

    PubMed

    Buti, M; Giordani, T; Vukich, M; Gentzbittel, L; Pistelli, L; Cattonaro, F; Morgante, M; Cavallini, A; Natali, L

    2009-11-01

    In this paper we report on the isolation and characterization, for the first time, of a complete 6511 bp retrotransposon of sunflower. Considering its protein domain order and sequence similarity to other copia elements of dicotyledons, this retrotransposon was assigned to the copia retrotransposon superfamily and named HACRE1 (Helianthus annuus copia-like retroelement 1). HACRE1 carries 5' and 3' long terminal repeats (LTRs) flanking an internal region of 4661 bp. The LTRs are identical in their sequence except for two deletions of 7 and 5 nucleotides in the 5' LTR. Based on the sequence identity of the LTRs, HACRE1 was estimated to have inserted within the last approximately 84 000 years. The isolated sequence contains a complete open reading frame with only one complete reading frame. The absence of nonsense mutations agrees with the very high sequence identity between LTRs, confirming that HACRE1 insertion is recent. The haploid genome of sunflower (inbred line HCM) contains about 160 copies of HACRE1. This retrotransposon is expressed in leaflets from 7-day-old plantlets under different light conditions, probably in relation to the occurrence of many putative light-related regulatory cis-elements in the LTRs. However, sequenced cDNAs show less variability than HACRE1 genomic sequences, indicating that only a subset of this family is expressed under these conditions.

  18. Pre-dawn stomatal opening does not substantially enhance early-morning photosynthesis in Helianthus annuus.

    PubMed

    Auchincloss, Lisa; Easlon, Hsien M; Levine, Diedre; Donovan, Lisa; Richards, James H

    2014-06-01

    Most C3 plant species have partially open stomata during the night especially in the 3-5 h before dawn. This pre-dawn stomatal opening has been hypothesized to enhance early-morning photosynthesis (A) by reducing diffusion limitations to CO2 at dawn. We tested this hypothesis in cultivated Helianthus annuus using whole-shoot gas exchange, leaf level gas exchange and modelling approaches. One hour pre-dawn low-humidity treatments were used to reduce pre-dawn stomatal conductance (g). At the whole-shoot level, a difference of pre-dawn g (0.40 versus 0.17 mol m(-2) s(-1)) did not significantly affect A during the first hour after dawn. Shorter term effects were investigated with leaf level gas exchange measurements and a difference of pre-dawn g (0.10 versus 0.04 mol m(-2) s(-1)) affected g and A for only 5 min after dawn. The potential effects of a wider range of stomatal apertures were explored with an empirical model of the relationship between A and intercellular CO2 concentration during the half-hour after dawn. Modelling results demonstrated that even extremely low pre-dawn stomatal conductance values have only a minimal effect on early-morning A for a few minutes after dawn. Thus, we found no evidence that pre-dawn stomatal opening enhances A.

  19. Cr localization and speciation in roots of chromate fed Helianthus annuus L. seedlings using synchrotron techniques.

    PubMed

    de la Rosa, Guadalupe; Castillo-Michel, Hiram; Cruz-Jiménez, Gustavo; Bernal-Alvarado, Jesús; Córdova-Fraga, Teodoro; López-Moreno, Laura; Cotte, Marine

    2014-01-01

    In order to gain knowledge on the potential use of Helianthus annuus L. for the remediation of Cr(VI) polluted waters, hydroponics experiments were set up to determine Cr uptake and tolerance in different Cr(VI)-sulfate conditions, and Cr biotransformations. Results indicated that Cr(VI) promoted seed germination, and plant tolerance was higher at younger plant stages. Cr uptake was dependent on sulfate concentrations. The highest Cr levels in roots and shoots (13,700 and 2,500 mg kg(-1) dry weight (DW), respectively) were obtained in 1 mM sulfate. The lowest Cr uptake in roots (10,600 mg kg(-1) DW) was observed in seedlings treated with no sulfate. In shoots, Cr concentration was of 1,500 mg kg(-1)DW for the 1 mM sulfate treatment, indicating a different level of interaction between chromate and sulfate in both tissues. For the first time, using micro X-ray florescence (muXRF), we demonstrated Cr reaches the root stele and is located in the walls of xylem vessels. Bulk and micro X-ray Absorption Near-Edge Structure (muXANES) results showed that Cr in the roots is mostly in the form of Cr(III) phosphate (80%), with the remainder complexed to organic acids. Our results suggest this plant species may serve for Cr(VI) rhizofiltration purposes.

  20. Capitate glandular trichomes of Helianthus annuus (Asteraceae): ultrastructure and cytological development.

    PubMed

    Amrehn, Evelyn; Heller, Annerose; Spring, Otmar

    2014-01-01

    Previous studies have shown that capitate glandular trichomes (CGT) of the common sunflower, Helianthus annuus, produce sesquiterpene lactones (STL) and flavonoids, which are sequestered and accumulated between the apical cuticle and the wall of the tip cells. To explore the cellular structures required and putatively involved in the STL biosynthesis and secretion, the present study was focused on the development of CGT and the comparison of the ultrastructure of its different cell types. Gradual maturation of flowers in the capitulum of the sunflower provided the possibility to study the simultaneous differentiation from the primordial to the secretory stage of CGT located by light microscopy (bright field, differential interference contrast and fluorescence) as well as transmission electron microscopy. It was shown that the CGT of sunflower anthers had a biseriate structure with up to 14 cell pairs. In mature trichomes, the apical cells called secretory cells were covered entirely by a large cuticle globe, which enclosed the resinous terpenoids and was specialised in thickness and structure. The secretory cells lacked chloroplasts and contained mainly smooth endoplasmic reticulum (sER). Conspicuous cell wall protuberances and an accumulation of mitochondria nearby occurred in the horizontally oriented cell walls. The cytological differences between stalk cells and secretory cells indicate a different function. The dominance of sER suggests its involvement in STL biosynthesis and cell wall protuberances enlarge the surface of the plasmamembrane of secretory cells and may be involved in the secretion processes of STL into the subcuticular space.

  1. Acyl-acyl carrier protein thioesterase activity from sunflower (Helianthus annuus L.) seeds.

    PubMed

    Martínez-Force, E; Cantisán, S; Serrano-Vega, M J; Garcés, R

    2000-10-01

    During sunflower (Helianthus annuus L.) seed formation there was an active period of lipid biosynthesis between 12 and 28 days after flowering (DAF). The maximum in-vitro acyl-acyl carrier protein (ACP) thioesterase activities (EC 3.1.2.14) were found at 15 DAF, preceding the largest accumulation of lipid in the seed. Data from the apparent kinetic parameters, Vmax and Km, from seeds of 15 and 30 DAF, showed that changes in acyl-ACP thioesterase activity are not only quantitative, but also qualitative, since, although the preferred substrate was always oleoyl-ACP, the affinity for palmitoyl-ACP decreased, whereas that for stearoyl-ACP increased with seed maturation. Bisubstrate assays carried out at 30 DAF seemed to indicate that the total activity found in mature seeds is due to a single enzyme with 100/75/15 affinity for oleoyl-ACP/stearoyl-ACP/ palmitoyl-ACP. In contrast, at 15 DAF, enzymatic data together with partial sequences from cDNAs indicated the presence of at least two enzymes with different properties, a FatA-like thioesterase, with a high affinity for oleoyl-ACP, plus a FatB-like enzyme, with preference for long-chain saturated fatty acids, both being expressed during the active lipid biosynthesis period. Competition assays carried out with CAS-5, a mutant with a higher content of palmitic acid in the seed oil, indicated that a modified FatA-type thioesterase is involved in the mutant phenotype.

  2. Sunflower (Helianthus annuus L.) as a pre-Columbian domesticate in Mexico.

    PubMed

    Lentz, David L; Pohl, Mary DeLand; Alvarado, José Luis; Tarighat, Somayeh; Bye, Robert

    2008-04-29

    Mexico has long been recognized as one of the world's cradles of domestication with evidence for squash (Cucurbita pepo) cultivation appearing as early as 8,000 cal B.C. followed by many other plants, such as maize (Zea mays), peppers (Capsicum annuum), common beans (Phaseolus vulgaris), and cotton (Gossypium hirsutum). We present archaeological, linguistic, ethnographic, and ethnohistoric data demonstrating that sunflower (Helianthus annuus) had entered the repertoire of Mexican domesticates by ca. 2600 cal B.C., that its cultivation was widespread in Mexico and extended as far south as El Salvador by the first millennium B.C., that it was well known to the Aztecs, and that it is still in use by traditional Mesoamerican cultures today. The sunflower's association with indigenous solar religion and warfare in Mexico may have led to its suppression after the Spanish Conquest. The discovery of ancient sunflower in Mexico refines our knowledge of domesticated Mesoamerican plants and adds complexity to our understanding of cultural evolution.

  3. Effect of chromium on growth attributes in sunflower (Helianthus annuus L.).

    PubMed

    Fozia, Andaleeb; Muhammad, Anjum Zia; Muhammad, Ashraf; Zafar, Mahmood Khalid

    2008-01-01

    Heavy metal soil pollution takes place when the metal concentration of soil exceeds natural background level and causes ecological destruction and deterioration of the environment. In the present study, a pot experiment was conducted to evaluate the effect of chromium-contaminated soil in sunflower (Helianthus annuus L.) growth attributes. Three different levels of chromium (Cr) i.e., 20, 40, and 60 mg/kg were applied to three varieties of sunflower (G-3, G-9, and G-59). The results of morphological, chemical, and yield parameters were recorded at crop maturity. The result showed that germination, root, and shoot lengths were decreased with increase in Cr concentrations. A gradual decrease was observed for various morphological parameters like root fresh and dry weights, shoot fresh and dry weights, and plant height with increase in Cr levels. A comparison among Cr treatments obtained a significant decrease in yield parameters as achenes/capitulum, achenes/plant, and 100 achenes weight in three varieties. Cr was significantly absorbed by roots but its transport to other parts of plants was slow, and uptake in seeds was much lower than in roots and shoots. PMID:19209635

  4. Sunflower (Helianthus annuus L.) as a pre-Columbian domesticate in Mexico.

    PubMed

    Lentz, David L; Pohl, Mary DeLand; Alvarado, José Luis; Tarighat, Somayeh; Bye, Robert

    2008-04-29

    Mexico has long been recognized as one of the world's cradles of domestication with evidence for squash (Cucurbita pepo) cultivation appearing as early as 8,000 cal B.C. followed by many other plants, such as maize (Zea mays), peppers (Capsicum annuum), common beans (Phaseolus vulgaris), and cotton (Gossypium hirsutum). We present archaeological, linguistic, ethnographic, and ethnohistoric data demonstrating that sunflower (Helianthus annuus) had entered the repertoire of Mexican domesticates by ca. 2600 cal B.C., that its cultivation was widespread in Mexico and extended as far south as El Salvador by the first millennium B.C., that it was well known to the Aztecs, and that it is still in use by traditional Mesoamerican cultures today. The sunflower's association with indigenous solar religion and warfare in Mexico may have led to its suppression after the Spanish Conquest. The discovery of ancient sunflower in Mexico refines our knowledge of domesticated Mesoamerican plants and adds complexity to our understanding of cultural evolution. PMID:18443289

  5. Phomopsis Stem Canker: A Reemerging Threat to Sunflower (Helianthus annuus) in the United States.

    PubMed

    Mathew, Febina M; Alananbeh, Kholoud M; Jordahl, James G; Meyer, Scott M; Castlebury, Lisa A; Gulya, Thomas J; Markell, Samuel G

    2015-07-01

    Phomopsis stem canker causes yield reductions on sunflower (Helianthus annuus L.) on several continents, including Australia, Europe, and North America. In the United States, Phomopsis stem canker incidence has increased 16-fold in the Northern Great Plains between 2001 and 2012. Although Diaporthe helianthi was assumed to be the sole causal agent in the United States, a newly described species, D. gulyae, was found to be the primary cause of Phomopsis stem canker in Australia. To determine the identity of Diaporthe spp. causing Phomopsis stem canker in the Northern Great Plains, 275 infected stems were collected between 2010 and 2012. Phylogenetic analyses of sequences of the ribosomal DNA internal transcribed spacer region, elongation factor subunit 1-α, and actin gene regions of representative isolates, in comparison with those of type specimens, confirmed two species (D. helianthi and D. gulyae) in the United States. Differences in aggressiveness between the two species were determined using the stem-wound method in the greenhouse; overall, D. helianthi and D. gulyae did not vary significantly (P≤0.05) in their aggressiveness at 10 and 14 days after inoculation. These findings indicate that both Diaporthe spp. have emerged as sunflower pathogens in the United States, and have implications on the management of this disease. PMID:26121367

  6. The biosynthesis of triacylglycerols in microsomal preparations of developing cotyledons of sunflower (Helianthus annuus L.).

    PubMed

    Stymne, S; Stobart, A K

    1984-06-01

    The synthesis of triacylglycerols was investigated in microsomes (microsomal fractions) prepared from the developing cotyledons of sunflower (Helianthus annuus). Particular emphasis was placed on the mechanisms involved in controlling the C18- unsaturated-fatty-acid content of the oils. We have demonstrated that the microsomes were capable of: the transfer of oleate from acyl-CoA to position 2 of sn-phosphatidylcholine for its subsequent desaturation and the return of the polyunsaturated products to the acyl-CoA pool by further acyl exchange; the acylation of sn-glycerol 3-phosphate with acyl-CoA to yield phosphatidic acid, which was further utilized in diacyl- and tri-acylglycerol synthesis; and (3) the equilibrium of a diacylglycerol pool with phosphatidylcholine. The acyl exchange between acyl-CoA and position 2 of sn-phosphatidylcholine coupled to the equilibration of diacylglycerol and phosphatidylcholine brings about the continuous enrichment of the glycerol backbone with C18 polyunsaturated fatty acids for triacylglycerol production. Similar reactions were found to operate in another oilseed plant, safflower (Carthamus tinctorius L.). On the other hand, the microsomes of avocado (Persea americana) mesocarp, which synthesize triacylglycerol via the Kennedy [(1961) Fed. Proc. Fed. Am. Soc. Exp. Biol. 20, 934-940] pathway, were deficient in acyl exchange and the diacylglycerol in equilibrium phosphatidylcholine interconversion. The results provide a working model that helps to explain the relationship between C18- unsaturated-fatty-acid synthesis and triacylglycerol production in oilseeds.

  7. Effects of Salinity, Temperature, and Polyethylene Glycol on the Seed Germination of Sunflower (Helianthus annuus L.)

    PubMed Central

    Luan, Zhihui; Xiao, Moxin; Zhou, Daowei; Tian, Yu; Wu, Yi; Guan, Bo; Song, Yantao

    2014-01-01

    Salinization has severe influences on agriculture in the whole world. The main aims of this work were to evaluate osmotic effect and ion effect of NaCl on seed germination of three sunflower (Helianthus annuus L.) cultivars interacting with three alternating temperature regimes and to select the most salt tolerant cultivars to plant in the saline region. Seeds were germinated in the isotonic NaCl and polyethylene glycol (PEG) solutions of −0.45, −0.90, −1.34, −1.79, and −2.24 MPa at 10 : 20, 15 : 25, and 20 : 30°C temperature regimes. Both NaCl and PEG inhibited germination, but the effects of NaCl were less as compared to that of PEG, which means that adverse effects of PEG on germination were due to osmotic effect rather than specific ion accumulation. For the three cultivars, higher germination occurred at 10 : 20°C in NaCl treatments and at 20 : 30°C in the isotonic PEG treatments. Among the three cultivars, Sandaomei (SDM) is the most tolerant to salt and PEG stress. PMID:25610896

  8. Sunflower (Helianthus annuus L.) as a pre-Columbian domesticate in Mexico

    PubMed Central

    Lentz, David L.; Pohl, Mary DeLand; Alvarado, José Luis; Tarighat, Somayeh; Bye, Robert

    2008-01-01

    Mexico has long been recognized as one of the world's cradles of domestication with evidence for squash (Cucurbita pepo) cultivation appearing as early as 8,000 cal B.C. followed by many other plants, such as maize (Zea mays), peppers (Capsicum annuum), common beans (Phaseolus vulgaris), and cotton (Gossypium hirsutum). We present archaeological, linguistic, ethnographic, and ethnohistoric data demonstrating that sunflower (Helianthus annuus) had entered the repertoire of Mexican domesticates by ca. 2600 cal B.C., that its cultivation was widespread in Mexico and extended as far south as El Salvador by the first millennium B.C., that it was well known to the Aztecs, and that it is still in use by traditional Mesoamerican cultures today. The sunflower's association with indigenous solar religion and warfare in Mexico may have led to its suppression after the Spanish Conquest. The discovery of ancient sunflower in Mexico refines our knowledge of domesticated Mesoamerican plants and adds complexity to our understanding of cultural evolution. PMID:18443289

  9. Effects of salinity, temperature, and polyethylene glycol on the seed germination of sunflower (Helianthus annuus L.).

    PubMed

    Luan, Zhihui; Xiao, Moxin; Zhou, Daowei; Zhang, Hongxiang; Tian, Yu; Wu, Yi; Guan, Bo; Song, Yantao

    2014-01-01

    Salinization has severe influences on agriculture in the whole world. The main aims of this work were to evaluate osmotic effect and ion effect of NaCl on seed germination of three sunflower (Helianthus annuus L.) cultivars interacting with three alternating temperature regimes and to select the most salt tolerant cultivars to plant in the saline region. Seeds were germinated in the isotonic NaCl and polyethylene glycol (PEG) solutions of -0.45, -0.90, -1.34, -1.79, and -2.24 MPa at 10:20, 15:25, and 20:30 °C temperature regimes. Both NaCl and PEG inhibited germination, but the effects of NaCl were less as compared to that of PEG, which means that adverse effects of PEG on germination were due to osmotic effect rather than specific ion accumulation. For the three cultivars, higher germination occurred at 10:20 °C in NaCl treatments and at 20:30 °C in the isotonic PEG treatments. Among the three cultivars, Sandaomei (SDM) is the most tolerant to salt and PEG stress.

  10. Phomopsis Stem Canker: A Reemerging Threat to Sunflower (Helianthus annuus) in the United States.

    PubMed

    Mathew, Febina M; Alananbeh, Kholoud M; Jordahl, James G; Meyer, Scott M; Castlebury, Lisa A; Gulya, Thomas J; Markell, Samuel G

    2015-07-01

    Phomopsis stem canker causes yield reductions on sunflower (Helianthus annuus L.) on several continents, including Australia, Europe, and North America. In the United States, Phomopsis stem canker incidence has increased 16-fold in the Northern Great Plains between 2001 and 2012. Although Diaporthe helianthi was assumed to be the sole causal agent in the United States, a newly described species, D. gulyae, was found to be the primary cause of Phomopsis stem canker in Australia. To determine the identity of Diaporthe spp. causing Phomopsis stem canker in the Northern Great Plains, 275 infected stems were collected between 2010 and 2012. Phylogenetic analyses of sequences of the ribosomal DNA internal transcribed spacer region, elongation factor subunit 1-α, and actin gene regions of representative isolates, in comparison with those of type specimens, confirmed two species (D. helianthi and D. gulyae) in the United States. Differences in aggressiveness between the two species were determined using the stem-wound method in the greenhouse; overall, D. helianthi and D. gulyae did not vary significantly (P≤0.05) in their aggressiveness at 10 and 14 days after inoculation. These findings indicate that both Diaporthe spp. have emerged as sunflower pathogens in the United States, and have implications on the management of this disease.

  11. Bacterial Cr(VI) reduction concurrently improves sunflower (Helianthus Annuus L.) growth.

    PubMed

    Faisal, Muhammad; Hasnain, Shahida

    2005-07-01

    Four Cr(VI)-reducing bacterial strains (Ochrobactrum intermedium, CrT-2, CrT-3 and CrT-4) previously isolated from chromium-contaminated sites were inoculated on to seeds of sunflower (Helianthus annuus var SF-187), which were germinated and grown along with non-inoculated controls with chromate salts (300 microg CrCl3 or K2CrO4 ml(-1)). Severe reduction (20%) in seed germination was observed in Cr(VI) stress. Plant height decreased (36%) with Cr(VI) when compared with chromium-free control, while O. intermedium inoculation resulted a 20% increment in this parameter as compared to non-inoculated chromium-free control. CrT-3 inoculation resulted a 69% increment in auxin content as compared to non-inoculated control. O. intermedium caused 30% decrease in chromium uptake in sunflower plant roots under Cr(VI) stress as compared to chromium-free control plants. PMID:16091890

  12. Chloroplast SSR polymorphisms in the Compositae and the mode of organellar inheritance in Helianthus annuus.

    PubMed

    Wills, David M; Hester, Melissa L; Liu, Aizhong; Burke, John M

    2005-03-01

    Because organellar genomes are often uniparentally inherited, chloroplast (cp) and mitochondrial (mt) DNA polymorphisms have become the markers of choice for investigating evolutionary issues such as sex-biased dispersal and the directionality of introgression. To the extent that organellar inheritance is strictly maternal, it has also been suggested that the insertion of transgenes into either the chloroplast or mitochondrial genomes would reduce the likelihood of gene escape via pollen flow from crop fields into wild plant populations. In this paper we describe the adaptation of chloroplast simple sequence repeats (cpSSRs) for use in the Compositae. This work resulted in the identification of 12 loci that are variable across the family, seven of which were further shown to be highly polymorphic within sunflower (Helianthus annuus). We then used these markers, along with a novel mtDNA restriction fragment length polymorphism (RFLP), to investigate the mode of organellar inheritance in a series of experimental crosses designed to mimic the initial stages of crop-wild hybridization in sunflower. Although we cannot rule out the possibility of extremely rare paternal transmission, our results provide the best evidence to date of strict maternal organellar inheritance in sunflower, suggesting that organellar gene containment may be a viable strategy in sunflower. Moreover, the portability of these markers suggests that they will provide a ready source of cpDNA polymorphisms for use in evolutionary studies across the Compositae.

  13. EDTA and HEDTA effects on Cd, Cr, and Ni uptake by Helianthus annuus.

    PubMed

    Chen, H; Cutright, T

    2001-10-01

    Phytoremediation has shown great potential as an alternative treatment for the remediation of heavy-metal-contaminated soils and groundwater. However, the lack of a clear understanding pertaining to metal uptake/translocation mechanisms, enhancement amendments, and external effects on phytoremediation has hindered its full-scale application. The objective of this research was to investigate the ability of synthetic chelators for enhancing the phytoremediation of cadmium-, chromium- and nickel-contaminated soil. Ethylenediaminetriacetic acid (EDTA) and N-(2-hydroxyethyl)-ethylenediaminetriacetic acid (HEDTA) were applied to the soil at various dosages to elevate metal mobility. Uptake into and translocation within Helianthus annuus was determined. It was found that EDTA at a rate of 0.5 g/kg significantly increased the shoot concentrations of Cd and Ni from 34 and 15 to 115 and 117 mg/kg, respectively. The total removal efficiency for EDTA was 59 microg/plant. HEDTA at the same application rate resulted in a total metal uptake of 42 microg/plant. These research demonstrated that chelator enhancement is plant- and metal-specific and is subjective to inhibition when multiple heavy metals are present. Results also showed that chelator toxicity reduced the plant's biomass, thereby decreasing the amount of metal accumulation.

  14. Ectopic expression of the HAM59 gene causes homeotic transformations of reproductive organs in sunflower (Helianthus annuus L.).

    PubMed

    Shulga, O A; Neskorodov, Ya B; Shchennikova, A V; Gaponenko, A K; Skryabin, K G

    2015-01-01

    The function of the HAM59 MADS-box gene in sunflower (Helianthus annuus L.) was studied to clarify homeotic C activity in the Asteraceae plant family. For the first time, transgenic sunflower plants with a modified pattern of HAM59 expression were obtained. It was shown that the HAM59 MADS-box transcription factor did mediate C activity in sunflower. In particular, it participated in termination of the floral meristem, repression of the cadastral function of A-activity, and together with other C-type sunflower protein HAM45-in the specification of the identity of stamens and pistils.

  15. Identification of Candidate Genes Associated with Leaf Senescence in Cultivated Sunflower (Helianthus annuus L.)

    PubMed Central

    Moschen, Sebastian; Bengoa Luoni, Sofia; Paniego, Norma B.; Hopp, H. Esteban; Dosio, Guillermo A. A.

    2014-01-01

    Cultivated sunflower (Helianthus annuus L.), an important source of edible vegetable oil, shows rapid onset of senescence, which limits production by reducing photosynthetic capacity under specific growing conditions. Carbon for grain filling depends strongly on light interception by green leaf area, which diminishes during grain filling due to leaf senescence. Transcription factors (TFs) regulate the progression of leaf senescence in plants and have been well explored in model systems, but information for many agronomic crops remains limited. Here, we characterize the expression profiles of a set of putative senescence associated genes (SAGs) identified by a candidate gene approach and sunflower microarray expression studies. We examined a time course of sunflower leaves undergoing natural senescence and used quantitative PCR (qPCR) to measure the expression of 11 candidate genes representing the NAC, WRKY, MYB and NF-Y TF families. In addition, we measured physiological parameters such as chlorophyll, total soluble sugars and nitrogen content. The expression of Ha-NAC01, Ha-NAC03, Ha-NAC04, Ha-NAC05 and Ha-MYB01 TFs increased before the remobilization rate increased and therefore, before the appearance of the first physiological symptoms of senescence, whereas Ha-NAC02 expression decreased. In addition, we also examined the trifurcate feed-forward pathway (involving ORE1, miR164, and ETHYLENE INSENSITIVE 2) previously reported for Arabidopsis. We measured transcription of Ha-NAC01 (the sunflower homolog of ORE1) and Ha-EIN2, along with the levels of miR164, in two leaves from different stem positions, and identified differences in transcription between basal and upper leaves. Interestingly, Ha-NAC01 and Ha-EIN2 transcription profiles showed an earlier up-regulation in upper leaves of plants close to maturity, compared with basal leaves of plants at pre-anthesis stages. These results suggest that the H. annuus TFs characterized in this work could play important

  16. Identification of candidate genes associated with leaf senescence in cultivated sunflower (Helianthus annuus L.).

    PubMed

    Moschen, Sebastian; Bengoa Luoni, Sofia; Paniego, Norma B; Hopp, H Esteban; Dosio, Guillermo A A; Fernandez, Paula; Heinz, Ruth A

    2014-01-01

    Cultivated sunflower (Helianthus annuus L.), an important source of edible vegetable oil, shows rapid onset of senescence, which limits production by reducing photosynthetic capacity under specific growing conditions. Carbon for grain filling depends strongly on light interception by green leaf area, which diminishes during grain filling due to leaf senescence. Transcription factors (TFs) regulate the progression of leaf senescence in plants and have been well explored in model systems, but information for many agronomic crops remains limited. Here, we characterize the expression profiles of a set of putative senescence associated genes (SAGs) identified by a candidate gene approach and sunflower microarray expression studies. We examined a time course of sunflower leaves undergoing natural senescence and used quantitative PCR (qPCR) to measure the expression of 11 candidate genes representing the NAC, WRKY, MYB and NF-Y TF families. In addition, we measured physiological parameters such as chlorophyll, total soluble sugars and nitrogen content. The expression of Ha-NAC01, Ha-NAC03, Ha-NAC04, Ha-NAC05 and Ha-MYB01 TFs increased before the remobilization rate increased and therefore, before the appearance of the first physiological symptoms of senescence, whereas Ha-NAC02 expression decreased. In addition, we also examined the trifurcate feed-forward pathway (involving ORE1, miR164, and ethylene insensitive 2) previously reported for Arabidopsis. We measured transcription of Ha-NAC01 (the sunflower homolog of ORE1) and Ha-EIN2, along with the levels of miR164, in two leaves from different stem positions, and identified differences in transcription between basal and upper leaves. Interestingly, Ha-NAC01 and Ha-EIN2 transcription profiles showed an earlier up-regulation in upper leaves of plants close to maturity, compared with basal leaves of plants at pre-anthesis stages. These results suggest that the H. annuus TFs characterized in this work could play important

  17. Impact of the stem borer, Dectes texanus, on yield of the cultivated sunflower, Helianthus annuus.

    PubMed

    Michaud, J P; Grant, Angela K; Jyoti, J L

    2007-01-01

    Foliar and soil-drench insecticide treatments were used in attempts to manipulate infestation of cultivated sunflower plants, Helianthus annuus LeConte (Asterales: Asteraceae) by Dectes texanus LeConte, (Coleoptera: Cerambycidae) a serious pest of sunflowers in the High Plains of the USA. Seed yields were assessed on a per-plant basis for both oilseed and confection type sunflower hybrids in two years. Both insecticide treatments (foliar ë-cyhalothrin and soil-drench carbofuran) improved yield of oilseed sunflowers in 2004, but not in 2005. Yield of confection hybrids was improved by a systemic fungicide (thiophanate methyl) in 2005, but insecticides did not improve yield in either year. Both insecticide treatments gave good control of various stalk-boring insects such as Cylindrocopturus adspersus (Coleoptera: Curculionidae), Mordellistena sp. (Coleoptera: Mordellidae), and Pelochrista womanana (Lepidoptera: Tortricidae), but neither gave better than 50% control of D. texanus. Plants were sorted according to the presence or absence of D. texanus larvae and no reduction was found in total seed weight, seed size, or oil content as a result of infestation. However, mature larvae of D. texanus girdle stalks at the base in preparation for overwintering, a behavior that reduced stalk breakage force by 34-40%, leading to yield losses through lodging. At harvest in 2005, there were differences between cultivars and among treatments in the proportions of D. texanus larvae that had girdled their plants at harvest. It was concluded that further research aimed at reducing crop losses to D. texanus should focus on means of delaying stalk desiccation and/or deterioration, factors that appear to trigger girdling behavior.

  18. Ent-Kaurene Biosynthesis in Extracts of Helianthus annuus L. Seedlings 1

    PubMed Central

    Shen-Miller, Jane; West, Charles A.

    1982-01-01

    Kaurene synthetase B activity (conversion of copalyl pyrophosphate to ent-kaurene) is readily detectable in crude cell-free extracts of 3- to 4-day old dark-grown sunflower (Helianthus annuus cv. Mammoth) seedlings, whereas little or no kaurene synthetase AB activity (conversion of geranylgeranyl pyrophosphate to ent-kaurene) can be found in these extracts under comparable assay conditions. A low amount of AB activity is evident only if an extensively dialyzed extract is used in low concentrations as the enzyme source. One factor which may contribute to the low apparent levels of AB activity is the presence of inhibitory factors in the crude sunflower extract since these extracts can be shown to act as a potent inhibitor of Marah macrocarpus endosperm kaurene synthetase AB activity. Heat treatment (100°C) or dialysis of the sunflower extract reduces the amount of its inhibitory activity. Also, it was observed that low concentrations of extensively dialyzed sunflower extracts act to stimulate M. macrocarpus AB activity. There is no evidence for the presence of an inhibitory factor for M. macrocarpus kaurene synthetase B activity in sunflower extracts. However, there does appear to be present in the crude preparation of sunflower extract a dialyzable factor(s) that impedes its own B activity. There is little information to date on the nature of these inhibitory and stimulatory factors for kaurene synthetase activity or their possible roles in physiological regulation. The possible presence of such factors should be considered, however, when attempting to evaluate kaurene synthetase activities in extracts of vegetative plants. PMID:16662264

  19. Root water transport of Helianthus annuus L. under iron oxide nanoparticle exposure.

    PubMed

    Martínez-Fernández, Domingo; Barroso, Didac; Komárek, Michael

    2016-01-01

    The application of nanomaterials in commercially available products is increasing rapidly for agriculture, phytoremediation and biotechnology. Since plants suppose the first sink for the accumulation of nanoparticles from the environment, emerging studies have focused on the general consequences for plants and their effects on the biomass production. However, effects on the root surface, as well as blockage of nutrients and water uptake by the roots, may also occur. This experiment was designed to prove if the plant water relations can be affected by the adsorption of nanoparticles on the root surface, causing a consequent stress for the plants. With this goal, plants of Helianthus annuus were previously grown in a hydroponic culture, and at age of 55 days, their roots were exposed to three different concentrations of nanomaghemite (NM) in the hydroponic solution for 5 days: control without NM; 50 and 100 mg l(-1) NM. The main effect was related to the reduction of the root hydraulic conductivity (Lo) and the nutrients uptake. The concentrations of the macronutrients Ca, K, Mg and S in the shoot were reduced relative to the control plants, which resulted in lower contents of chlorophyll pigments. Although stress was not detected in the plants, after the analysis of stress markers like the accumulation of proline or ascorbate in the tissues, reduction of the root functionality by nanoparticles has been identified here, manifested as the effect of NM on Lo. The treatment with 50 mg l(-1) NM significantly reduced the Lo, by up to 57% of its control value, and it was reduced by up to 26% at 100 mg l(-1) NM. These results will be an important factor to take into account with regard to the applicability of NM for long-term use in crops, particularly during privative water conditions.

  20. Ethylene-mediated regulation of gibberellin content and growth in helianthus annuus L

    SciTech Connect

    Pearce, D.W.; Reid, D.M.; Pharis, R.P. )

    1991-04-01

    Elongation of hypocotyls of sunflower can be promoted by gibberellins (GAs) and inhibited by ethylene. The role of these hormones in regulating elongation was investigated by measuring changes in both endogenous GAs and in the metabolism of exogenous ({sup 3}H)- and ({sup 2}H{sub 2})GA{sub 20} in the hypocotyls of sunflower (Helianthus annuus L. cv Delgren 131) seedlings exposed to ethylene. The major biologically active GAs identified by gas chromatography-mass spectrometry were GA{sub 1}, GA{sub 19}, GA{sub 20}, and GA{sub 44}. In hypocotyls of seedlings exposed to ethylene, the concentration of GA{sub 1}, known to be directly active in regulating shoot elongation in a number of species, was reduced. Ethylene treatment reduced the metabolism of ({sup 3}H)GA{sub 20} and less ({sup 2}H{sub 2})GA{sub 1} was found in the hypocotyls of those seedlings exposed to the higher ethylene concentrations. However, it is not known if the effect of ethylene on GA{sub 20} metabolism was direct or indirect. In seedlings treated with exogenous GA{sub 1} or GA{sub 3}, the hypocotyls elongated faster than those of controls, but the GA treatment only partially overcame the inhibitory effect of ethylene on elongation. The authors conclude that GA content is a factor which may limit elongation in hypocotyls of sunflower, and that while exposure to ethylene results in reduced concentration of GA{sub 1} this is not sufficient per se to account for the inhibition of elongation caused by ethylene.

  1. Transport and Metabolism of 1-Aminocyclopropane-1-carboxylic Acid in Sunflower (Helianthus annuus L.) Seedlings 1

    PubMed Central

    Finlayson, Scott A.; Foster, Kenneth R.; Reid, David M.

    1991-01-01

    Transport and metabolism of [2,3-14C] 1-aminocyclopropane-1-carboxylic acid (ACC) from roots to shoots in 4-day-old sunflower (Helianthus annuus L.) seedlings were studied. [14C]ACC was detected in, and 14C2H4 was evolved from, shoots 0.5 hours after [14C]ACC was supplied to roots. Ethylene emanation from the shoots returned to normal levels after 6 hours. The roots showed a similar pattern, although at 24 hours ethylene emanation was still slightly higher than in those plants that did not receive ACC. [14C]N-malonyl-ACC (MACC) was detected in both tissues at all times sampled. [14C]MACC levels surpassed [14C]ACC levels in the shoot at 2 hours, whereas [14C]MACC levels in the root remained below [14C]ACC levels until 6 hours, after which they were higher. Thin-layer chromatography analysis identified [14C] ACC in 1-hour shoot extracts, and [14C]MACC was identified in root tissues at 1 and 12 hours after treatment. [14C]ACC and [14C] MACC in the xylem sap of treated seedlings were identified by thin-layer chromatography. Xylem transport of [14C]ACC in treated seedlings, and transport of ACC in untreated seedlings, was confirmed by gas chromatography-mass spectrometry. Some evidence for the presence of [14C]MACC in xylem sap in [14C]ACC-treated seedlings is presented. A substantial amount of radioactivity in both ACC and MACC fractions was detected leaking from the roots over 24 hours. A second radiolabeled volatile compound was trapped in a CO2-trapping solution but not in mercuric perchlorate. Levels of this compound were highest after the peak of ACC levels and before peak MACC levels in both tissues, suggesting that an alternate pathway of ACC metabolism was operating in this system. PMID:16668342

  2. Root water transport of Helianthus annuus L. under iron oxide nanoparticle exposure.

    PubMed

    Martínez-Fernández, Domingo; Barroso, Didac; Komárek, Michael

    2016-01-01

    The application of nanomaterials in commercially available products is increasing rapidly for agriculture, phytoremediation and biotechnology. Since plants suppose the first sink for the accumulation of nanoparticles from the environment, emerging studies have focused on the general consequences for plants and their effects on the biomass production. However, effects on the root surface, as well as blockage of nutrients and water uptake by the roots, may also occur. This experiment was designed to prove if the plant water relations can be affected by the adsorption of nanoparticles on the root surface, causing a consequent stress for the plants. With this goal, plants of Helianthus annuus were previously grown in a hydroponic culture, and at age of 55 days, their roots were exposed to three different concentrations of nanomaghemite (NM) in the hydroponic solution for 5 days: control without NM; 50 and 100 mg l(-1) NM. The main effect was related to the reduction of the root hydraulic conductivity (Lo) and the nutrients uptake. The concentrations of the macronutrients Ca, K, Mg and S in the shoot were reduced relative to the control plants, which resulted in lower contents of chlorophyll pigments. Although stress was not detected in the plants, after the analysis of stress markers like the accumulation of proline or ascorbate in the tissues, reduction of the root functionality by nanoparticles has been identified here, manifested as the effect of NM on Lo. The treatment with 50 mg l(-1) NM significantly reduced the Lo, by up to 57% of its control value, and it was reduced by up to 26% at 100 mg l(-1) NM. These results will be an important factor to take into account with regard to the applicability of NM for long-term use in crops, particularly during privative water conditions. PMID:26396006

  3. Effects of copper on chlorophyll, proline, protein and abscisic acid level of sunflower (Helianthus annuus L.) seedlings.

    PubMed

    Zengin, Fikriye Kirbag; Kirbag, Sevda

    2007-07-01

    The effect of copperchloride (CuCl2) on the level of chlorophyll (a+b), proline, protein and abscisic acid in sunflower (Helianthus annuus L.) seedlings were investigated Control and copper treated (0.4, 0.5 and 0.6 mM) seedlings were grown for ten days in Hoagland solution. Abscisic acid content was determined in root, shoot and leaf tissues of seedlings by HPLC. Copper stress caused significant increase of the abscisic acid contents in roots, shoots and leaves of seedlings. The increase was dependent on the copper salt concentration. Enhanced accumulation of proline in the leaves of seedlings exposed to copper was determined, as well as a decrease of chlorophyll (a+b) and total protein (p < 0.05 or p < 0.01). It was observed that the level of chlorophyll (a+b) and total protein (p < 0.05 or p < 0.01) remarkably decreased as copper concentration increased to 0.6 mM, although the levels of proline and abscisic acid in the leaves of plants were increased--a dose-depended behavior The same trends were also observed with the level of abscisic acid of stems and roots. Copper has dose- depended effects on chlorophyll, proline, protein and abscisic acid level of sunflower (Helianthus annuus L.) seedlings. Thus, we assumed that copper levels increase above some critical points seedling growth get negative effects. This assumption is in line with previous findings.

  4. [Adaptability of Helianthus annuus seedlings to crude oil pollution in soil and its improvement measures under salinization stress].

    PubMed

    Zhang, Jing-lei; Ci, Hua-cong; He, Xing-dong; Liang, Yu-ting; Zhao, Xuan; Sun, Hui-ting; Xie, Hong-tao

    2015-11-01

    To explore the adaptability of plant under salt stress to crude oil pollution of soil and improvement measures, a pot experiment of Helianthus annuus seedlings was conducted using orthogonal experiment method with crude oil-sodium chloride-desulfurization gypsum and cinder-zeolite-desulfurization gypsum-sawdust. The results showed that, with the increase of soil crude oil concentration, the relative growth rate (RGR) of plant height, RGR of aboveground biomass and root N: P ratios of H. annuus seedlings decreased significantly, while the activity of SOD and CAT increased at first and then decreased significantly. The RGR of plant height and aboveground biomass significantly increased (P < 0.05), while the activity of SOD decreased gradually with the increase of the volume fraction of sawdust, indicating that sawdust had the most significant effect in comparison with cinder, zeolite, desulfurization gypsum under salinization condition. The crude oil pollution of soil could decrease the relative growth rate of H. annuus seedling, and sawdust could reduce the influence of crude oil pollution on plant growth under salt stress.

  5. [Adaptability of Helianthus annuus seedlings to crude oil pollution in soil and its improvement measures under salinization stress].

    PubMed

    Zhang, Jing-lei; Ci, Hua-cong; He, Xing-dong; Liang, Yu-ting; Zhao, Xuan; Sun, Hui-ting; Xie, Hong-tao

    2015-11-01

    To explore the adaptability of plant under salt stress to crude oil pollution of soil and improvement measures, a pot experiment of Helianthus annuus seedlings was conducted using orthogonal experiment method with crude oil-sodium chloride-desulfurization gypsum and cinder-zeolite-desulfurization gypsum-sawdust. The results showed that, with the increase of soil crude oil concentration, the relative growth rate (RGR) of plant height, RGR of aboveground biomass and root N: P ratios of H. annuus seedlings decreased significantly, while the activity of SOD and CAT increased at first and then decreased significantly. The RGR of plant height and aboveground biomass significantly increased (P < 0.05), while the activity of SOD decreased gradually with the increase of the volume fraction of sawdust, indicating that sawdust had the most significant effect in comparison with cinder, zeolite, desulfurization gypsum under salinization condition. The crude oil pollution of soil could decrease the relative growth rate of H. annuus seedling, and sawdust could reduce the influence of crude oil pollution on plant growth under salt stress. PMID:26915209

  6. Molecular tagging of a novel rust resistance gene R(12) in sunflower (Helianthus annuus L.).

    PubMed

    Gong, L; Hulke, B S; Gulya, T J; Markell, S G; Qi, L L

    2013-01-01

    Sunflower production in North America has recently suffered economic losses in yield and seed quality from sunflower rust (Puccinia helianthi Schwein.) because of the increasing incidence and lack of resistance to new rust races. RHA 464, a newly released sunflower male fertility restorer line, is resistant to both of the most predominant and most virulent rust races identified in the Northern Great Plains of the USA. The gene conditioning rust resistance in RHA 464 originated from wild Helianthus annuus L., but has not been molecularly marked or determined to be independent from other rust loci. The objectives of this study are to identify molecular markers linked to the rust resistance gene and to investigate the allelism of this gene with the unmapped rust resistance genes present in HA-R6, HA-R8 and RHA 397. Virulence phenotypes of seedlings for the F(2) population and F(2:3) families suggested that a single dominant gene confers rust resistance in RHA 464, and this gene was designated as R(12). Bulked segregant analysis identified ten markers polymorphic between resistant and susceptible bulks. In subsequent genetic mapping, the ten markers covered 33.4 cM of genetic distance on linkage group 11 of sunflower. A co-dominant marker CRT275-11 is the closest marker distal to R(12) with a genetic distance of 1.0 cM, while ZVG53, a dominant marker linked in the repulsion phase, is proximal to R(12) with a genetic distance of 9.6 cM. The allelism test demonstrated that R(12) is not allelic to the rust resistance genes in HA-R6, HA-R8 and RHA 397, and it is also not linked to any previously mapped rust resistance genes. Discovery of the R(12) novel rust resistance locus in sunflower and associated markers will potentially support the molecular marker-assisted introgression and pyramiding of R(12) into sunflower breeding lines.

  7. The physiological and biochemical effects of salicylic acid on sunflowers (Helianthus annuus) exposed to flurochloridone.

    PubMed

    Kaya, Armagan; Yigit, Emel

    2014-08-01

    In this study, we comparatively evaluated the effects of the flurochloridone as well as flurochloridone and exogenously applied salicylic acid (SA) on Helianthus annuus L. to find out herbicide-induced toxicity reducing influence of SA. We examined and compared the physiological and biochemical effects of different concentrations of flurochloridone (11, 32 and 72 mM) in both the SA pre-treated and non-treated plants. The plants treated with flurochloridone exhibited reduced total chlorophyll, carotenoid, and relative water content compared to the control group, whereas the plants that were pre-treated with SA exhibited relatively higher values for the same physiological parameters. In the SA non-treated plants, the superoxide dismutase, glutathione reductase and glutathione S-transferase activities were increased in the treatment groups compared to the control group. In the treatment groups, these enzyme activities were decreased in the SA-pre-treated plants compared to the non-treated plants. Ascorbate peroxidase and catalase activities decreased in the flurochloridone-treated plants compared to the control plants. The ascorbate peroxidase activity increased in the control groups but decreased in the treatment groups in the SA pre-treated plants compared to the non-treated plants. However, SA treatment decreased the activity of catalase in the control and treatment groups compared to the plants that were not treated with SA. Flurochloridone treatment increased the malondialdehyde content in the treated groups compared to the control groups, whereas SA-pretreatment decreased malondialdehyde content compared to plants that were not treated with SA. Flurochloridone treatment increased endogenous SA content compared to the control. Although the residual levels of herbicide in the plants increased proportionately with increasing herbicide concentrations, the SA-pre-treated plants exhibited reduced residual herbicide levels compared to the plants that were not treated

  8. Detection of herbicide effects on pigment composition and PSII photochemistry in Helianthus annuus by Raman spectroscopy and chlorophyll a fluorescence.

    PubMed

    Vítek, Petr; Novotná, Kateřina; Hodaňová, Petra; Rapantová, Barbora; Klem, Karel

    2017-01-01

    The effects of herbicides from three mode-of-action groups - inhibitors of protoporphyrinogen oxidase (carfentrazone-ethyl), inhibitors of carotenoid biosynthesis (mesotrione, clomazone, and diflufenican), and inhibitors of acetolactate synthase (amidosulfuron) - were studied in sunflower plants (Helianthus annuus). Raman spectroscopy, chlorophyll fluorescence (ChlF) imaging, and UV screening of ChlF were combined to evaluate changes in pigment composition, photosystem II (PSII) photochemistry, and non-photochemical quenching in plant leaves 6d after herbicide application. The Raman signals of phenolic compounds, carotenoids, and chlorophyll were evaluated and differences in their intensity ratios were observed. Strongly augmented relative content of phenolic compounds was observed in the case of amidosulfuron-treated plants, with a simultaneous decrease in the chlorophyll/carotenoid intensity ratio. The results were confirmed by in vivo measurement of flavonols using UV screening of ChlF. Herbicides from the group of carotenoid biosynthesis inhibitors significantly decreased both the maximum quantum efficiency of PSII and non-photochemical quenching as determined by ChlF. Resonance Raman imaging (mapping) data with high resolution (150,000-200,000 spectra) are presented, showing the distribution of carotenoids in H. annuus leaves treated by two of the herbicides acting as inhibitors of carotenoid biosynthesis (clomazone or diflufenican). Clear signs were observed that the treatment induced carotenoid depletion within sunflower leaves. The depletion spatial pattern registered differed depending on the type of herbicide applied.

  9. Response of antioxidants in sunflower (Helianthus annuus L.) grown on different amendments of tannery sludge: its metal accumulation potential.

    PubMed

    Singh, Shraddha; Saxena, Rohit; Pandey, Kavita; Bhatt, Kavita; Sinha, Sarita

    2004-12-01

    The interaction of metals present in tannery waste and their tolerance in the plants of sunflower (Helianthus annuus L.) was studied in the present paper under field conditions. Effects of 100% tannery sludge and various amendments of tannery sludge (10%, 25%, 35%, 50%, 75%) along with one set of control were studied on the physiological and biochemical parameters of the plant along with their metal accumulation potential after 30, 60 and 90d after sowing. The plants of H. annuus were found effective in the accumulation of metals (Cr, Fe, Zn and Mn) in roots, shoots and leaves, however, the level of toxic metal, Cr was found below detection limit in the seeds of the plant. The oil was extracted from the seeds of the plant and the level of oil content was increased up to 35% tannery sludge as compared to control followed by decrease at higher tannery sludge ratio. An increase in the chlorophyll, protein, cysteine, non-protein thiol and sugar contents was observed at the lower amendment of tannery sludge at initial exposure periods followed by decrease than their respective controls. Malondialdehyde content in the roots and leaves was increased beyond 50% sludge amendments at all the exposure periods as compared to control. However, proline and ascorbic acid contents of the roots and leaves of the plant increased at all the exposure periods and sludge amendments, compared to their respective controls.

  10. Detection of herbicide effects on pigment composition and PSII photochemistry in Helianthus annuus by Raman spectroscopy and chlorophyll a fluorescence.

    PubMed

    Vítek, Petr; Novotná, Kateřina; Hodaňová, Petra; Rapantová, Barbora; Klem, Karel

    2017-01-01

    The effects of herbicides from three mode-of-action groups - inhibitors of protoporphyrinogen oxidase (carfentrazone-ethyl), inhibitors of carotenoid biosynthesis (mesotrione, clomazone, and diflufenican), and inhibitors of acetolactate synthase (amidosulfuron) - were studied in sunflower plants (Helianthus annuus). Raman spectroscopy, chlorophyll fluorescence (ChlF) imaging, and UV screening of ChlF were combined to evaluate changes in pigment composition, photosystem II (PSII) photochemistry, and non-photochemical quenching in plant leaves 6d after herbicide application. The Raman signals of phenolic compounds, carotenoids, and chlorophyll were evaluated and differences in their intensity ratios were observed. Strongly augmented relative content of phenolic compounds was observed in the case of amidosulfuron-treated plants, with a simultaneous decrease in the chlorophyll/carotenoid intensity ratio. The results were confirmed by in vivo measurement of flavonols using UV screening of ChlF. Herbicides from the group of carotenoid biosynthesis inhibitors significantly decreased both the maximum quantum efficiency of PSII and non-photochemical quenching as determined by ChlF. Resonance Raman imaging (mapping) data with high resolution (150,000-200,000 spectra) are presented, showing the distribution of carotenoids in H. annuus leaves treated by two of the herbicides acting as inhibitors of carotenoid biosynthesis (clomazone or diflufenican). Clear signs were observed that the treatment induced carotenoid depletion within sunflower leaves. The depletion spatial pattern registered differed depending on the type of herbicide applied. PMID:27450121

  11. Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium.

    PubMed

    Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María

    2015-01-01

    The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.

  12. Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium.

    PubMed

    Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María

    2015-01-01

    The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants. PMID:25495930

  13. Genome scan of hybridizing sunflowers from Texas (Helianthus annuus and H. debilis) reveals asymmetric patterns of introgression and small islands of genomic differentiation.

    PubMed

    Scascitelli, M; Whitney, K D; Randell, R A; King, Matthew; Buerkle, C A; Rieseberg, L H

    2010-02-01

    Although the sexual transfer of genetic material between species (i.e. introgression) has been documented in many groups of plants and animals, genome-wide patterns of introgression are poorly understood. Is most of the genome permeable to interspecific gene flow, or is introgression typically restricted to a handful of genomic regions? Here, we assess the genomic extent and direction of introgression between three sunflowers from the south-central USA: the common sunflower, Helianthus annuus ssp. annuus; a near-endemic to Texas, Helianthus debilis ssp. cucumerifolius; and their putative hybrid derivative, thought to have recently colonized Texas, H. annuus ssp. texanus. Analyses of variation at 88 genetically mapped microsatellite loci revealed that long-term migration rates were high, genome-wide and asymmetric, with higher migration rates from H. annuus texanus into the two parental taxa than vice versa. These results imply a longer history of intermittent contact between H. debilis and H. annuus than previously believed, and that H. annuus texanus may serve as a bridge for the transfer of alleles between its parental taxa. They also contradict recent theory suggesting that introgression should predominantly be in the direction of the colonizing species. As in previous studies of hybridizing sunflower species, regions of genetic differentiation appear small, whether estimated in terms of FST or unidirectional migration rates. Estimates of recent immigration and admixture were inconsistent, depending on the type of analysis. At the individual locus level, one marker showed striking asymmetry in migration rates, a pattern consistent with tight linkage to a Bateson-Dobzhansky-Muller incompatibility.

  14. Molecular characterization of Helja, an extracellular jacalin-related protein from Helianthus annuus: Insights into the relationship of this protein with unconventionally secreted lectins.

    PubMed

    Pinedo, Marcela; Orts, Facundo; Carvalho, André de Oliveira; Regente, Mariana; Soares, Julia Ribeiro; Gomes, Valdirene Moreira; de la Canal, Laura

    2015-07-01

    Jacalin-related lectins (JRLs) encompass cytosolic, nuclear and vacuolar members displaying the jacalin domain in one or more copies or in combination with unrelated domains. Helianthus annuus jacalin (Helja) is a mannose-specific JRL previously identified in the apoplast of Helianthus annuus seedlings, and this protein has been proposed to follow unconventional secretion. Here, we describe the full-length Helja cDNA sequence, which presents a unique jacalin domain (merolectin) and the absence of a signal peptide, confirming that the protein cannot follow the classical ER-dependent secretory pathway. Helja mRNA is present in seeds, cotyledons, roots and hypocotyls, but no transcripts were detected in the leaves. Searches for sequence similarity showed that Helja is barely similar to other JRLs present in H. annuus databases and less than 45% identical to other monocot or dicot JRLs. Strikingly, most of the merolectins recovered through data mining using Helja as a query were predicted as apoplastic, although most of these proteins lack the signal peptide required for classical secretion. Thus, Helja is the first bait identified to recover putative unconventionally secreted lectins. Because the recovered JRLs are widely distributed among the plant kingdom, an as yet unknown role for jacalin lectins in the apoplast is emerging.

  15. Effect on germination and early growth characteristics in sunflower (Helianthus annuus) seeds exposed to static magnetic field.

    PubMed

    Vashisth, Ananta; Nagarajan, Shantha

    2010-01-15

    Seeds of sunflower (Helianthus annuus) were exposed in batches to static magnetic fields of strength from 0 to 250mT in steps of 50mT for 1-4h in steps of 1h. Treatment of sunflower seeds in these magnetic fields increased the speed of germination, seedling length and seedling dry weight under laboratory germination tests. Of the various treatments, 50 and 200mT for 2h yielded the peak performance. Exposure of seeds to magnetic fields improved seed coat membrane integrity and reduced the cellular leakage and electrical conductivity. Treated seeds planted in soil resulted in statistically higher seedling dry weight, root length, root surface area and root volume in 1-month-old seedlings. In germinating seeds, enzyme activities of alpha-amylase, dehydrogenase and protease were significantly higher in treated seeds in contrast to controls. The higher enzyme activity in magnetic-field-treated sunflower seeds could be triggering the fast germination and early vigor of seedlings.

  16. Characterization and partial purification of acyl-CoA:glycerol 3-phosphate acyltransferase from sunflower (Helianthus annuus L.) developing seeds.

    PubMed

    Ruiz-López, Noemí; Garcés, Rafael; Harwood, John L; Martínez-Force, Enrique

    2010-01-01

    The glycerol 3-phosphate acyltransferase (GPAT, EC 2.3.1.15) from sunflower (Helianthus annuus L.) microsomes has been characterised and partially purified. The in vitro determination of activity was optimized, and the maximum value for GPAT activity identified between 15 and 20 days after flowering. The apparent Michaelis-Menten K(m) for the glycerol 3-phosphate was 354 muM. The preferred substrates were palmitoyl-CoA = linoleoyl-CoA > oleoyl-CoA with the lowest activity using stearoyl-CoA. High solubilisation was achieved using 0.75% Tween80 and the solubilised GPAT was partially purified by ion-exchange chromatography using a Hi-Trap DEAE FF column, followed by gel filtration chromatography using a Superose 12 HR column. The fraction containing the GPAT activity was analysed by SDS-PAGE and contained a major band of 60.1 kDa. Finally, evidence is provided which shows the role of GPAT in the asymmetrical distribution, between positions sn-1 and sn-3, of saturated fatty acids in highly saturated sunflower triacylglycerols. This work provides background information on the sunflower endoplasmic reticulum GPAT which may prove valuable for future modification of oil deposition in this important crop.

  17. Characterization of a small acyl-CoA-binding protein (ACBP) from Helianthus annuus L. and its binding affinities.

    PubMed

    Aznar-Moreno, Jose A; Venegas-Calerón, Mónica; Du, Zhi-Yan; Garcés, Rafael; Tanner, Julian A; Chye, Mee-Len; Martínez-Force, Enrique; Salas, Joaquín J

    2016-05-01

    Acyl-CoA-binding proteins (ACBPs) bind to acyl-CoA esters and promote their interaction with other proteins, lipids and cell structures. Small class I ACBPs have been identified in different plants, such as Arabidopsis thaliana (AtACBP6), Brassica napus (BnACBP) and Oryza sativa (OsACBP1, OsACBP2, OsACBP3), and they are capable of binding to different acyl-CoA esters and phospholipids. Here we characterize HaACBP6, a class I ACBP expressed in sunflower (Helianthus annuus) tissues, studying the specificity of its corresponding recombinant HaACBP6 protein towards various acyl-CoA esters and phospholipids in vitro, particularly using isothermal titration calorimetry and protein phospholipid binding assays. This protein binds with high affinity to de novo synthetized derivatives palmitoly-CoA, stearoyl-CoA and oleoyl-CoA (Kd 0.29, 0.14 and 0.15 μM respectively). On the contrary, it showed lower affinity towards linoleoyl-CoA (Kd 5.6 μM). Moreover, rHaACBP6 binds to different phosphatidylcholine species (dipalmitoyl-PC, dioleoyl-PC and dilinoleoyl-PC), yet it displays no affinity towards other phospholipids like lyso-PC, phosphatidic acid and lysophosphatidic acid derivatives. In the light of these results, the possible involvement of this protein in sunflower oil synthesis is considered. PMID:26938582

  18. Translatome profiling in dormant and nondormant sunflower (Helianthus annuus) seeds highlights post-transcriptional regulation of germination.

    PubMed

    Layat, Elodie; Leymarie, Juliette; El-Maarouf-Bouteau, Hayat; Caius, José; Langlade, Nicolas; Bailly, Christophe

    2014-12-01

    Seed dormancy, which blocks germination in apparently favourable conditions, is a key regulatory control point of plant population establishment. As germination requires de novo translation, its regulation by dormancy is likely to be related to the association of individual transcripts to polysomes. Here, the polysome-associated mRNAs, that is, the translatome, were fractionated and characterized with microarrays in dormant and nondormant sunflower (Helianthus annuus) embryos during their imbibition at 10°C, a temperature preventing germination of dormant embryos. Profiling of mRNAs in polysomal complexes revealed that the translatome differs between germinating and nongerminating embryos. Association of transcripts with polysomes reached a maximum after 15 h of imbibition; at this time-point 194 polysome-associated transcripts were specifically found in nondormant embryos and 47 in dormant embryos only. The proteins corresponding to the polysomal mRNAs in nondormant embryos appeared to be very pertinent for germination and were involved mainly in transport, regulation of transcription or cell wall modifications. This work demonstrates that seed germination results from a timely regulated and selective recruitment of mRNAs to polysomes, thus opening novel fields of investigation for the understanding of this developmental process.

  19. Molecular cloning and biochemical characterization of three phosphoglycerate kinase isoforms from developing sunflower (Helianthus annuus L.) seeds.

    PubMed

    Troncoso-Ponce, M A; Rivoal, J; Venegas-Calerón, M; Dorion, S; Sánchez, R; Cejudo, F J; Garcés, R; Martínez-Force, E

    2012-07-01

    Three cDNAs encoding different phosphoglycerate kinase (PGK, EC 2.7.2.3) isoforms, two cytosolic (HacPGK1 and HacPGK2) and one plastidic (HapPGK), were cloned and characterized from developing sunflower (Helianthus annuus L.) seeds. The expression profiles of these genes showed differences in heterotrophic tissues, such as developing seeds and roots, where HacPGK1 was predominant, while HapPGK was highly expressed in photosynthetic tissues. The cDNAs were expressed in Escherichia coli, and the corresponding proteins purified to electrophoretic homogeneity, using immobilized metal ion affinity chromatography, and biochemically characterized. Despite the high level of identity between sequences, the HacPGK1 isoform showed strong differences in terms of specific activity, temperature stability and pH sensitivity in comparison to HacPGK2 and HapPGK. A polyclonal immune serum was raised against the purified HacPGK1 isoform, which showed cross-immunoreactivity with the other PGK isoforms. This serum allowed the localization of high expression levels of PGK isozymes in embryo tissues.

  20. Rampant gene exchange across a strong reproductive barrier between the annual sunflowers, Helianthus annuus and H. petiolaris.

    PubMed

    Yatabe, Yoko; Kane, Nolan C; Scotti-Saintagne, Caroline; Rieseberg, Loren H

    2007-04-01

    Plant species may remain morphologically distinct despite gene exchange with congeners, yet little is known about the genomewide pattern of introgression among species. Here we analyze the effects of persistent gene flow on genomic differentiation between the sympatric sunflower species Helianthus annuus and H. petiolaris. While the species are strongly isolated in testcrosses, genetic distances at 108 microsatellite loci and 14 sequenced genes are highly variable and much lower (on average) than for more closely related but historically allopatric congeners. Our analyses failed to detect a positive association between levels of genetic differentiation and chromosomal rearrangements (as reported in a prior publication) or proximity to QTL for morphological differences or hybrid sterility. However, a significant increase in differentiation was observed for markers within 5 cM of chromosomal breakpoints. Together, these results suggest that islands of differentiation between these two species are small, except in areas of low recombination. Furthermore, only microsatellites associated with ESTs were identified as outlier loci in tests for selection, which might indicate that the ESTs themselves are the targets of selection rather than linked genes (or that coding regions are not randomly distributed). In general, these results indicate that even strong and genetically complex reproductive barriers cannot prevent widespread introgression.

  1. Cloning, heterologous expression and biochemical characterization of plastidial sn-glycerol-3-phosphate acyltransferase from Helianthus annuus.

    PubMed

    Payá-Milans, Miriam; Venegas-Calerón, Mónica; Salas, Joaquín J; Garcés, Rafael; Martínez-Force, Enrique

    2015-03-01

    The acyl-[acyl carrier protein]:sn-1-glycerol-3-phosphate acyltransferase (GPAT; E.C. 2.3.1.15) catalyzes the first step of glycerolipid assembly within the stroma of the chloroplast. In the present study, the sunflower (Helianthus annuus, L.) stromal GPAT was cloned, sequenced and characterized. We identified a single ORF of 1344base pairs that encoded a GPAT sharing strong sequence homology with the plastidial GPAT from Arabidopsis thaliana (ATS1, At1g32200). Gene expression studies showed that the highest transcript levels occurred in green tissues in which chloroplasts are abundant. The corresponding mature protein was heterologously overexpressed in Escherichia coli for purification and biochemical characterization. In vitro assays using radiolabelled acyl-ACPs and glycerol-3-phosphate as substrates revealed a strong preference for oleic versus palmitic acid, and weak activity towards stearic acid. The positional fatty acid composition of relevant chloroplast phospholipids from sunflower leaves did not reflect the in vitro GPAT specificity, suggesting a more complex scenario with mixed substrates at different concentrations, competition with other acyl-ACP consuming enzymatic reactions, etc. In summary, this study has confirmed the affinity of this enzyme which would partly explain the resistance to cold temperatures observed in sunflower plants.

  2. Rampant Gene Exchange Across a Strong Reproductive Barrier Between the Annual Sunflowers, Helianthus annuus and H. petiolaris

    PubMed Central

    Yatabe, Yoko; Kane, Nolan C.; Scotti-Saintagne, Caroline; Rieseberg, Loren H.

    2007-01-01

    Plant species may remain morphologically distinct despite gene exchange with congeners, yet little is known about the genomewide pattern of introgression among species. Here we analyze the effects of persistent gene flow on genomic differentiation between the sympatric sunflower species Helianthus annuus and H. petiolaris. While the species are strongly isolated in testcrosses, genetic distances at 108 microsatellite loci and 14 sequenced genes are highly variable and much lower (on average) than for more closely related but historically allopatric congeners. Our analyses failed to detect a positive association between levels of genetic differentiation and chromosomal rearrangements (as reported in a prior publication) or proximity to QTL for morphological differences or hybrid sterility. However, a significant increase in differentiation was observed for markers within 5 cM of chromosomal breakpoints. Together, these results suggest that islands of differentiation between these two species are small, except in areas of low recombination. Furthermore, only microsatellites associated with ESTs were identified as outlier loci in tests for selection, which might indicate that the ESTs themselves are the targets of selection rather than linked genes (or that coding regions are not randomly distributed). In general, these results indicate that even strong and genetically complex reproductive barriers cannot prevent widespread introgression. PMID:17277373

  3. Rhizofiltration using sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) to remediate uranium contaminated groundwater.

    PubMed

    Lee, Minhee; Yang, Minjune

    2010-01-15

    The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24h by using sunflower and the residual uranium concentration of the treated water was lower than 30 microg/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.

  4. Removal of trace metals by Sorghum bicolor and Helianthus annuus in a site polluted by industrial wastes: a field experience.

    PubMed

    Marchiol, L; Fellet, G; Perosa, D; Zerbi, G

    2007-05-01

    Using the perspective of full scale application of phytoremediation techniques, research is focusing on the optimization of agronomic practices. Two annual high biomass yield crops, Sorghum bicolor and Helianthus annuus, were grown in a polymetallic soil. The experimental site, polluted by pyrite cinders, is located in an industrial site that has been listed in the clean-up national priority list since 2001. Specific aims of this work were to observe the concentration of metals in plants during the crop cycle and to establish the amount of metal removed by the crops. The field trial, arranged in a randomized block design, started in 2005. The concentrations of heavy metals in the soil were: As 309, Cd 4.29, Co 50.9, Cu 1527 and Zn 980mg kg(-1). The crops grown on the polluted soil received mineral fertilization (Fert) and organic amendment (Org), while plants in control soil (Ctrl) did not receive anything. The plots were watered during the crop cycle during two drought periods, using a sprinkler irrigation system. The phytoextraction potential of crops was estimated during the whole growth cycle and the plant biomass that was collected in each sampling date was ICP-analyzed. Plant-biomass growth curves were obtained. The concentrations of the metals in the shoots and in the total plant biomass were recorded. Finally, the metal removal was calculated for the harvestable parts of the crops. The amelioration of the nutritive status of the substrate that resulted, was highly effective for the biomass yield. However, fertilization and soil amendment did not heighten the concentration of metals in the harvestable tissue of the plants during the crop cycle. In some cases, organic matter appeared to bind the elements making them less available for the plants. The evaluation of the potential of phytoremediation of our plants compared to other crops in terms of metal removal was positive. Our results of metal removal are consistent with the results from other in situ

  5. Effect of antioxidant butylated hydroxyl anisole on the thermal or oxidative stability of sunflower oil (Helianthus Annuus) by ultrasonic.

    PubMed

    Murari, Satish Kumar; Shwetha, M V

    2016-01-01

    The aim of the current investigation was to evaluate the efficiency of butylated hydroxyl anisole (BHA) as an antioxidant in sunflower oil (Helianthus Annuus). The oxidation stability of sunflower oil have been investigated by the effects of varying amounts of BHA. The antioxidant incorporated sunflower oil system and control edible oil were subjected to heating at 180 ± 5 °C continuously for a period of 4 h per day for consecutive 4 days. The parameters used to assess the thermal degradation and oxidation properties of the oils include ultrasonic velocity, viscosity, density and peroxide value. The fatty acid compositions of the oils were measured by gas chromatography. Adiabatic compressibility, intermolecular free length, relaxation time and acoustic impedance have been calculated from experimental data. Viscosity, density and ultrasonic velocity change in control oil is from 3.72 × 10(-2) to 13.2 × 10(-2) Nsm - 2, 918 to 994 kg/m3 and 1412 to 1484 m/s respectively and in sunflower oil with 200 ppm BHA is from 3.88 × 10(-2) to 7.52 × 10(-2) Nsm - 2, 926 to 962 kg/m3 and 1418 to 1463 m/s respectively for 16 h of heat treated oil. The ultrasonic results obtained have shown reduction in thermal degradation and improvement in oxidation stability of antioxidant loaded oil in comparison to base oil. Hence, it can be recommended that sunflower oil with 200 ppm BHA can be used for frying without adverse effect on physical properties. The ultrasonic velocity can be used for assessment of stability of frying oil. PMID:26788006

  6. Foliar-applied glyphosate substantially reduced uptake and transport of iron and manganese in sunflower (Helianthus annuus L.) plants.

    PubMed

    Eker, Selim; Ozturk, Levent; Yazici, Atilla; Erenoglu, Bulent; Romheld, Volker; Cakmak, Ismail

    2006-12-27

    Evidence clearly shows that cationic micronutrients in spray solutions reduce the herbicidal effectiveness of glyphosate for weed control due to the formation of metal-glyphosate complexes. The formation of these glyphosate-metal complexes in plant tissue may also impair micronutrient nutrition of nontarget plants when exposed to glyphosate drift or glyphosate residues in soil. In the present study, the effects of simulated glyphosate drift on plant growth and uptake, translocation, and accumulation (tissue concentration) of iron (Fe), manganese (Mn), zinc (Zn), and copper (Cu) were investigated in sunflower (Helianthus annuus L.) plants grown in nutrient solution under controlled environmental conditions. Glyphosate was sprayed on plant shoots at different rates between 1.25 and 6.0% of the recommended dosage (i.e., 0.39 and 1.89 mM glyphosate isopropylamine salt). Glyphosate applications significantly decreased root and shoot dry matter production and chlorophyll concentrations of young leaves and shoot tips. The basal parts of the youngest leaves and shoot tips were severely chlorotic. These effects became apparent within 48 h after the glyphosate spray. Glyphosate also caused substantial decreases in leaf concentration of Fe and Mn while the concentration of Zn and Cu was less affected. In short-term uptake experiments with radiolabeled Fe (59Fe), Mn (54Mn), and Zn (65Zn), root uptake of 59Fe and 54Mn was significantly reduced in 12 and 24 h after application of 6% of the recommended dosage of glyphosate, respectively. Glyphosate resulted in almost complete inhibition of root-to-shoot translocation of 59Fe within 12 h and 54Mn within 24 h after application. These results suggest that glyphosate residues or drift may result in severe impairments in Fe and Mn nutrition of nontarget plants, possibly due to the formation of poorly soluble glyphosate-metal complexes in plant tissues and/or rhizosphere interactions.

  7. Effect of antioxidant butylated hydroxyl anisole on the thermal or oxidative stability of sunflower oil (Helianthus Annuus) by ultrasonic.

    PubMed

    Murari, Satish Kumar; Shwetha, M V

    2016-01-01

    The aim of the current investigation was to evaluate the efficiency of butylated hydroxyl anisole (BHA) as an antioxidant in sunflower oil (Helianthus Annuus). The oxidation stability of sunflower oil have been investigated by the effects of varying amounts of BHA. The antioxidant incorporated sunflower oil system and control edible oil were subjected to heating at 180 ± 5 °C continuously for a period of 4 h per day for consecutive 4 days. The parameters used to assess the thermal degradation and oxidation properties of the oils include ultrasonic velocity, viscosity, density and peroxide value. The fatty acid compositions of the oils were measured by gas chromatography. Adiabatic compressibility, intermolecular free length, relaxation time and acoustic impedance have been calculated from experimental data. Viscosity, density and ultrasonic velocity change in control oil is from 3.72 × 10(-2) to 13.2 × 10(-2) Nsm - 2, 918 to 994 kg/m3 and 1412 to 1484 m/s respectively and in sunflower oil with 200 ppm BHA is from 3.88 × 10(-2) to 7.52 × 10(-2) Nsm - 2, 926 to 962 kg/m3 and 1418 to 1463 m/s respectively for 16 h of heat treated oil. The ultrasonic results obtained have shown reduction in thermal degradation and improvement in oxidation stability of antioxidant loaded oil in comparison to base oil. Hence, it can be recommended that sunflower oil with 200 ppm BHA can be used for frying without adverse effect on physical properties. The ultrasonic velocity can be used for assessment of stability of frying oil.

  8. A Genomic Scan for Selection Reveals Candidates for Genes Involved in the Evolution of Cultivated Sunflower (Helianthus annuus)[W

    PubMed Central

    Chapman, Mark A.; Pashley, Catherine H.; Wenzler, Jessica; Hvala, John; Tang, Shunxue; Knapp, Steven J.; Burke, John M.

    2008-01-01

    Genomic scans for selection are a useful tool for identifying genes underlying phenotypic transitions. In this article, we describe the results of a genome scan designed to identify candidates for genes targeted by selection during the evolution of cultivated sunflower. This work involved screening 492 loci derived from ESTs on a large panel of wild, primitive (i.e., landrace), and improved sunflower (Helianthus annuus) lines. This sampling strategy allowed us to identify candidates for selectively important genes and investigate the likely timing of selection. Thirty-six genes showed evidence of selection during either domestication or improvement based on multiple criteria, and a sequence-based test of selection on a subset of these loci confirmed this result. In view of what is known about the structure of linkage disequilibrium across the sunflower genome, these genes are themselves likely to have been targeted by selection, rather than being merely linked to the actual targets. While the selection candidates showed a broad range of putative functions, they were enriched for genes involved in amino acid synthesis and protein catabolism. Given that a similar pattern has been detected in maize (Zea mays), this finding suggests that selection on amino acid composition may be a general feature of the evolution of crop plants. In terms of genomic locations, the selection candidates were significantly clustered near quantitative trait loci (QTL) that contribute to phenotypic differences between wild and cultivated sunflower, and specific instances of QTL colocalization provide some clues as to the roles that these genes may have played during sunflower evolution. PMID:19017747

  9. Development, Characterization and Experimental Validation of a Cultivated Sunflower (Helianthus annuus L.) Gene Expression Oligonucleotide Microarray

    PubMed Central

    Fernandez, Paula; Soria, Marcelo; Blesa, David; DiRienzo, Julio; Moschen, Sebastian; Rivarola, Maximo; Clavijo, Bernardo Jose; Gonzalez, Sergio; Peluffo, Lucila; Príncipi, Dario; Dosio, Guillermo; Aguirrezabal, Luis; García-García, Francisco; Conesa, Ana; Hopp, Esteban; Dopazo, Joaquín; Heinz, Ruth Amelia; Paniego, Norma

    2012-01-01

    Oligonucleotide-based microarrays with accurate gene coverage represent a key strategy for transcriptional studies in orphan species such as sunflower, H. annuus L., which lacks full genome sequences. The goal of this study was the development and functional annotation of a comprehensive sunflower unigene collection and the design and validation of a custom sunflower oligonucleotide-based microarray. A large scale EST (>130,000 ESTs) curation, assembly and sequence annotation was performed using Blast2GO (www.blast2go.de). The EST assembly comprises 41,013 putative transcripts (12,924 contigs and 28,089 singletons). The resulting Sunflower Unigen Resource (SUR version 1.0) was used to design an oligonucleotide-based Agilent microarray for cultivated sunflower. This microarray includes a total of 42,326 features: 1,417 Agilent controls, 74 control probes for sunflower replicated 10 times (740 controls) and 40,169 different non-control probes. Microarray performance was validated using a model experiment examining the induction of senescence by water deficit. Pre-processing and differential expression analysis of Agilent microarrays was performed using the Bioconductor limma package. The analyses based on p-values calculated by eBayes (p<0.01) allowed the detection of 558 differentially expressed genes between water stress and control conditions; from these, ten genes were further validated by qPCR. Over-represented ontologies were identified using FatiScan in the Babelomics suite. This work generated a curated and trustable sunflower unigene collection, and a custom, validated sunflower oligonucleotide-based microarray using Agilent technology. Both the curated unigene collection and the validated oligonucleotide microarray provide key resources for sunflower genome analysis, transcriptional studies, and molecular breeding for crop improvement. PMID:23110046

  10. Development, characterization and experimental validation of a cultivated sunflower (Helianthus annuus L.) gene expression oligonucleotide microarray.

    PubMed

    Fernandez, Paula; Soria, Marcelo; Blesa, David; DiRienzo, Julio; Moschen, Sebastian; Rivarola, Maximo; Clavijo, Bernardo Jose; Gonzalez, Sergio; Peluffo, Lucila; Príncipi, Dario; Dosio, Guillermo; Aguirrezabal, Luis; García-García, Francisco; Conesa, Ana; Hopp, Esteban; Dopazo, Joaquín; Heinz, Ruth Amelia; Paniego, Norma

    2012-01-01

    Oligonucleotide-based microarrays with accurate gene coverage represent a key strategy for transcriptional studies in orphan species such as sunflower, H. annuus L., which lacks full genome sequences. The goal of this study was the development and functional annotation of a comprehensive sunflower unigene collection and the design and validation of a custom sunflower oligonucleotide-based microarray. A large scale EST (>130,000 ESTs) curation, assembly and sequence annotation was performed using Blast2GO (www.blast2go.de). The EST assembly comprises 41,013 putative transcripts (12,924 contigs and 28,089 singletons). The resulting Sunflower Unigen Resource (SUR version 1.0) was used to design an oligonucleotide-based Agilent microarray for cultivated sunflower. This microarray includes a total of 42,326 features: 1,417 Agilent controls, 74 control probes for sunflower replicated 10 times (740 controls) and 40,169 different non-control probes. Microarray performance was validated using a model experiment examining the induction of senescence by water deficit. Pre-processing and differential expression analysis of Agilent microarrays was performed using the Bioconductor limma package. The analyses based on p-values calculated by eBayes (p<0.01) allowed the detection of 558 differentially expressed genes between water stress and control conditions; from these, ten genes were further validated by qPCR. Over-represented ontologies were identified using FatiScan in the Babelomics suite. This work generated a curated and trustable sunflower unigene collection, and a custom, validated sunflower oligonucleotide-based microarray using Agilent technology. Both the curated unigene collection and the validated oligonucleotide microarray provide key resources for sunflower genome analysis, transcriptional studies, and molecular breeding for crop improvement. PMID:23110046

  11. Uptake of NO, NO 2 and O 3 by sunflower ( Helianthus annuus L.) and tobacco plants ( Nicotiana tabacum L.): dependence on stomatal conductivity

    NASA Astrophysics Data System (ADS)

    Neubert, A.; Kley, D.; Wildt, J.; Segschneider, H. J.; Förstel, H.

    The uptake of NO, NO 2 and O 3 by sunflowers ( Helianthus annuus L. var. giganteus) and tobacco plants ( Nicotiana tabacum L. var. Bel W3), using concentrations representative for moderately polluted air, has been determined by gas exchange experiments. Conductivities for these trace gases were measured at different light fluxes ranging from 820 μEm -2s -1 to darkness. The conductivities to water vapor and the trace gases are highly correlated. It is concluded that the uptake of NO, NO 2 and O 3 by sunflowers and tobacco plants is linearly dependent on stomatal opening. While the uptake of NO is limited by the mesophyll resistance, the uptake of NO 2 is only by diffusion through the stomata. Loss processes by deposition to the leaf surfaces are more pronounced for O 3 than for NO and NO 2.

  12. Repetitive DNA and Plant Domestication: Variation in Copy Number and Proximity to Genes of LTR-Retrotransposons among Wild and Cultivated Sunflower (Helianthus annuus) Genotypes.

    PubMed

    Mascagni, Flavia; Barghini, Elena; Giordani, Tommaso; Rieseberg, Loren H; Cavallini, Andrea; Natali, Lucia

    2015-12-01

    The sunflower (Helianthus annuus) genome contains a very large proportion of transposable elements, especially long terminal repeat retrotransposons. However, knowledge on the retrotransposon-related variability within this species is still limited. We used next-generation sequencing (NGS) technologies to perform a quantitative and qualitative survey of intraspecific variation of the retrotransposon fraction of the genome across 15 genotypes--7 wild accessions and 8 cultivars--of H. annuus. By mapping the Illumina reads of the 15 genotypes onto a library of sunflower long terminal repeat retrotransposons, we observed considerable variability in redundancy among genotypes, at both superfamily and family levels. In another analysis, we mapped Illumina paired reads to two sets of sequences, that is, long terminal repeat retrotransposons and protein-encoding sequences, and evaluated the extent of retrotransposon proximity to genes in the sunflower genome by counting the number of paired reads in which one read mapped to a retrotransposon and the other to a gene. Large variability among genotypes was also ascertained for retrotransposon proximity to genes. Both long terminal repeat retrotransposon redundancy and proximity to genes varied among retrotransposon families and also between cultivated and wild genotypes. Such differences are discussed in relation to the possible role of long terminal repeat retrotransposons in the domestication of sunflower. PMID:26608057

  13. Repetitive DNA and Plant Domestication: Variation in Copy Number and Proximity to Genes of LTR-Retrotransposons among Wild and Cultivated Sunflower (Helianthus annuus) Genotypes

    PubMed Central

    Mascagni, Flavia; Barghini, Elena; Giordani, Tommaso; Rieseberg, Loren H.; Cavallini, Andrea; Natali, Lucia

    2015-01-01

    The sunflower (Helianthus annuus) genome contains a very large proportion of transposable elements, especially long terminal repeat retrotransposons. However, knowledge on the retrotransposon-related variability within this species is still limited. We used next-generation sequencing (NGS) technologies to perform a quantitative and qualitative survey of intraspecific variation of the retrotransposon fraction of the genome across 15 genotypes—7 wild accessions and 8 cultivars—of H. annuus. By mapping the Illumina reads of the 15 genotypes onto a library of sunflower long terminal repeat retrotransposons, we observed considerable variability in redundancy among genotypes, at both superfamily and family levels. In another analysis, we mapped Illumina paired reads to two sets of sequences, that is, long terminal repeat retrotransposons and protein-encoding sequences, and evaluated the extent of retrotransposon proximity to genes in the sunflower genome by counting the number of paired reads in which one read mapped to a retrotransposon and the other to a gene. Large variability among genotypes was also ascertained for retrotransposon proximity to genes. Both long terminal repeat retrotransposon redundancy and proximity to genes varied among retrotransposon families and also between cultivated and wild genotypes. Such differences are discussed in relation to the possible role of long terminal repeat retrotransposons in the domestication of sunflower. PMID:26608057

  14. Molecular demographic history of the annual sunflowers Helianthus annuus and H. petiolaris--large effective population sizes and rates of long-term gene flow.

    PubMed

    Strasburg, Jared L; Rieseberg, Loren H

    2008-08-01

    Hybridization between distinct species may lead to introgression of genes across species boundaries, and this pattern can potentially persist for extended periods as long as selection at some loci or genomic regions prevents thorough mixing of gene pools. However, very few reliable estimates of long-term levels of effective migration are available between hybridizing species throughout their history. Accurate estimates of divergence dates and levels of gene flow require data from multiple unlinked loci as well as an analytical framework that can distinguish between lineage sorting and gene flow and incorporate the effects of demographic changes within each species. Here we use sequence data from 18 anonymous nuclear loci in two broadly sympatric sunflower species, Helianthus annuus and H. petiolaris, analyzed within an "isolation with migration" framework to make genome-wide estimates of the ages of these two species, long-term rates of gene flow between them, and effective population sizes and historical patterns of population growth. Our results indicate that H. annuus and H. petiolaris are approximately one million years old and have exchanged genes at a surprisingly high rate (long-term N(ef)m estimates of approximately 0.5 in each direction), with somewhat higher rates of introgression from H. annuus into H. petiolaris than vice versa. In addition, each species has undergone dramatic population expansion since divergence, and both species have among the highest levels of genetic diversity reported for flowering plants. Our results provide the most comprehensive estimate to date of long-term patterns of gene flow and historical demography in a nonmodel plant system, and they indicate that species integrity can be maintained even in the face of extensive gene flow over a prolonged period.

  15. Genetics and mapping of a novel downy mildew resistance gene, Pl18, introgressed from wild Helianthus argophyllus into cultivated sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower downy mildew is considered to be the most destructive foliar disease that has spread to every major sunflower-growing country of the world, except Australia. A new dominant downy mildew resistance gene (Pl18) transferred from wild Helianthus argophyllus (PI 494573) into cultivated sunflowe...

  16. Supplemental macronutrients and microbial fermentation products improve the uptake and transport of foliar applied zinc in sunflower (Helianthus annuus L.) plants. Studies utilizing micro X-ray florescence

    PubMed Central

    Tian, Shengke; Lu, Lingli; Xie, Ruohan; Zhang, Minzhe; Jernstedt, Judith A.; Hou, Dandi; Ramsier, Cliff; Brown, Patrick H.

    2014-01-01

    Enhancing nutrient uptake and the subsequent elemental transport from the sites of application to sites of utilization is of great importance to the science and practical field application of foliar fertilizers. The aim of this study was to investigate the mobility of various foliar applied zinc (Zn) formulations in sunflower (Helianthus annuus L.) and to evaluate the effects of the addition of an organic biostimulant on phloem loading and elemental mobility. This was achieved by application of foliar formulations to the blade of sunflower (H. annuus L.) and high-resolution elemental imaging with micro X-ray fluorescence (μ-XRF) to visualize Zn within the vascular system of the leaf petiole. Although no significant increase of total Zn in petioles was determined by inductively-coupled plasma mass-spectrometer, μ-XRF elemental imaging showed a clear enrichment of Zn in the vascular tissues within the sunflower petioles treated with foliar fertilizers containing Zn. The concentration of Zn in the vascular of sunflower petioles was increased when Zn was applied with other microelements with EDTA (commercial product Kick-Off) as compared with an equimolar concentration of ZnSO4 alone. The addition of macronutrients N, P, K (commercial product CleanStart) to the Kick-Off Zn fertilizer, further increased vascular system Zn concentrations while the addition of the microbially derived organic biostimulant “GroZyme” resulted in a remarkable enhancement of Zn concentrations in the petiole vascular system. The study provides direct visualized evidence for phloem transport of foliar applied Zn out of sites of application in plants by using μ-XRF technique, and suggests that the formulation of the foliar applied Zn and the addition of the organic biostimulant GroZyme increases the mobility of Zn following its absorption by the leaf of sunflower. PMID:25653663

  17. Supplemental macronutrients and microbial fermentation products improve the uptake and transport of foliar applied zinc in sunflower (Helianthus annuus L.) plants. Studies utilizing micro X-ray florescence

    DOE PAGES

    Tian, Shengke; Lu, Lingli; Xie, Ruohan; Zhang, Minzhe; Jernstedt, Judith A.; Hou, Dandi; Ramsier, Cliff; Brown, Patrick H.

    2015-01-21

    Enhancing nutrient uptake and the subsequent elemental transport from the sites of application to sites of utilization is of great importance to the science and practical field application of foliar fertilizers. The aim of this study was to investigate the mobility of various foliar applied zinc (Zn) formulations in sunflower (Helianthus annuus L.) and to evaluate the effects of the addition of an organic biostimulant on phloem loading and elemental mobility. This was achieved by application of foliar formulations to the blade of sunflower (H. annuus L.) and high-resolution elemental imaging with micro X-ray fluorescence (μ-XRF) to visualize Zn withinmore » the vascular system of the leaf petiole. Although no significant increase of total Zn in petioles was determined by inductively-coupled plasma mass-spectrometer, μ-XRF elemental imaging showed a clear enrichment of Zn in the vascular tissues within the sunflower petioles treated with foliar fertilizers containing Zn. The concentration of Zn in the vascular of sunflower petioles was increased when Zn was applied with other microelements with EDTA (commercial product Kick-Off) as compared with an equimolar concentration of ZnSO₄ alone. The addition of macronutrients N, P, K (commercial product CleanStart) to the Kick-Off Zn fertilizer, further increased vascular system Zn concentrations while the addition of the microbially derived organic biostimulant “GroZyme” resulted in a remarkable enhancement of Zn concentrations in the petiole vascular system. The study provides direct visualized evidence for phloem transport of foliar applied Zn out of sites of application in plants by using μ-XRF technique, and suggests that the formulation of the foliar applied Zn and the addition of the organic biostimulant GroZyme increases the mobility of Zn following its absorption by the leaf of sunflower.« less

  18. Purification and characterization of oil-bodies (oleosomes) and oil-body boundary proteins (oleosins) from the developing cotyledons of sunflower (Helianthus annuus L.)

    PubMed

    Millichip, M; Tatham, A S; Jackson, F; Griffiths, G; Shewry, P R; Stobart, A K

    1996-02-15

    Oil-bodies, from the immature cotyledons of sunflower (Helianthus annuus L.), were difficult to purify to homogeneity using conventional techniques. The major protein contaminants were albumin and globulin storage proteins. A protocol has been developed, therefore, based upon the stringent washing of the oil-body fraction in 9 M urea, which effectively removed almost all the contaminating protein as judged by SDS/PAGE. The urea-washed oil-bodies were enriched in two major proteins of M(r) 19000 and 20000. These proteins were oleosins as demonstrated by their amino acid compositions and the sequence analysis of peptides produced by CNBr cleavage. Far-UV CD spectra of the oleosins in trifluoroethanol, trifluoroethanol/water mixtures and as mixed micelles in SDS, were typical of alpha-helical proteins with alpha-helical contents of some 55%. The phospholipid content of the urea-washed preparations was less than 0.1% of that required to form a half-unit membrane surrounding the oil-body. The oil-body surface therefore appears to be an unusual and novel structure, covered largely by an oleosin protein coat or pellicle rather than a conventional fluid membrane, half-unit or otherwise.

  19. Spatio-temporal mapping of variation potentials in leaves of Helianthus annuus L. seedlings in situ using multi-electrode array

    PubMed Central

    Zhao, Dong-Jie; Wang, Zhong-Yi; Huang, Lan; Jia, Yong-Peng; Leng, John Q.

    2014-01-01

    Damaging thermal stimuli trigger long-lasting variation potentials (VPs) in higher plants. Owing to limitations in conventional plant electrophysiological recording techniques, recorded signals are composed of signals originating from all of the cells that are connected to an electrode. This limitation does not enable detailed spatio-temporal distributions of transmission and electrical activities in plants to be visualised. Multi-electrode array (MEA) enables the recording and imaging of dynamic spatio-temporal electrical activities in higher plants. Here, we used an 8 × 8 MEA with a polar distance of 450 μm to measure electrical activities from numerous cells simultaneously. The mapping of the data that were recorded from the MEA revealed the transfer mode of the thermally induced VPs in the leaves of Helianthus annuus L. seedlings in situ. These results suggest that MEA can enable recordings with high spatio-temporal resolution that facilitate the determination of the bioelectrical response mode of higher plants under stress. PMID:24961469

  20. [Analysis of mineral elements of sunflower (Helianthus annuus L.) grown on saline land in Hetao Irrigation District by ICP-AES].

    PubMed

    Tong, Wen-Jie; Chen, Fu; Wen, Xin-Ya

    2014-01-01

    The absorption and accumulation of ten mineral elements in four kinds of organs (root, steam, leaf and flower disc) in Helianthus annuus L. plants cultured in Hetao Irrigation District under different level of salinity stress were determined by ICP-AES with wet digestion (HNO3 + HClO4). The results showed that: (1) The contents of Fe, Mn, Zn, Ca, and Na were highest in roots, so was K in stems, B and Mg in leaves and P in flower discs, while no significant difference was detected in the content of Cu among these organs; (2) The cumulants of Ca, Mg, P, Cu, B and Zn were highest in flower discs, so were Na, Fe and Mn in roots and K in stems; (3) In sunflower plants, the proportion of mineral element cumulant for K : Ca : Mg : P : Na was 16.71 : 5.23 : 3.86 : 1.23 : 1.00, and for Zn : Fe : B : Mn: Cu was 56.28 : 27.75 : 1.93 : 1.17 : 1.00, respectively; (4) The effect of salinity stress on absorption of mineral elements differed according to the kind of organ and element, root was the most sensitive to soil salt content, followed by stem and leaf, and the effect on flower disc seemed complex. PMID:24783567

  1. Comparison of MP AES and ICP-MS for analysis of principal and selected trace elements in nitric acid digests of sunflower (Helianthus annuus).

    PubMed

    Karlsson, Stefan; Sjöberg, Viktor; Ogar, Anna

    2015-04-01

    The use of nitrogen as plasma gas for microwave plasma atomic emission spectroscopy (MP AES) is an interesting development in analytical science since the running cost can be significantly reduced in comparison to the inductively coupled argon plasma. Here, we evaluate the performance of the Agilent 4100 MP AES instrument for the analysis of principal metals (Ca, K, Mg, and Na), lithogenic metals (Al, Fe, and Mn) and selected trace metals (As, Ba, Cd, Co, Cr, Cu, Mo, Ni, Pb, V, and Zn) in nitric acid plant digests. The digests were prepared by microwave-assisted dissolution of dry plant material from sunflower (Helianthus annuus) in concentrated nitric acid. Comparisons are made with analysis of the same solutions with ICP-MS (Agilent 7500cx) using the octopole reaction system (ORS) in the collision mode for As, Fe, and V. The limits of detection were usually in the low µg L(-1) range and all principal and lithogenic metals were successfully determined with the MP AES and provided almost identical results with the ICP-MS. The same applies for the selected trace metals except for As, Co and Mo where the concentrations were below the detection limit with the MP AES. For successful analysis we recommend that (i) only atom lines are used, (ii) ionization is minimized (e.g. addition of CsNO3) and (iii) the use of internal standards should be considered to resolve spectral interferences.

  2. The effects of air flow and stem flexure on the mechanical and hydraulic properties of the stems of sunflowers Helianthus annuus L.

    PubMed

    Smith, V C; Ennos, A R

    2003-02-01

    Many studies have shown that wind affects plant development, causing them to develop shorter and usually stronger stems. Many of these effects have been shown to be due to a response to mechanical flexing of the stem which is known as thigmomorphogenesis. However, it is not known how wind affects the hydraulic properties of stems, nor have the effects of air flow past leaves been examined in isolation from mechanical flexing. This study, therefore, used a factorial experiment to distinguish between the effects of stem flexing and air flow, and examined the morphology, hydraulics and mechanics of developing sunflowers Helianthus annuus. It was found that flexure and air flow had opposite effects on several aspects of development; air flow increased plant height and length-specific stem hydraulic conductivity, k(h), and reduced stem rigidity and strength, while flexing did the reverse. There was also a clear trade-off between hydraulic and mechanical capability: as one increased the other decreased. A plant's response to wind must, therefore, be a complex response to at least two different stimuli and this might help explain why it varies with species and environment.

  3. Effects of an acute dose of gamma radiation exposure on stem diameter growth, carbon gain, and biomass partitioning in Helianthus annuus

    SciTech Connect

    Thiede, M.E.

    1988-05-25

    Nineteen-day-old dwarf sunflower plants (Helianthus annuus, variety NK894) received a variable dose (0-40 Gy) from a cobalt-60 gamma source. A very sensitive stem monitoring device, developed at Battelle's Pacific Northwest Laboratories, Richland, Washington was used to measure real-time changes in stem diameter. Exposure of plants caused a significant reduction in stem growth and root biomass. Doses as low as 5 Gy resulted in a significant increase in leaf density, suggesting that nonreversible morphological growth changes could be induced by very low doses of radiation. Carbohydrate analysis of 40-Gy irradiated plants demonstrated significantly more starch content in leaves and significantly less starch content in stems 18 days after exposure than did control plants. In contrast, the carbohydrate content in roots of 40-Gy irradiated plants were not significantly different from unirradiated plants 18 days after exposure. These results indicate that radiation either decreased phloem transport or reduced the availability of sugar reducing enzymes in irradiated plants. 44 refs., 12 figs.

  4. Comparative study of SOS2 and a novel PMP3-1 gene expression in two sunflower (Helianthus annuus L.) lines differing in salt tolerance.

    PubMed

    Saadia, Mubshara; Jamil, Amer; Ashraf, Muhammad; Akram, Nudrat Aisha

    2013-06-01

    Gene expression pattern of two important regulatory proteins, salt overly sensitive 2 (SOS2) and plasma membrane protein 3-1 (PMP3-1), involved in ion homeostasis, was analyzed in two salinity-contrasting sunflower (Helianthus annuus L.) lines, Hysun-38 (salt tolerant) and S-278 (moderately salt tolerant). The pattern was studied at selected time intervals (24 h) under 150 mM NaCl treatment. Using reverse transcription PCR, SOS2 gene fragment was obtained from young leaf and root tissues of opposing lines while that for PMP3-1 was obtained only from young root tissues. Both tolerant and moderately tolerant lines showed a gradual increase in SOS2 expression in sunflower root tissues. Leaf tissues showed the gradually increasing pattern of SOS2 expression in tolerant plants as compared to that for moderately tolerant ones that showed a relatively lower level of expression for this gene. We found the highest level of PMP 3-1 expression in the roots of tolerant sunflower line at 6 and 12 h postsalinity treatment. The moderately tolerant line showed higher expression of PMP3-1 at 12 and 24 h after salt treatment. Overall, the expression of genes for both the regulator proteins varied significantly in the two sunflower lines differing in salinity tolerance.

  5. Influence of drought acclimation and CO sub 2 enrichment on osmotic adjustment and chlorophyll a fluorescence of sunflower during drought. [Helianthus annuus var Hyson 30

    SciTech Connect

    Conroy, J.P.; Virgona, J.M.; Smillie, R.M.; Barlow, E.W. Commonwealth Scientific and Industrial Research Organization, North Ryde )

    1988-04-01

    Osmotic adjustment occurred during drought in expanded leaves of sunflowers (Helianthus annuus var Hysun 30) which had been continuously exposed to 660 microliters CO{sub 2} per liter or had been previously acclimated to drought. The effect was greatest when the treatments were combined and was negligible in nonacclimated plants grown at 340 microliters CO{sub 2} per liter. The concentrations of ethanol soluble sugars and potassium increased during drought but they did not account for the osmotic adjustment. The delay in the decline in conductance and relative water content and in the loss of structural integrity with increasing drought was dependent on the degree of osmotic adjustment. The relative water content remained constant at 85% for three days and fell to 36% on the sixth day. There was no evidence of leaf desiccation even on the eighth day. In contrast, the conductance of leaves showing minimal adjustment fell rapidly after the first day of drought and was negligible after the fourth, at which time the relative water content was 36%. By the sixth day of drought, areas near the margins of the leaves were desiccating and the plants did not recover upon rewatering. Despite the differences in the rate of change of conductance and relative water content during drought, photosynthetic electron transport activity, remained functional until desiccation occurred.

  6. Inoculating Helianthus annuus (sunflower) grown in zinc and cadmium contaminated soils with plant growth promoting bacteria--effects on phytoremediation strategies.

    PubMed

    Marques, Ana P G C; Moreira, Helena; Franco, Albina R; Rangel, António O S S; Castro, Paula M L

    2013-06-01

    Plant growth promoting bacteria (PGPR) may help reducing the toxicity of heavy metals to plants in polluted environments. In this work the effects of inoculating metal resistant and plant growth promoting bacterial strains on the growth of Helianthus annuus grown in Zn and Cd spiked soils were assessed. The PGPR strains Ralstonia eutropha (B1) and Chrysiobacterium humi (B2) reduced losses of weight in metal exposed plants and induced changes in metal bioaccumulation and bioconcentration - with strain B2 decreasing up to 67% Zn accumulation and by 20% Zn bioconcentration factor (BCF) in the shoots, up to 64% Zn uptake and 38% Zn BCF in the roots, and up to 27% Cd uptake and 27% Cd BCF in plant roots. The impact of inoculation on the bacterial communities in the rhizosphere of the plant was also assessed. Bacterial community diversity decreased with increasing levels of metal contamination in the soil, but in rhizosphere soil of plants inoculated with the PGPR strains, a higher bacterial diversity was kept throughout the experimental period. Inoculation of sunflower, particularly with C. humi (B2), appears to be an effective way of enhancing the short term stabilization potential of the plant in metal contaminated land, lowering losses in plant biomass and decreasing aboveground tissue contamination.

  7. Spatio-temporal mapping of variation potentials in leaves of Helianthus annuus L. seedlings in situ using multi-electrode array.

    PubMed

    Zhao, Dong-Jie; Wang, Zhong-Yi; Huang, Lan; Jia, Yong-Peng; Leng, John Q

    2014-06-25

    Damaging thermal stimuli trigger long-lasting variation potentials (VPs) in higher plants. Owing to limitations in conventional plant electrophysiological recording techniques, recorded signals are composed of signals originating from all of the cells that are connected to an electrode. This limitation does not enable detailed spatio-temporal distributions of transmission and electrical activities in plants to be visualised. Multi-electrode array (MEA) enables the recording and imaging of dynamic spatio-temporal electrical activities in higher plants. Here, we used an 8 × 8 MEA with a polar distance of 450 μm to measure electrical activities from numerous cells simultaneously. The mapping of the data that were recorded from the MEA revealed the transfer mode of the thermally induced VPs in the leaves of Helianthus annuus L. seedlings in situ. These results suggest that MEA can enable recordings with high spatio-temporal resolution that facilitate the determination of the bioelectrical response mode of higher plants under stress.

  8. Induction of a photomixotrophic plant cell culture of Helianthus annuus and optimization of culture conditions for improved α-tocopherol production.

    PubMed

    Geipel, Katja; Song, Xue; Socher, Maria Lisa; Kümmritz, Sibylle; Püschel, Joachim; Bley, Thomas; Ludwig-Müller, Jutta; Steingroewer, Juliane

    2014-03-01

    Tocopherols, collectively known as vitamin E, are lipophilic antioxidants, which are synthesized only by photosynthetic organisms. Due to their enormous potential to protect cells from oxidative damage, tocopherols are used, e.g., as nutraceuticals and additives in pharmaceuticals. The most biologically active form of vitamin E is α-tocopherol. Most tocopherols are currently produced via chemical synthesis. Nevertheless, this always results in a racemic mixture of different and less effective stereoisomers because the natural isomer has the highest biological activity. Therefore, tocopherols synthesized in natural sources are preferred for medical purposes. The annual sunflower (Helianthus annuus L.) is a well-known source for α-tocopherol. Within the presented work, sunflower callus and suspension cultures were established growing under photomixotrophic conditions to enhance α-tocopherol yield. The most efficient callus induction was achieved with sunflower stems cultivated on solid Murashige and Skoog medium supplemented with 30 g l(-1) sucrose, 0.5 mg l(-1) of the auxin 1-naphthalene acetic acid, and 0.5 mg l(-1) of the cytokinin 6-benzylaminopurine. Photomixotrophic sunflower suspension cultures were induced by transferring previously established callus into liquid medium. The effects of light intensity, sugar concentration, and culture age on growth rate and α-tocopherol synthesis rate were characterized. A considerable increase (max. 230%) of α-tocopherol production in the cells was obtained within the photomixotrophic cell culture compared to a heterotrophic cell culture. These results will be useful for improving α-tocopherol yields of plant in vitro cultures.

  9. Effects of untreated and treated oilfield-produced water on seed germination, seedling development, and biomass production of sunflower (Helianthus annuus L.).

    PubMed

    da Costa Marques, Mônica Regina; de Souza, Paulo Sérgio Alves; Rigo, Michelle Machado; Cerqueira, Alexandre Andrade; de Paiva, Julieta L; Merçon, Fábio; Perez, Daniel Vidal

    2015-10-01

    This study aims to evaluate possible toxic effects of oil and other contaminants from oilfield-produced water from oil exploration and production, on seed germination, and seedling development of sunflower (Helianthus annuus L.). In comparison, as treated by electroflocculation, oilfield-produced water, with lower oil and organic matter content, was also used. Electroflocculation treatment of oilfield-produced water achieved significant removals of chemical oxygen demand (COD) (94 %), oil and grease (O&G) (96 %), color (97 %), and turbidity (99 %). Different O&G, COD, and salt levels of untreated and treated oilfield-produced water did not influence germination process and seedling biomass production. Normal seedlings percentage and vigor tended to decrease more intensely in O&G and COD levels, higher than 337.5 mg L(-1) and 1321 mg O2 L(-1), respectively, using untreated oilfield-produced water. These results indicate that this industrial effluent must be treated, in order to not affect adversely seedling development. This way, electroflocculation treatment appears as an interesting alternative to removing oil and soluble organic matter in excess from oilfield-produced water improving sunflower's seedling development and providing a friendly environmental destination for this wastewater, reducing its potential to harm water resources, soil, and biota.

  10. The effect of subambient to elevated atmospheric CO₂ concentration on vascular function in Helianthus annuus: implications for plant response to climate change.

    PubMed

    Rico, Christopher; Pittermann, Jarmila; Polley, H Wayne; Aspinwall, Michael J; Fay, Phillip A

    2013-09-01

    Plant gas exchange is regulated by stomata, which coordinate leaf-level water loss with xylem transport. Stomatal opening responds to internal concentrations of CO₂ in the leaf, but changing CO₂ can also lead to changes in stomatal density that influence transpiration. Given that stomatal conductance increases under subambient concentrations of CO₂ and, conversely, that plants lose less water at elevated concentrations, can downstream effects of atmospheric CO₂ be observed in xylem tissue? We approached this problem by evaluating leaf stomatal density, xylem transport, xylem anatomy and resistance to cavitation in Helianthus annuus plants grown under three CO₂ regimes ranging from pre-industrial to elevated concentrations. Xylem transport, conduit size and stomatal density all increased at 290 ppm relative to ambient and elevated CO₂ concentrations. The shoots of the 290-ppm-grown plants were most vulnerable to cavitation, whereas xylem cavitation resistance did not differ in 390- and 480-ppm-grown plants. Our data indicate that, even as an indirect driver of water loss, CO₂ can affect xylem structure and water transport by coupling stomatal and xylem hydraulic functions during plant development. This plastic response has implications for plant water use under variable concentrations of CO₂, as well as the evolution of efficient xylem transport.

  11. Greenhouse gas emissions and plant characteristics from soil cultivated with sunflower (Helianthus annuus L.) and amended with organic or inorganic fertilizers.

    PubMed

    López-Valdez, F; Fernández-Luqueño, F; Luna-Suárez, S; Dendooven, L

    2011-12-15

    Agricultural application of wastewater sludge has become the most widespread method of disposal, but the environmental effects on soil, air, and crops must be considered. The effect of wastewater sludge or urea on sunflower's (Helianthus annuus L.) growth and yield, the soil properties, and the resulting CO(2) and N(2)O emissions are still unknown. The objectives of this study were to investigate: i) the effect on soil properties of organic or inorganic fertilizer added to agricultural soil cultivated with sunflower, ii) how urea or wastewater sludge increases CO(2) and N(2)O emissions from agricultural soil over short time periods, and iii) the effect on plant characteristics and yield of urea or wastewater sludge added to agricultural soil cultivated with sunflower. The sunflower was fertilized with wastewater sludge or urea or grown in unamended soil under greenhouse conditions while plant and soil characteristics, yield, and greenhouse gas emissions were monitored. Sludge and urea modified some soil characteristics at the onset of the experiment and during the first two months but not thereafter. Some plant characteristics were improved by sludge. Urea and sludge treatments increased the yield at similar rates, while sludge-amended soil significantly increased N(2)O emissions but not CO(2) emissions compared to the other amended or unamended soils. This implies that wastewater sludge increased the biomass and/or the yield; however, from a holistic point of view, using wastewater sludge as fertilizer should be viewed with concern. PMID:22033361

  12. Greenhouse gas emissions and plant characteristics from soil cultivated with sunflower (Helianthus annuus L.) and amended with organic or inorganic fertilizers.

    PubMed

    López-Valdez, F; Fernández-Luqueño, F; Luna-Suárez, S; Dendooven, L

    2011-12-15

    Agricultural application of wastewater sludge has become the most widespread method of disposal, but the environmental effects on soil, air, and crops must be considered. The effect of wastewater sludge or urea on sunflower's (Helianthus annuus L.) growth and yield, the soil properties, and the resulting CO(2) and N(2)O emissions are still unknown. The objectives of this study were to investigate: i) the effect on soil properties of organic or inorganic fertilizer added to agricultural soil cultivated with sunflower, ii) how urea or wastewater sludge increases CO(2) and N(2)O emissions from agricultural soil over short time periods, and iii) the effect on plant characteristics and yield of urea or wastewater sludge added to agricultural soil cultivated with sunflower. The sunflower was fertilized with wastewater sludge or urea or grown in unamended soil under greenhouse conditions while plant and soil characteristics, yield, and greenhouse gas emissions were monitored. Sludge and urea modified some soil characteristics at the onset of the experiment and during the first two months but not thereafter. Some plant characteristics were improved by sludge. Urea and sludge treatments increased the yield at similar rates, while sludge-amended soil significantly increased N(2)O emissions but not CO(2) emissions compared to the other amended or unamended soils. This implies that wastewater sludge increased the biomass and/or the yield; however, from a holistic point of view, using wastewater sludge as fertilizer should be viewed with concern.

  13. Effects of untreated and treated oilfield-produced water on seed germination, seedling development, and biomass production of sunflower (Helianthus annuus L.).

    PubMed

    da Costa Marques, Mônica Regina; de Souza, Paulo Sérgio Alves; Rigo, Michelle Machado; Cerqueira, Alexandre Andrade; de Paiva, Julieta L; Merçon, Fábio; Perez, Daniel Vidal

    2015-10-01

    This study aims to evaluate possible toxic effects of oil and other contaminants from oilfield-produced water from oil exploration and production, on seed germination, and seedling development of sunflower (Helianthus annuus L.). In comparison, as treated by electroflocculation, oilfield-produced water, with lower oil and organic matter content, was also used. Electroflocculation treatment of oilfield-produced water achieved significant removals of chemical oxygen demand (COD) (94 %), oil and grease (O&G) (96 %), color (97 %), and turbidity (99 %). Different O&G, COD, and salt levels of untreated and treated oilfield-produced water did not influence germination process and seedling biomass production. Normal seedlings percentage and vigor tended to decrease more intensely in O&G and COD levels, higher than 337.5 mg L(-1) and 1321 mg O2 L(-1), respectively, using untreated oilfield-produced water. These results indicate that this industrial effluent must be treated, in order to not affect adversely seedling development. This way, electroflocculation treatment appears as an interesting alternative to removing oil and soluble organic matter in excess from oilfield-produced water improving sunflower's seedling development and providing a friendly environmental destination for this wastewater, reducing its potential to harm water resources, soil, and biota. PMID:26059762

  14. A New Method for in-situ Monitoring of the Underground Development of Orobanche cumana in Sunflower (Helianthus annuus) with a Mini-rhizotron

    PubMed Central

    EIZENBERG, H.; SHTIENBERG, D.; SILBERBUSH, M.; EPHRATH, J. E.

    2005-01-01

    • Aims To develop an in-situ, non-destructive method for observation and monitoring of the underground developmental stages of the root parasite Orobanche cumana. • Scope The parasitic weed Orobanche causes severe damage to vegetables and field crops. Most of the damage caused to the crops occurs during the underground, unobservable parasitism stage. Sunflower (Helianthus annuus ‘Adi’) plants were planted in soil that was artificially inoculated with O. cumana seeds. Clear Plexiglas mini-rhizotron plastic observation tubes were inserted into the soil. Seed germination, early stage of penetration, and formation of tubercles and spikes were observed non-destructively and were monitored throughout the growing season by mean of a mini-rhizotron camera. Use of this technology enabled the complete individual parasite life cycle from the very early development (including germination) to Orobanche shoot to be monitored. In addition, the effect of the systemic herbicide Cadre (imazapic) on the development of O. cumana was inspected and quantified. • Conclusions This novel methodology facilitates the in-situ study of major aspects of the host–parasite interaction and of parasite suppression, such as parasitism dynamics, parasite growth rate, and the effect of chemical treatments on the parasite. PMID:16157627

  15. [Analysis of mineral elements of sunflower (Helianthus annuus L.) grown on saline land in Hetao Irrigation District by ICP-AES].

    PubMed

    Tong, Wen-Jie; Chen, Fu; Wen, Xin-Ya

    2014-01-01

    The absorption and accumulation of ten mineral elements in four kinds of organs (root, steam, leaf and flower disc) in Helianthus annuus L. plants cultured in Hetao Irrigation District under different level of salinity stress were determined by ICP-AES with wet digestion (HNO3 + HClO4). The results showed that: (1) The contents of Fe, Mn, Zn, Ca, and Na were highest in roots, so was K in stems, B and Mg in leaves and P in flower discs, while no significant difference was detected in the content of Cu among these organs; (2) The cumulants of Ca, Mg, P, Cu, B and Zn were highest in flower discs, so were Na, Fe and Mn in roots and K in stems; (3) In sunflower plants, the proportion of mineral element cumulant for K : Ca : Mg : P : Na was 16.71 : 5.23 : 3.86 : 1.23 : 1.00, and for Zn : Fe : B : Mn: Cu was 56.28 : 27.75 : 1.93 : 1.17 : 1.00, respectively; (4) The effect of salinity stress on absorption of mineral elements differed according to the kind of organ and element, root was the most sensitive to soil salt content, followed by stem and leaf, and the effect on flower disc seemed complex.

  16. The sources of carbon and reducing power for fatty acid synthesis in the heterotrophic plastids of developing sunflower (Helianthus annuus L.) embryos.

    PubMed

    Pleite, Rafael; Pike, Marilyn J; Garcés, Rafael; Martínez-Force, Enrique; Rawsthorne, Stephen

    2005-05-01

    The provision of carbon substrates and reducing power for fatty acid synthesis in the heterotrophic plastids of developing embryos of sunflower (Helianthus annuus L.) has been investigated. Profiles of oil and storage protein accumulation were determined and embryos at 17 and 24 days after anthesis (DAA) were selected to represent early and late periods of oil accumulation. Plastids isolated from either 17 or 24 DAA embryos did not incorporate label from [1-(14)C]glucose 6-phosphate (Glc6P) into fatty acids. Malate, when supplied alone, supported the highest rates of fatty acid synthesis by the isolated plastids at both stages. Pyruvate supported rates of fatty acid synthesis at 17 DAA that were comparable to those supported by malate, but only when incubations also included Glc6P. The stimulatory effect of Glc6P on pyruvate utilization at 17 DAA was related to the rapid utilization of Glc6P through the oxidative pentose phosphate pathway (OPPP) at this stage. Addition of pyruvate to incubations containing [1-(14)C]Glc6P increased OPPP activity (measured as (14)CO(2) release), while the addition of malate suppressed it. Observations of the interactions between the rate of metabolite utilization for fatty acid synthesis and the rate of the OPPP are consistent with regulation of the OPPP by redox control of the plastidial glucose 6-phosphate dehydrogenase activity through the demand for NADPH. During pyruvate utilization for fatty acid synthesis, flux through the OPPP increases as NADPH is consumed, whereas during malate utilization, in which NADPH is produced by NADP-malic enzyme, flux through the OPPP is decreased.

  17. cDNA cloning, expression levels and gene mapping of photosynthetic and non-photosynthetic ferredoxin genes in sunflower (Helianthus annuus L.).

    PubMed

    Venegas-Calerón, M; Zambelli, A; Ruiz-López, N; Youssar, L; León, A; Garcés, R; Martínez-Force, Enrique

    2009-03-01

    Fatty acid desaturation in plastids and chloroplasts depends on the electron-donor activity of ferredoxins. Using degenerate oligonucleotides designed from known photosynthetic and heterotrophic plant ferredoxin sequences, two full-length ferredoxin cDNAs were cloned from sunflower (Helianthus annuus L.) leaves and developing seeds, HaFd1 and HaFd2, homologous to photosynthetic and non-photosynthetic ferredoxins, respectively. Based on these cDNAs, the respective genomic sequences were obtained and the presence of DNA polymorphisms was investigated. Complete sequencing of the HaFd1 and HaFd2 genes in different lines indicated the presence of two haplotypes for HaFd2 and their alignment showed that sequence polymorphisms are restricted to the 5'-NTR intron. In addition, specific DNA markers for the HaFd1 and HaFd2 genes were developed that enabled the genes to be mapped. Accordingly, the HaFd1 locus maps to linkage group 10 of the public sunflower map, while the HaFd2 locus maps to linkage group 11. Both ferredoxins display different spatial-temporal patterns of expression. While HaFd2 is expressed at similar levels in all tissues tested (leaves, stem, roots, cotyledons and developing seeds), HaFd1 is more strongly expressed in green tissues than in all the other tissues tested. Both photosynthetic- and heterotrophic-ferredoxins are present in sunflower seeds and may contribute to fatty acid desaturation during oil accumulation. Nevertheless, the levels of HaFd2 expression during seed formation are distinct in lines that only varied in the HaFd2 haplotypes they expressed.

  18. A GRAS-like gene of sunflower (Helianthus annuus L.) alters the gibberellin content and axillary meristem outgrowth in transgenic Arabidopsis plants.

    PubMed

    Fambrini, M; Mariotti, L; Parlanti, S; Salvini, M; Pugliesi, C

    2015-11-01

    The GRAS proteins belong to a plant transcriptional regulator family that function in the regulation of plant growth and development. Despite their important roles, in sunflower only one GRAS gene (HaDella1) with the DELLA domain has been reported. Here, we provide a functional characterisation of a GRAS-like gene from Helianthus annuus (Ha-GRASL) lacking the DELLA motif. The Ha-GRASL gene contains an intronless open reading frame of 1,743 bp encoding 580 amino acids. Conserved motifs in the GRAS domain are detected, including VHIID, PFYRE, SAW and two LHR motifs. Within the VHII motif, the P-H-N-D-Q-L residues are entirely maintained. Phylogenetic analysis reveals that Ha-GRASL belongs to the SCARECROW LIKE4/7 (SCL4/7) subfamily of the GRAS consensus tree. Accumulation of Ha-GRASL mRNA at the adaxial boundaries from P6/P7 leaf primordia suggests a role of Ha-GRASL in the initiation of median and basal axillary meristems (AMs) of sunflower. When Ha-GRASL is over-expressed in Arabidopsis wild-type plants, the number of lateral bolts increases differently from untransformed plants. However, Ha-GRASL slightly affects the lateral suppressor (las-4-) mutation. Therefore, we hypothesise that Ha-GRASL and LAS are not functionally equivalent. The over-expression of Ha-GRASL reduces metabolic flow of gibberellins (GAs) in Arabidopsis and this modification could be relevant in AM development. Phylogenetic analysis includes LAS and SCL4/7 in the same major clade, suggesting a more recent separation of these genes with respect to other GRAS members. We propose that some features of their ancestor, as well as AM initiation and outgrowth, are partially retained in both LAS and SCL4/7.

  19. Identification and characterization of two bisabolene synthases from linear glandular trichomes of sunflower (Helianthus annuus L., Asteraceae).

    PubMed

    Aschenbrenner, Anna-Katharina; Kwon, Moonhyuk; Conrad, Jürgen; Ro, Dae-Kyun; Spring, Otmar

    2016-04-01

    Sunflower is known to produce a variety of bisabolene-type sesquiterpenes and accumulates these substances in trichomes of leaves, stems and flowering parts. A bioinformatics approach was used to identify the enzyme responsible for the initial step in the biosynthesis of these compounds from its precursor farnesyl pyrophosphate. Based on sequence similarity with a known bisabolene synthases from Arabidopsis thaliana AtTPS12, candidate genes of Helianthus were searched in EST-database and used to design specific primers. PCR experiments identified two candidates in the RNA pool of linear glandular trichomes of sunflower. Their sequences contained the typical motifs of sesquiterpene synthases and their expression in yeast functionally characterized them as bisabolene synthases. Spectroscopic analysis identified the stereochemistry of the product of both enzymes as (Z)-γ-bisabolene. The origin of the two sunflower bisabolene synthase genes from the transcripts of linear trichomes indicates that they may be involved in the synthesis of sesquiterpenes produced in these trichomes. Comparison of the amino acid sequences of the sunflower bisabolene synthases showed high similarity with sesquiterpene synthases from other Asteracean species and indicated putative evolutionary origin from a β-farnesene synthase. PMID:26880289

  20. Identification and characterization of two bisabolene synthases from linear glandular trichomes of sunflower (Helianthus annuus L., Asteraceae).

    PubMed

    Aschenbrenner, Anna-Katharina; Kwon, Moonhyuk; Conrad, Jürgen; Ro, Dae-Kyun; Spring, Otmar

    2016-04-01

    Sunflower is known to produce a variety of bisabolene-type sesquiterpenes and accumulates these substances in trichomes of leaves, stems and flowering parts. A bioinformatics approach was used to identify the enzyme responsible for the initial step in the biosynthesis of these compounds from its precursor farnesyl pyrophosphate. Based on sequence similarity with a known bisabolene synthases from Arabidopsis thaliana AtTPS12, candidate genes of Helianthus were searched in EST-database and used to design specific primers. PCR experiments identified two candidates in the RNA pool of linear glandular trichomes of sunflower. Their sequences contained the typical motifs of sesquiterpene synthases and their expression in yeast functionally characterized them as bisabolene synthases. Spectroscopic analysis identified the stereochemistry of the product of both enzymes as (Z)-γ-bisabolene. The origin of the two sunflower bisabolene synthase genes from the transcripts of linear trichomes indicates that they may be involved in the synthesis of sesquiterpenes produced in these trichomes. Comparison of the amino acid sequences of the sunflower bisabolene synthases showed high similarity with sesquiterpene synthases from other Asteracean species and indicated putative evolutionary origin from a β-farnesene synthase.

  1. Genetics and mapping of the R₁₁ gene conferring resistance to recently emerged rust races, tightly linked to male fertility restoration, in sunflower (Helianthus annuus L.).

    PubMed

    Qi, L L; Seiler, G J; Vick, B A; Gulya, T J

    2012-09-01

    Sunflower oil is one of the major sources of edible oil. As the second largest hybrid crop in the world, hybrid sunflowers are developed by using the PET1 cytoplasmic male sterility system that contributes to a 20 % yield advantage over the open-pollinated varieties. However, sunflower production in North America has recently been threatened by the evolution of new virulent pathotypes of sunflower rust caused by the fungus Puccinia helianthi Schwein. Rf ANN-1742, an 'HA 89' backcross restorer line derived from wild annual sunflower (Helianthus annuus L.), was identified as resistant to the newly emerged rust races. The aim of this study was to elucidate the inheritance of rust resistance and male fertility restoration and identify the chromosome location of the underlying genes in Rf ANN-1742. Chi-squared analysis of the segregation of rust response and male fertility in F(2) and F(3) populations revealed that both traits are controlled by single dominant genes, and that the rust resistance gene is closely linked to the restorer gene in the coupling phase. The two genes were designated as R ( 11 ) and Rf5, respectively. A set of 723 mapped SSR markers of sunflower was used to screen the polymorphism between HA 89 and the resistant plant. Bulked segregant analysis subsequently located R ( 11 ) on linkage group (LG) 13 of sunflower. Based on the SSR analyses of 192 F(2) individuals, R ( 11 ) and Rf5 both mapped to the lower end of LG13 at a genetic distance of 1.6 cM, and shared a common marker, ORS728, which was mapped 1.3 cM proximal to Rf5 and 0.3 cM distal to R ( 11 ) (Rf5/ORS728/R ( 11 )). Two additional SSRs were linked to Rf5 and R ( 11 ): ORS995 was 4.5 cM distal to Rf5 and ORS45 was 1.0 cM proximal to R ( 11 ). The advantage of such an introduced alien segment harboring two genes is its large phenotypic effect and simple inheritance, thereby facilitating their rapid deployment in sunflower breeding programs. Suppressed recombination was observed in LGs 2, 9

  2. Uncoupling light quality from light irradiance effects in Helianthus annuus shoots: putative roles for plant hormones in leaf and internode growth.

    PubMed

    Kurepin, Leonid V; Emery, R J Neil; Pharis, Richard P; Reid, David M

    2007-01-01

    An attempt has been made to uncouple the effects of the two primary components of shade light, a reduced red to far-red (R/FR) ratio and low photosynthetically active radiation (PAR), on the elongation of the youngest internode of sunflower (Helianthus annuus) seedlings. Maximal internode growth (length and biomass) was induced by a shade light having a reduced R/FR ratio (0.85) under the low PAR of 157 micromol m(-2) s(-1). Reducing the R/FR ratio under normal PAR (421 micromol m(-2) s(-1)) gave similar growth trends, albeit with a reduced magnitude of the response. Leaf area growth showed a rather different pattern, with maximal growth occurring at the higher (normal) PAR of 421 micromol m(-2) s(-1)), but with variable effects being seen with changes in light quality. Reducing the R/FR ratio (by enrichment with FR) gave significant increases in gibberellin A(1) (GA(1)) and indole-3-acetic acid (IAA) contents in both internodes and leaves. By contrast, a lower PAR irradiance had no significant effect on GA(1) and IAA levels in internodes or leaves, but did increase the levels of other GAs, including two precursors of GA(1). Interestingly, both leaf and internode hormone content (GAs, IAA) are positively and significantly correlated with growth of the internode, as are leaf levels of abscisic acid (ABA). However, changes in these three hormones bear little relationship to leaf growth. By implication, then, the leaf may be the major source of GAs and IAA, at least, for the rapidly elongating internode. Several other hormones were also assessed in leaves for plants grown under varying R/FR ratios and PARs. Leaf ethylene production was not influenced by changes in R/FR ratio, but was significantly reduced under the normal (higher) PAR, the irradiance treatment which increased leaf growth. Levels of the growth-active free base and riboside cytokinins were significantly increased in leaves under a reduced R/FR ratio, but only at the higher (normal) PAR irradiance; other

  3. Supplemental macronutrients and microbial fermentation products improve the uptake and transport of foliar applied zinc in sunflower (Helianthus annuus L.) plants. Studies utilizing micro X-ray florescence

    SciTech Connect

    Tian, Shengke; Lu, Lingli; Xie, Ruohan; Zhang, Minzhe; Jernstedt, Judith A.; Hou, Dandi; Ramsier, Cliff; Brown, Patrick H.

    2015-01-21

    Enhancing nutrient uptake and the subsequent elemental transport from the sites of application to sites of utilization is of great importance to the science and practical field application of foliar fertilizers. The aim of this study was to investigate the mobility of various foliar applied zinc (Zn) formulations in sunflower (Helianthus annuus L.) and to evaluate the effects of the addition of an organic biostimulant on phloem loading and elemental mobility. This was achieved by application of foliar formulations to the blade of sunflower (H. annuus L.) and high-resolution elemental imaging with micro X-ray fluorescence (μ-XRF) to visualize Zn within the vascular system of the leaf petiole. Although no significant increase of total Zn in petioles was determined by inductively-coupled plasma mass-spectrometer, μ-XRF elemental imaging showed a clear enrichment of Zn in the vascular tissues within the sunflower petioles treated with foliar fertilizers containing Zn. The concentration of Zn in the vascular of sunflower petioles was increased when Zn was applied with other microelements with EDTA (commercial product Kick-Off) as compared with an equimolar concentration of ZnSO₄ alone. The addition of macronutrients N, P, K (commercial product CleanStart) to the Kick-Off Zn fertilizer, further increased vascular system Zn concentrations while the addition of the microbially derived organic biostimulant “GroZyme” resulted in a remarkable enhancement of Zn concentrations in the petiole vascular system. The study provides direct visualized evidence for phloem transport of foliar applied Zn out of sites of application in plants by using μ-XRF technique, and suggests that the formulation of the foliar applied Zn and the addition of the organic biostimulant GroZyme increases the mobility of Zn following its absorption by the leaf of sunflower.

  4. [Agrobacterium-mediated sunflower transformation (Helianthus annuus L.) in vitro and in Planta using strain of LBA4404 harboring binary vector pBi2E with dsRNA-suppressor proline dehydrogenase gene].

    PubMed

    Tishchenko, E N; Komisarenko, A G; Mikhal'skaia, S I; Sergeeva, L E; Adamenko, N I; Morgun, B V; Kochetov, A V

    2014-01-01

    To estimate the efficiency of proline dehydrogenase gene suppression towards increasing of sunflower (Helianthus annuus L.) tolerance level to water deficit and salinity, we employed strain LBA4404 harboring pBi2E with double-stranded RNA-suppressor, which were prepared on basis arabidopsis ProDH1 gene. The techniques of Agrobacterium-mediated transformation in vitro and in planta during fertilization sunflower have been proposed. There was shown the genotype-depended integration of T-DNA in sunflower genome. PCR-analysis showed that ProDH1 presents in genome of inbred lines transformed in planta, as well as in T1- and T2-generations. In trans-genic regenerants the essential accumulation of free L-proline during early stages of in vitro cultivation under normal conditions was shown. There was established the essential accumulation of free proline in transgenic regenerants during cultivation under lethal stress pressure (0.4 M mannitol and 2.0% sea water salts) and its decline upon the recovery period. These data are declared about effectiveness of suppression of sunflower ProDH and gene participation in processes connected with osmotolerance.

  5. Influence of Boron Nutrition on Net Uptake and Efflux of (32)P and (14)C-Glucose in Helianthus annuus Roots and Cell Cultures of Daucus carota.

    PubMed

    Goldbach, H

    1985-04-01

    (32)P and (14)C-glucose uptake were reduced under B deficiency in both Daucus cell suspensions and Helianthus roots. Similarly, efflux rates were found to be smaller in B deficient material. Efflux rates tended to be more affected than net uptake of both (32)P and glucose. This may explain why sunflower roots showed a higher glucose net uptake immediately after transferring from a B sufficient to a B deficient nutrient solution. The data confirm earlier findings of B as an essential element for membrane function and integrity. B-deficiency effects could be reversed by the addition of B within less than one hour. Cell suspensions reacted similarly to roots with respect to B deficiency and may thus be suitable for further research on B deficiency effects.

  6. Substitution of crude cell wall for neutral detergent fibre in the equations of the Cornell Net Carbohydrate and Protein System that predict carbohydrate fractions: application to sunflower ( Helianthus annuus L.).

    PubMed

    Queiroz, M A A; Fukushima, R S; Gomide, C A; Braga, M R

    2008-07-01

    Prediction of carbohydrate fractions using equations from the Cornell Net Carbohydrate and Protein System (CNCPS) is a valuable tool to assess the nutritional value of forages. In this paper, these carbohydrate fractions were predicted using data from three sunflower (Helianthus annuus L.) cultivars, fresh or as silage. The CNCPS equations for fractions B2 and C include measurement of ash and protein-free neutral detergent fibre (NDF) as one of their components. However, NDF lacks pectin and other non-starch polysaccharides that are found in the cell wall (CW) matrix, so this work compared the use of a crude CW preparation instead of NDF in the CNCPS equations. There were no differences in the estimates of fractions B1 and C when CW replaced NDF; however, there were differences in fractions A and B2. Some of the CNCPS equations could be simplified when using CW instead of NDF. Notably, lignin could be expressed as a proportion of DM, rather than on the basis of ash and protein-free NDF, when predicting CNCPS fraction C. The CNCPS fraction B1 (starch + pectin) values were lower than pectin determined through wet chemistry. This finding, along with the results obtained by the substitution of CW for NDF in the CNCPS equations, suggests that pectin was not part of fraction B1 but present in fraction A. We suggest that pectin and other non-starch polysaccharides that are dissolved by the neutral detergent solution be allocated to a specific fraction (B2) and that another fraction (B3) be adopted for the digestible cell wall carbohydrates.

  7. Impact of wheat straw biochar addition to soil on the sorption, leaching, dissipation of the herbicide (4-chloro-2-methylphenoxy)acetic acid and the growth of sunflower (Helianthus annuus L.).

    PubMed

    Tatarková, Veronika; Hiller, Edgar; Vaculík, Marek

    2013-06-01

    Biochar addition to agricultural soils might increase the sorption of herbicides, and therefore, affect other sorption-related processes such as leaching, dissipation and toxicity for plants. In this study, the impact of wheat straw biochar on the sorption, leaching and dissipation in a soil, and toxicity for sunflower of (4-chloro-2-methylphenoxy)acetic acid (MCPA), a commonly used ionizable herbicide, was investigated. The results showed that MCPA sorption by biochar and biochar-amended soil (1.0wt% biochar) was 82 and 2.53 times higher than that by the non-amended soil, respectively. However, desorption of MCPA from biochar-amended soil was only 1.17 times lower than its desorption in non-amended soil. Biochar addition to soil reduced both MCPA leaching and dissipation. About 35% of the applied MCPA was transported through biochar-amended soil, while up to 56% was recovered in the leachates transported through non-amended soil. The half-life value of MCPA increased from 5.2d in non-amended soil to 21.5 d in biochar-amended soil. Pot experiments with sunflower (Helianthus annuus L.) grown in MCPA-free, but biochar-amended soil showed no positive effect of biochar on the growth of sunflower in comparison to the non-amended soil. However, biochar itself significantly reduced the content of photosynthetic pigments (chlorophyll a, b) in sunflower. There was no significant difference in the phytotoxic effects of MCPA on sunflowers between the biochar-amended soil and the non-amended soil. Furthermore, MCPA had no effect on the photosynthetic pigment contents in sunflower.

  8. Nongenotoxic effects and a reduction of the DXR-induced genotoxic effects of Helianthus annuus Linné (sunflower) seeds revealed by micronucleus assays in mouse bone marrow

    PubMed Central

    2014-01-01

    Background This research evaluated the genotoxicity of oil and tincture of H. annuus L. seeds using the micronucleus assay in bone marrow of mice. The interaction between these preparations and the genotoxic effects of doxorubicin (DXR) was also analysed (antigenotoxicity test). Methods Experimental groups were evaluated at 24-48 h post treatment with N-Nitroso-N-ethylurea (positive control – NEU), DXR (chemotherapeutic), NaCl (negative control), a sunflower tincture (THALS) and two sources of sunflower oils (POHALS and FOHALS). Antigenotoxic assays were carried out using the sunflower tincture and oils separately and in combination with NUE or DXR. Results For THALS, analysis of the MNPCEs showed no significant differences between treatment doses (250–2,000 mg.Kg-1) and NaCl. A significant reduction in MNPCE was observed when THALS (2,000 mg.Kg-1) was administered in combination with DXR (5 mg.Kg-1). For POHALS or FOHALS, analysis of the MNPCEs also showed no significant differences between treatment doses (250–2,000 mg.Kg-1) and NaCl. However, the combination DXR + POHALS (2,000 mg.Kg-1) or DXR + FOHALS (2,000 mg.Kg-1) not contributed to the MNPCEs reduction. Conclusions This research suggests absence of genotoxicity of THALS, dose-, time- and sex-independent, and its combination with DXR can reduce the genotoxic effects of DXR. POHALS and FOHALS also showed absence of genotoxicity, but their association with DXR showed no antigenotoxic effects. PMID:24694203

  9. Diffusible gibberellins and phototropism in Helianthus annuus.

    PubMed

    Phillips, I D

    1972-12-01

    Endogenous gibberellins were obtained in agar from the lower cut surface of upright sunflower shoot-tips. Exposure to unilateral light of the tips standing on agar, with the lower cut ends bisected by a vertical glass barrier at right angles to incident light, resulted in approximately 8 times the quantity of gibberellins moving into the agar below the shaded side than into the agar below the illuminated side. These results are similar to those reported earlier for gibberellins and geotropism in sunflower shoots, and suggest than the development of both light-and gravity-induced growth curvatures involve an asymmetry in gibberellin distribution across elongating internodes.

  10. Effect of Asymmetric Auxin Application on Helianthus Hypocotyl Curvature 1

    PubMed Central

    Migliaccio, Fernando; Rayle, David L.

    1989-01-01

    Indole-3-acetic acid was applied asymmetrically to the hypocotyls of sunflower (Helianthus annuus L.) seedlings. After 5 hours on a clinostat, auxin gradients as small as 1 to 1.3 produced substantial (more than 60 degrees) hypocotyl curvature. This result suggests the asymmetric growth underlying hypocotyl gravitropism can be explained by lateral auxin redistribution. PMID:11537460

  11. Effect of asymmetric auxin application on Helianthus hypocotyl curvature

    NASA Technical Reports Server (NTRS)

    Migliaccio, F.; Rayle, D. L.

    1989-01-01

    Indole-3-acetic acid was applied asymmetrically to the hypocotyls of sunflower (Helianthus annuus L.) seedlings. After 5 hours on a clinostat, auxin gradients as small as 1 to 1.3 produced substantial (more than 60 degrees) hypocotyl curvature. This result suggests the asymmetric growth underlying hypocotyl gravitropism can be explained by lateral auxin redistribution.

  12. [Study of Chloroplast DNA Polymorphism in the Sunflower (Helianthus L.)].

    PubMed

    Markina, N V; Usatov, A V; Logacheva, M D; Azarin, K V; Gorbachenko, C F; Kornienko, I V; Gavrilova, V A; Tihobaeva, V E

    2015-08-01

    The polymorphism of microsatellite loci of chloroplast genome in six Helianthus species and 46 lines of cultivated sunflower H. annuus (17 CMS lines and 29 Rf-lines) were studied. The differences between species are confined to four SSR loci. Within cultivated forms of the sunflower H. annuus, the polymorphism is absent. A comparative analysis was performed on sequences of the cpDNA inbred line 3629, line 398941 of the wild sunflower, and the American line HA383 H. annuus. As a result, 52 polymorphic loci represented by 27 SSR and 25 SNP were found; they can be used for genotyping of H. annuus samples, including cultural varieties: twelve polymorphic positions, of which eight are SSR and four are SNP. PMID:26601486

  13. [Study of Chloroplast DNA Polymorphism in the Sunflower (Helianthus L.)].

    PubMed

    Markina, N V; Usatov, A V; Logacheva, M D; Azarin, K V; Gorbachenko, C F; Kornienko, I V; Gavrilova, V A; Tihobaeva, V E

    2015-08-01

    The polymorphism of microsatellite loci of chloroplast genome in six Helianthus species and 46 lines of cultivated sunflower H. annuus (17 CMS lines and 29 Rf-lines) were studied. The differences between species are confined to four SSR loci. Within cultivated forms of the sunflower H. annuus, the polymorphism is absent. A comparative analysis was performed on sequences of the cpDNA inbred line 3629, line 398941 of the wild sunflower, and the American line HA383 H. annuus. As a result, 52 polymorphic loci represented by 27 SSR and 25 SNP were found; they can be used for genotyping of H. annuus samples, including cultural varieties: twelve polymorphic positions, of which eight are SSR and four are SNP.

  14. Chromosomal evolution and patterns of introgression in helianthus.

    PubMed

    Barb, Jessica G; Bowers, John E; Renaut, Sebastien; Rey, Juan I; Knapp, Steven J; Rieseberg, Loren H; Burke, John M

    2014-07-01

    Knowledge of the nature and extent of karyotypic differences between species provides insight into the evolutionary history of the genomes in question and, in the case of closely related species, the potential for genetic exchange between taxa. We constructed high-density genetic maps of the silverleaf sunflower (Helianthus argophyllus) and Algodones Dune sunflower (H. niveus ssp. tephrodes) genomes and compared them to a consensus map of cultivated sunflower (H. annuus) to identify chromosomal rearrangements between species. The genetic maps of H. argophyllus and H. niveus ssp. tephrodes included 17 linkage groups each and spanned 1337 and 1478 cM, respectively. Comparative analyses revealed greater divergence between H. annuus and H. niveus ssp. tephrodes (13 inverted segments, 18 translocated segments) than between H. annuus and H. argophyllus (10 inverted segments, 8 translocated segments), consistent with their known phylogenetic relationships. Marker order was conserved across much of the genome, with 83 and 64% of the H. argophyllus and H. niveus ssp. tephrodes genomes, respectively, being syntenic with H. annuus. Population genomic analyses between H. annuus and H. argophyllus, which are sympatric across a portion of the natural range of H. annuus, revealed significantly elevated genetic structure in rearranged portions of the genome, indicating that such rearrangements are associated with restricted gene flow between these two species.

  15. Evaluation of rare Helianthus eggertii achenes for oil concentration and fatty acid composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus L.) oil has the potential to be improved for nutritional and industrial purposes through selection and breeding. The narrow genetic base of cultivated sunflower has been broadened by the infusion of genes from wild species, resulting in a continuous improvement in agrono...

  16. Phylogenetic relationships between annual and perennial species of Helianthus: evolution of a tandem repeated DNA sequence and cytological hybridization experiments.

    PubMed

    Natali, L; Ceccarelli, M; Giordani, T; Sarri, V; Zuccolo, A; Jurman, I; Morgante, M; Cavallini, A; Cionini, P G

    2008-12-01

    The amplification and chromosomal localization of tandem repeated DNA sequences from Helianthus annuus (clone HAG004N15) and the physical organization of ribosomal DNA were studied in annual and perennial species of Helianthus. HAG004N15-related sequences, which did not show amplification in other Asteraceae except for Viguiera multiflora, were redundant in all the Helianthus species tested, but their frequency was significantly higher in perennials than in annuals. These sequences were located at the ends and intercalary regions of all chromosome pairs of annual species. A similar pattern was found in the perennials, but a metacentric pair in their complement was not labelled. Ribosomal cistrons were carried on two chromosome pairs in perennials and on three pairs in annuals except for H. annuus, where rDNA loci were on four pairs. No difference was observed between cultivated H. annuus and its wild accessions in the hybridization pattern of the HAG004N15 and ribosomal probes. These findings support the hypothesis that the separation between annual and perennial Helianthus species occurred through interspecific hybridization involving at least one different parent. However, GISH in H. annuus using genomic DNA from the perennial Helianthus giganteus as blocking DNA failed to reveal different genomic assets in annual and perennial species.

  17. Helianthus Nighttime Conductance and Transpiration Respond to Soil Water But Not Nutrient Availability1[W][OA

    PubMed Central

    Howard, Ava R.; Donovan, Lisa A.

    2007-01-01

    We investigated the response of Helianthus species nighttime conductance (gnight) and transpiration (Enight) to soil nutrient and water limitations in nine greenhouse studies. The studies primarily used wild Helianthus annuus, but also included a commercial and early domesticate of H. annuus and three additional wild species (Helianthus petiolaris Nutt., Helianthus deserticola Heiser, and Helianthus anomalus Blake). Well-watered plants of all species showed substantial gnight (0.023–0.225 mol m−2 s−1) and Enight (0.29–2.46 mmol m−2 s−1) measured as instantaneous gas exchange. Based on the potential for transpiration to increase mass flow of mobile nutrients to roots, we hypothesized that gnight and Enight would increase under limiting soil nutrients but found no evidence of responses in all six studies testing this. Based on known daytime responses to water limitation, we hypothesized that gnight and Enight would decrease when soil water availability was limited, and results from all four studies testing this supported our hypothesis. We also established that stomatal conductance at night was on average 5 times greater than cuticular conductance. Additionally, gnight and Enight varied nocturnally and across plant reproductive stages while remaining relatively constant as leaves aged. Our results further the ability to predict conditions under which nighttime water loss will be biologically significant and demonstrate that for Helianthus, gnight can be regulated. PMID:17142487

  18. Complete Mitochondrial Genome Sequence of Sunflower (Helianthus annuus L.).

    PubMed

    Grassa, Christopher J; Ebert, Daniel P; Kane, Nolan C; Rieseberg, Loren H

    2016-01-01

    This is the first complete mitochondrial genome sequence for sunflower and the first complete mitochondrial genome for any member of Asteraceae, the largest plant family, which includes over 23,000 named species. The master circle is 300,945-bp long and includes 27 protein-coding sequences, 18 tRNAs, and the 26S, 5S, and 18S rRNAs. PMID:27635002

  19. Nutation of Helianthus Annuus in a microgravity environment

    NASA Technical Reports Server (NTRS)

    Brown, A. H.

    1981-01-01

    An experiment to gather evidence to decide between the Darwinian concept of endogenously motivated nutation and the more mechanistic concept of gravity dependent nutation is described. If nutation persists in weightlessness, parameters describing the motion will be measured by recording in time lapse mode the video images of a population of seedlings that were grown at 1-g, but which will be observed at virtual zero gravity. Later, the plant images will be displayed on a video monitor in a laboratory, photographed on 16 millimeter film, and analyzed frame by frame to determine the kinetics of nutation for each specimen tested.

  20. Complete Mitochondrial Genome Sequence of Sunflower (Helianthus annuus L.)

    PubMed Central

    Ebert, Daniel P.; Kane, Nolan C.; Rieseberg, Loren H.

    2016-01-01

    This is the first complete mitochondrial genome sequence for sunflower and the first complete mitochondrial genome for any member of Asteraceae, the largest plant family, which includes over 23,000 named species. The master circle is 300,945-bp long and includes 27 protein-coding sequences, 18 tRNAs, and the 26S, 5S, and 18S rRNAs. PMID:27635002

  1. Shoot development from hypocotyl protoplasts of sunflower (Helianthus annuus L.).

    PubMed

    Taski-Ajdukovic, Ksenija; Nagl, Nevena; Miladinovic, Dragana; Mikic, A

    2009-06-01

    The plant regeneration from sunflower protoplast was achieved by protocols that considerably differ with respect to basal medium and concentration of growth regulators added. In most cases regeneration was restricted to a small proportion of genotypes. In this experiment, sunflower inbred line Ha-74A, with a high regeneration ability was used for protoplast isolation from etiolated hypocotyls. Isolated protoplasts were embedded in agarose droplets and cultured according to different regeneration protocols. The best results were obtained when protoplasts were cultured on L4 medium followed by transfer of regenerated microcalluses to solid regeneration media. Shoot regeneration was achieved by culture of calluses on SE regeneration medium after the treatment with 2.2 μM thidiazuron. PMID:19584032

  2. Sorting through the chaff, nDNA gene trees for phylogenetic inference and hybrid identification of annual sunflowers (Helianthus sect. Helianthus).

    PubMed

    Moody, Michael L; Rieseberg, Loren H

    2012-07-01

    The annual sunflowers (Helianthus sect. Helianthus) present a formidable challenge for phylogenetic inference because of ancient hybrid speciation, recent introgression, and suspected issues with deep coalescence. Here we analyze sequence data from 11 nuclear DNA (nDNA) genes for multiple genotypes of species within the section to (1) reconstruct the phylogeny of this group, (2) explore the utility of nDNA gene trees for detecting hybrid speciation and introgression; and (3) test an empirical method of hybrid identification based on the phylogenetic congruence of nDNA gene trees from tightly linked genes. We uncovered considerable topological heterogeneity among gene trees with or without three previously identified hybrid species included in the analyses, as well as a general lack of reciprocal monophyly of species. Nonetheless, partitioned Bayesian analyses provided strong support for the reciprocal monophyly of all species except H. annuus (0.89 PP), the most widespread and abundant annual sunflower. Previous hypotheses of relationships among taxa were generally strongly supported (1.0 PP), except among taxa typically associated with H. annuus, apparently due to the paraphyly of the latter in all gene trees. While the individual nDNA gene trees provided a useful means for detecting recent hybridization, identification of ancient hybridization was problematic for all ancient hybrid species, even when linkage was considered. We discuss biological factors that affect the efficacy of phylogenetic methods for hybrid identification.

  3. An approach to identify the novel miRNA encoded from H. Annuus EST sequences.

    PubMed

    Gupta, Hemant; Tiwari, Tanushree; Patel, Maulik; Mehta, Aditya; Ghosh, Arpita

    2015-12-01

    MicroRNAs are a newly discovered class of non-protein small RNAs with 22-24 nucleotides. They play multiple roles in biological processes including development, cell proliferation, apoptosis, stress responses and many other cell functions. In this research, several approaches were combined to make a computational prediction of potential miRNAs and their targets in Helianthus annuus (H. annuus). The already available information of the plant miRNAs present in miRBase v21 was used against expressed sequence tags (ESTs). A total of three miRNAs were detected from which one potential novel miRNA was identified following a range of strict filtering criteria. The target prediction was carried out for these three miRNAs having various targets. These targets were functionally annotated and GO terms were assigned. To study the conserved nature of the miRNAs, predicted phylogenetic analysis was carried out. These findings will significantly provide the broader picture for understanding the functions in H. annuus. PMID:26697356

  4. Distribution of Ty3-gypsy- and Ty1-copia-like DNA sequences in the genus Helianthus and other Asteraceae.

    PubMed

    Natali, L; Santini, S; Giordani, T; Minelli, S; Maestrini, P; Cionini, P G; Cavallini, A

    2006-01-01

    Two repeated DNA sequences, pHaS13 and pHaS211, which revealed similarity to the int gene of Ty3-gypsy retrotransposons and the RNAse-H gene of Ty1-copia retroelements, respectively, were surveyed in Asteraceae species and within the genus Helianthus. Southern analysis of the genome of selected Asteraceae that belong to different tribes showed that pHaS13- and pHaS211-related subfamilies of gypsy- and copia-like retroelements are highly redundant only in Helianthus and, to a lesser extent, in Tithonia, a Helianthus strict relative. However, under low stringency posthybridization washes, bands were observed in almost all the other Asteraceae tested when pHaS13 was used as a probe, and in several species when pHaS211 was hybridized. FISH analysis of pHaS13 or pHaS211 probes was performed in species in which labelling was observed in Southern hybridizations carried out under high stringency conditions (Helianthus annuus, Tithonia rotundifolia, Ageratum spp., Leontopodium spp., Senecio vulgaris for pHaS13, and H. annuus, Tithonia rotundifolia, and S. vulgaris for pHaS211). Scattered labelling was observed over all metaphase chromosomes, indicating a large dispersal of both Ty3-gypsy- and Ty1-copia-like retroelements. However, preferential localization of Ty3-gypsy-like sequences at centromeric chromosome regions was observed in all of the species studies but one, even in species in which pHaS13-related elements are poorly represented. Ty1-copia-like sequences showed preferential localization at the chromosome ends only in H. annuus. To study the evolution of gypsy- and copia-like retrotransposons in Helianthus, cladograms were built based on the Southern blot hybridization patterns of pHaS13 or pHaS211 sequences to DNA digests of several species of this genus. Both cladograms agree in splitting the genomes studied into annuals and perennials. Differences that occurred within the clades of perennial and annual species between gypsy- and copia-like retroelements

  5. Comparative mapping and rapid karyotypic evolution in the genus helianthus.

    PubMed Central

    Burke, John M; Lai, Zhao; Salmaso, Marzia; Nakazato, Takuya; Tang, Shunxue; Heesacker, Adam; Knapp, Steven J; Rieseberg, Loren H

    2004-01-01

    Comparative genetic linkage maps provide a powerful tool for the study of karyotypic evolution. We constructed a joint SSR/RAPD genetic linkage map of the Helianthus petiolaris genome and used it, along with an integrated SSR genetic linkage map derived from four independent H. annuus mapping populations, to examine the evolution of genome structure between these two annual sunflower species. The results of this work indicate the presence of 27 colinear segments resulting from a minimum of eight translocations and three inversions. These 11 rearrangements are more than previously suspected on the basis of either cytological or genetic map-based analyses. Taken together, these rearrangements required a minimum of 20 chromosomal breakages/fusions. On the basis of estimates of the time since divergence of these two species (750,000-1,000,000 years), this translates into an estimated rate of 5.5-7.3 chromosomal rearrangements per million years of evolution, the highest rate reported for any taxonomic group to date. PMID:15166168

  6. Ontogeny strongly and differentially alters leaf economic and other key traits in three diverse Helianthus species.

    PubMed

    Mason, Chase M; McGaughey, Sarah E; Donovan, Lisa A

    2013-10-01

    The leaf economics spectrum (LES) describes large cross-species variation in suites of leaf functional traits ranging from resource-acquisitive to resource-conservative strategies. Such strategies have been integral in explaining plant adaptation to diverse environments, and have been linked to numerous ecosystem processes. The LES has previously been found to be significantly modulated by climate, soil fertility, biogeography, growth form, and life history. One largely unexplored aspect of LES variation, whole-plant ontogeny, is investigated here using multiple populations of three very different species of sunflower: Helianthus annuus, Helianthus mollis, and Helianthus radula. Plants were grown under environmentally controlled conditions and assessed for LES and related traits at four key developmental stages, using recently matured leaves to standardize for leaf age. Nearly every trait exhibited a significant ontogenetic shift in one or more species, with trait patterns differing among populations and species. Photosynthetic rate, leaf nitrogen concentration, and leaf mass per area exhibited surprisingly large changes, spanning over two-thirds of the original cross-species LES variation and shifting from resource-acquisitive to resource-conservative strategies as the plants matured. Other traits being investigated in relation to the LES, such as leaf water content, pH, and vein density, also showed large changes. The finding that ontogenetic variation in LES strategy can be substantial leads to a recommendation of standardization by developmental stage when assessing 'species values' of labile traits for comparative approaches. Additionally, the substantial ontogenetic trait shifts seen within single individuals provide an opportunity to uncover the contribution of gene regulatory changes to variation in LES traits.

  7. Weed control in sunflower (helianthus annuus L.) with post-emergent herbicides.

    PubMed

    Béres, I; Szente, D; Gyenes, V; Somlyay, I

    2005-01-01

    Sunflower is the most important oil crop in Hungary, is the base of the production of cooking oil and moreover takes an important part in production of margarine too. Extracted sunflower groats as a secondary product origining from the mentioned procedure can be used in forage successfully. The amount of harvested sunflower reaches the 20-25% of the EU's yield. The sowing area approaches 500 thousand hectares. The essential condition of successful crop production is the perfect weed control. Sowing areas are infected with monocotyledon and dicotyledonous weeds too. Annual dicotyledonous weeds are the most troublesome. The worst species is the Ambrosia artemisiifolia L. Many other weed species as Abutilon theophrasti MEDIC., Datura stramonium L. and Xanthium strumarium L. can cause serious damages. In our model experiments we examined the herbicide sensibility of two commercial sunflower cultivars as "Iregi szürke csikos", "Marica II" and a sulfonylurea-urea tolerant new hybrid "PR63E82". The experiment was set up under greenhouse conditions with the use of four important weed and different post-emergent herbicide as Modown 4F (bifenox), Pledge 50 WP (flumioxazin) and Granstar 75 DF (tribenuron-methyl). We applied normal and double doses too. Sunflower was cultivated to 4-6 leaf stage. Post-emergent herbicides were sprayed out when weeds were in 2, 2-4 and 4-6 leaf stage. Weed killer and phytotoxic effects of post-emergent herbicides were examined. We declared that development of weeds had significally effect on the effectiveness of different herbicides. PMID:16637218

  8. Carbon conversion efficiency and central metabolic fluxes in developing sunflower (Helianthus annuus L.) embryos.

    PubMed

    Alonso, Ana P; Goffman, Fernando D; Ohlrogge, John B; Shachar-Hill, Yair

    2007-10-01

    The efficiency with which developing sunflower embryos convert substrates into seed storage reserves was determined by labeling embryos with [U-(14)C6]glucose or [U-(14)C5]glutamine and measuring their conversion to CO2, oil, protein and other biomass compounds. The average carbon conversion efficiency was 50%, which contrasts with a value of over 80% previously observed in Brassica napus embryos (Goffman et al., 2005), in which light and the RuBisCO bypass pathway allow more efficient conversion of hexose to oil. Labeling levels after incubating sunflower embryos with [U-(14)C4]malate indicated that some carbon from malate enters the plastidic compartment and contributes to oil synthesis. To test this and to map the underlying pattern of metabolic fluxes, separate experiments were carried out in which embryos were labeled to isotopic steady state using [1-(13)C1]glucose, [2-(13)C1]glucose, or [U-(13)C5]glutamine. The resultant labeling in sugars, starch, fatty acids and amino acids was analyzed by NMR and GC-MS. The fluxes through intermediary metabolism were then quantified by computer-aided modeling. The resulting flux map accounted well for the labeling data, was in good agreement with the observed carbon efficiency, and was further validated by testing for agreement with gas exchange measurements. The map shows that the influx of malate into oil is low and that flux through futile cycles (wasting ATP) is low, which contrasts with the high rates previously determined for growing root tips and heterotrophic cell cultures.

  9. The lipidome and proteome of oil bodies from Helianthus annuus (common sunflower).

    PubMed

    Furse, Samuel; Liddell, Susan; Ortori, Catharine A; Williams, Huw; Neylon, D Cameron; Scott, David J; Barrett, David A; Gray, David A

    2013-04-01

    In this paper we report the molecular profiling, lipidome and proteome, of the plant organelle known as an oil body (OB). The OB is remarkable in that it is able to perform its biological role (storage of triglycerides) whilst resisting the physical stresses caused by changes during desiccation (dehydration) and germination (rehydration). The molecular profile that confers such extraordinary physical stability on OBs was determined using a combination of (31)P/(1)H nuclear magnetic resonance (NMR), high-resolution mass spectrometry and nominal mass-tandem mass spectrometry for the lipidome, and gel-electrophoresis-chromatography-tandem mass spectrometry for the proteome. The integrity of the procedure for isolating OBs was supported by physical evidence from small-angle neutron-scattering experiments. Suppression of lipase activity was crucial in determining the lipidome. There is conclusive evidence that the latter is dominated by phosphatidylcholine (∼60 %) and phosphatidylinositol (∼20 %), with a variety of other head groups (∼20 %). The fatty acid profile of the surface monolayer comprised palmitic, linoleic and oleic acids (2:1:0.25, (1)H NMR) with only traces of other fatty acids (C24:0, C22:0, C18:0, C18:3, C16:2; by MS). The proteome is rich in oleosins (78 %) with the remainder being made up of caleosins and steroleosins. These data are sufficiently detailed to inform an update of the understood model of this organelle and can be used to inform the use of such components in a range of molecular biological, biotechnological and food industry applications. The techniques used in this study for profiling the lipidome throw a new light on the lipid profile of plant cellular compartments.

  10. Weed control in sunflower (helianthus annuus L.) with post-emergent herbicides.

    PubMed

    Béres, I; Szente, D; Gyenes, V; Somlyay, I

    2005-01-01

    Sunflower is the most important oil crop in Hungary, is the base of the production of cooking oil and moreover takes an important part in production of margarine too. Extracted sunflower groats as a secondary product origining from the mentioned procedure can be used in forage successfully. The amount of harvested sunflower reaches the 20-25% of the EU's yield. The sowing area approaches 500 thousand hectares. The essential condition of successful crop production is the perfect weed control. Sowing areas are infected with monocotyledon and dicotyledonous weeds too. Annual dicotyledonous weeds are the most troublesome. The worst species is the Ambrosia artemisiifolia L. Many other weed species as Abutilon theophrasti MEDIC., Datura stramonium L. and Xanthium strumarium L. can cause serious damages. In our model experiments we examined the herbicide sensibility of two commercial sunflower cultivars as "Iregi szürke csikos", "Marica II" and a sulfonylurea-urea tolerant new hybrid "PR63E82". The experiment was set up under greenhouse conditions with the use of four important weed and different post-emergent herbicide as Modown 4F (bifenox), Pledge 50 WP (flumioxazin) and Granstar 75 DF (tribenuron-methyl). We applied normal and double doses too. Sunflower was cultivated to 4-6 leaf stage. Post-emergent herbicides were sprayed out when weeds were in 2, 2-4 and 4-6 leaf stage. Weed killer and phytotoxic effects of post-emergent herbicides were examined. We declared that development of weeds had significally effect on the effectiveness of different herbicides.

  11. Phospholipid molecular profiles in the seed kernel from different sunflower (Helianthus annuus) mutants.

    PubMed

    Salas, Joaquín J; Martínez-Force, Enrique; Garcés, Rafael

    2006-08-01

    Phospholipids are essential components of plant cell membranes whose acyl composition appears to be influenced by oil composition in the sunflower. In the current study, we have determined the diacylglycerol profile of the main phospholipids using phospholipase C degradation and separation of the diacylglycerols by HPLC and GLC. The main polar lipid molecular species were defined in different classes of sunflower kernel: PC, PE, and PI. The proportions of each were determined at different stages of development in order to define the point at which the mutations carried by each sunflower line affected the phospholipid composition of the seeds. The results indicated that modifications to intraplastidial de novo FA synthesis affected the seed phospholipid profile during the whole period of the seed formation, including accumulation and maturation, whereas the influence of mutations in the endoplasmic reticulum desaturases were more readily detected at later stages of development. These results are discussed in terms of the pathways involved in glycerolipid synthesis and phospholipid conversion in sunflower seeds.

  12. Relationships between xanthoxin, phototropism, and elongation growth in the sunflower seedling Helianthus annuus L.

    PubMed

    Franssen, J M; Bruinsma, J

    1981-04-01

    For phototropic curvature of a green sunflower seedling, only the hypocotyl has to be illuminated; the tip and cotyledons are not involved in stimulus perception. The etiolated seedling is phototropically insensitive, illumination of only the hypocotyl renders it sensitive. It is concluded that the photoreceptor is located within the responding organ. In curving seedlings, the endogenous indoleacetic acid (IAA) remains evenly distributed. However, the inhibitor, xanthoxin (Xa), accumulates on the illuminated side. The degree of phototropic response is generally related to the concentration of Xa. The amount of phototropic curvature is independent of the rate of elongation growth, the former can be changed without affecting the latter, and vice versa. The data conflict with the Cholodny-Went theory, whereas they support the hypothesis of Blaauw that the phototropic reaction is caused by the local accumulation of a growth-inhibiting substance on the irradiated side.

  13. Sunflower (Helianthus annuus) pollination in California's Central Valley is limited by native bee nest site location.

    PubMed

    Sardiñas, Hillary S; Tom, Kathleen; Ponisio, Lauren Catherine; Rominger, Andrew; Kremen, Claire

    2016-03-01

    The delivery of ecosystem services by mobile organisms depends on the distribution of those organisms, which is, in turn, affected by resources at local and landscape scales. Pollinator-dependent crops rely on mobile animals like bees for crop production, and the spatial relationship between floral resources and nest location for these central-place foragers influences the delivery of pollination services. Current models that map pollination coverage in agricultural regions utilize landscape-level estimates of floral availability and nesting incidence inferred from expert opinion, rather than direct assessments. Foraging distance is often derived from proxies of bee body size, rather than direct measurements of foraging that account for behavioral responses to floral resource type and distribution. The lack of direct measurements of nesting incidence and foraging distances may lead to inaccurate mapping of pollination services. We examined the role of local-scale floral resource presence from hedgerow plantings on nest incidence of ground-nesting bees in field margins and within monoculture, conventionally managed sunflower fields in California's Central Valley. We tracked bee movement into fields using fluorescent powder. We then used these data to simulate the distribution of pollination services within a crop field. Contrary to expert opinion, we found that ground-nesting native bees nested both in fields and edges, though nesting rates declined with distance into field. Further, we detected no effect of field-margin floral enhancements on nesting. We found evidence of an exponential decay rate of bee movement into fields, indicating that foraging predominantly occurred in less than 1% of medium-sized bees' predicted typical foraging range. Although we found native bees nesting within agricultural fields, their restricted foraging movements likely centralize pollination near nest sites. Our data thus predict a heterogeneous distribution of pollination services within sunflower fields, with edges receiving higher coverage than field centers. To generate more accurate maps of services, we advocate directly measuring the autecology of ecosystem service providers, which vary by crop system, pollinator species, and region. Improving estimates of the factors affecting pollinator populations can increase the accuracy of pollination service maps and help clarify the influence of farming practices on wild bees occurring in agricultural landscapes. PMID:27209786

  14. Effect of the ferredoxin electron donor on sunflower (Helianthus annuus) desaturases.

    PubMed

    Venegas-Calerón, M; Youssar, L; Salas, J J; Garcés, R; Martínez-Force, E

    2009-08-01

    Ferredoxins are proteins that participate in photosynthesis and in other processes that require reducing equivalents, such as the reduction of nitrogen or fatty acid desaturation. Two classes of ferredoxins have been described in plants: light-regulated photosynthetic ferredoxins and heterotrophic ferredoxins whose activity is not influenced by light. Genes encoding the two forms of ferredoxin have been cloned and characterized in developing sunflower cotyledons. Here, these genes were overexpressed in Escherichia coli and they were purified by ion exchange and size exclusion chromatography to study their capacity to supply electrons to two different sunflower desaturases: soluble stearoyl-ACP desaturase from sunflower cotyledons, and membrane bound desaturase FAD7 expressed in yeast. In both cases photosynthetic ferredoxin was the form that promoted the strongest desaturase activity.

  15. Acetohydroxyacid synthase (AHAS) in vivo assay for screening imidazolinone-resistance in sunflower (Helianthus annuus L.).

    PubMed

    Vega, T; Breccia, G; Gil, M; Zorzoli, R; Picardi, L; Nestares, G

    2012-12-01

    The objective of this work was to evaluate the in vivo acetohydroxyacid synthase (AHAS) activity response to imidazolinones and its possible use as a selection method for evaluating AHAS inhibitor resistance. In vivo AHAS assay and the comparison of parameters from dose-response curves have been used as a valid tool for comparing sunflower lines and hybrids differing in imidazolinone resistance. The sunflower resistant genotypes evaluated here were 100-fold and 20-fold more resistant compared with the susceptible line for imazethapyr and imazapyr, respectively. This assay also allowed discrimination of homozygous from heterozygous genotypes for I(mr1) locus that codify for the catalytic subunit of AHAS. The in vivo AHAS assay described in this study was useful for the selection of sunflower genotypes differing in herbicide resistance and could be a useful tool when breeding for imidazolinone resistance in sunflower.

  16. Molecular mapping of a new induced gene for nuclear male sterility in sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new NMS line, NMS HA89-872, induced by mitomycin C and streptomycin carries a single recessive male-sterile gene ms6. An F2 population of 88 plants was obtained from a cross between nuclear male-sterile mutant NMS HA89-872 (msms) and male-fertile line RHA271 (MsMs). 225 SSR primers and 9 RFLP-deri...

  17. Selenium alleviates cadmium toxicity by preventing oxidative stress in sunflower (Helianthus annuus) seedlings.

    PubMed

    Saidi, Issam; Chtourou, Yacine; Djebali, Wahbi

    2014-03-01

    The present study investigated the possible mediatory role of selenium (Se) in protecting plants from cadmium (Cd) toxicity. The exposure of sunflower seedlings to 20μM Cd inhibited biomass production, decreased chlorophyll and carotenoid concentrations and strongly increased accumulation of Cd in both roots and shoots. Similarly, Cd enhanced hydrogen peroxides content and lipid peroxidation as indicated by malondialdehyde accumulation. Pre-soaking seeds with Se (5, 10 and 20μM) alleviated the negative effect of Cd on growth and led to a decrease in oxidative injuries caused by Cd. Furthermore, Se enhanced the activities of catalase, ascorbate peroxidase and glutathione reductase, but lowered that of superoxide dismutase and guaiacol peroxidase. As important antioxidants, ascorbate and glutathione contents in sunflower leaves exposed to Cd were significantly decreased by Se treatment. The data suggest that the beneficial effect of Se during an earlier growth period could be related to avoidance of cumulative damage upon exposure to Cd, thus reducing the negative consequences of oxidative stress caused by heavy metal toxicity.

  18. Hydroponic phytoremediation of Cd, Cr, Ni, As, and Fe: can Helianthus annuus hyperaccumulate multiple heavy metals?

    PubMed

    January, Mary C; Cutright, Teresa J; Van Keulen, Harry; Wei, Robert

    2008-01-01

    Sundance sunflowers were subjected to contaminated solutions containing 3, 4, or 5 heavy metals, with and without EDTA. The sunflowers exhibited a metal uptake preference of Cd=Cr>Ni, Cr>Cd>Ni>As and Fe>As>Cd>Ni>Cr without EDTA and Cr>Cd>Ni, Fe>As>Cd>Cr>Ni with EDTA. As uptake was not affected by other metals, but it decreased Cd and Ni concentration in the stems. The presence of Fe improved the translocation of the other metals regardless of whether EDTA was present. In general, EDTA served as a hindrance to metal uptake. For the experiment with all five heavy metals, EDTA decreased Cd in the roots and stems from 2.11 to 1.36 and from 2.83 to 2.3 2mg g(-1) biomass, respectively. For the same conditions, Ni in the stems decreased from 1.98 to 0.94 mg g(-1) total metal uptake decreased from 14.95 mg to 13.89 mg, and total biomass decreased from 2.38 g to 1.99 g. These results showed an overall negative effect in addition of EDTA. However it is unknown whether the negative effect was due to toxicity posed by EDTA or the breaking of phytochelatin-metal bonds. The most important finding was the ability of Sundance sunflowers to achieve hyperaccumulator status for both As and Cd under all conditions studied. Ni hyperaccumulator status was only achieved in the presence of three metals without EDTA.

  19. Effect of salinity and sodicity stresses on physiological response and productivity in Helianthus annuus.

    PubMed

    Farghaly, Fatma Aly; Radi, Abeer Ahmed; Abdel-Wahab, Dalia Ahmed; Hamada, Afaf Mohamed

    2016-06-01

    Soil salinity and sodicity (alkalinity) are serious land degradation issues worldwide that are predicted to increase in the future. The objective of the present study is to distinguish the effects of NaCl and Na(2)CO(3) salinity in two concentrations on the growth, lipoxygenase (LOX) activity, membrane integrity, total lipids, yield parameters and fatty acids (FAs) composition of seeds of sunflower cultivar Sakha 53. Plant growth, LOX activity and malondialdehyde (MDA) content were reduced by salts stresses. On the contrary, salinity and alkalinity stress induced stimulatory effects on membrane permeability, leakage of UV-metabolites from leaves and total lipids of sunflower shoots and roots. Crop yield (plant height, head diameter, seed index and number of seeds for each head) that is known as a hallmark of plant stress was decreased by increasing concentrations of NaCl and Na(2)CO(3) in the growth media. Fatty acid methyl esters (FAME) composition of salt-stressed sunflower seeds varied with different levels of NaCl and Na(2)CO(3).

  20. Rhizopus oryzae associated with Melanagromyza splendida and stem disease of sunflowers (Helianthus annuus) in California

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In September 2012, a female parental line in a Yolo, CA in sunflower seed-production field began displaying external stem symptoms that could not be attributed to any known disease. Symptoms appeared to be associated with tunneling caused by an un-identified insect. Stems were collected and Rhizopu...

  1. Evaluation of proteome alterations induced by cadmium stress in sunflower (Helianthus annuus L.) cultures.

    PubMed

    Lopes Júnior, Cícero Alves; Barbosa, Herbert de Sousa; Moretto Galazzi, Rodrigo; Ferreira Koolen, Hector Henrique; Gozzo, Fábio Cesar; Arruda, Marco Aurélio Zezzi

    2015-09-01

    The present study evaluates, at a proteomic level, changes in protein abundance in sunflower leaves in the absence or presence (at 50 or 700mg) of cadmium (as CdCl2). At the end of the cultivation period (45 days), proteins are extracted from leaves with phenol, separated by two-dimensional difference gel electrophoresis (2-D DIGE), and excised from the gels. The differential protein abundances (for proteins differing by more than 1.8 fold, which corresponds to 90% variation) are characterized using nESI-LC-MS/MS. The protein content decreases by approximately 41% in plants treated with 700mg Cd compared with control plants. By comparing all groups of plants evaluated in this study (Control vs. Cd-lower, Control vs. Cd-higher and Cd-lower vs. Cd-higher), 39 proteins are found differential and 18 accurately identified; the control vs. Cd-higher treatment is that presenting the most differential proteins. From identified proteins, those involved in energy and disease/defense (including stress), are the ribulose bisphosphate carboxylase large chain, transketolase, and heat shock proteins are the most differential abundant proteins. Thus, at the present study, photosynthesis is the main process affected by Cd in sunflowers, although these plants are highly tolerant to Cd.

  2. Distribution of [(14)C]imidacloprid in sunflowers (Helianthus annuus L.) following seed treatment.

    PubMed

    Laurent, François M; Rathahao, Estelle

    2003-12-31

    Imidacloprid, a neonicotinic insecticide, has been used as a seed dressing (Gaucho) to protect crops against soil and aerial insects. However, French beekeepers observed abnormal behavior of bees foraging on sunflowers and suspected a link between the imidacloprid seed treatment and the observed bee syndrome. This work studies the distribution of [(14)C-imidazolidin]imidacloprid (1 mg/seed) in three stages of Gaucho-treated sunflowers grown in an outdoor lysimeter. Plants absorbed <10% of [(14)C]imidacloprid spiked on seeds, and 75% of that absorbed radioactivity was found in cotyledons. Concentrations in the upper leaves were 20 times lower than in the first leaves. From the extracted radioactivity, imidacloprid accounted for 50% and metabolites for the other 50%. Four major metabolites can be detected, in variable concentrations, among which the hydroxy- and olefin-imidacloprid have toxicities equivalent to that of imidacloprid. In pollen, concentrations of imidacloprid were 13 ng x g(-1). Thus, imidacloprid residues from Gaucho seed treatment contaminated sunflower pollen, involving the translocation of imidacloprid within the plant.

  3. Molecular evolution of candidate genes for crop-related traits in sunflower (Helianthus annuus L.).

    PubMed

    Mandel, Jennifer R; McAssey, Edward V; Nambeesan, Savithri; Garcia-Navarro, Elena; Burke, John M

    2014-01-01

    Evolutionary analyses aimed at detecting the molecular signature of selection during crop domestication and/or improvement can be used to identify genes or genomic regions of likely agronomic importance. Here, we describe the DNA sequence-based characterization of a pool of candidate genes for crop-related traits in sunflower. These genes, which were identified based on homology to genes of known effect in other study systems, were initially sequenced from a panel of improved lines. All genes that exhibited a paucity of sequence diversity, consistent with the possible effects of selection during the evolution of cultivated sunflower, were then sequenced from a panel of wild sunflower accessions an outgroup. These data enabled formal tests for the effects of selection in shaping sequence diversity at these loci. When selection was detected, we further sequenced these genes from a panel of primitive landraces, thereby allowing us to investigate the likely timing of selection (i.e., domestication vs. improvement). We ultimately identified seven genes that exhibited the signature of positive selection during either domestication or improvement. Genetic mapping of a subset of these genes revealed co-localization between candidates for genes involved in the determination of flowering time, seed germination, plant growth/development, and branching and QTL that were previously identified for these traits in cultivated × wild sunflower mapping populations. PMID:24914686

  4. Florets of sunflower (Helianthus annuus L.): potential new sources of dietary fiber and phenolic acids.

    PubMed

    Liang, Qiang; Cui, Jun; Li, Hang; Liu, Jia; Zhao, Guohua

    2013-04-10

    Ray florets (Rf) and disc florets (Df) are agricultural byproducts of sunflower seeds. Their nutrition-related compounds were determined. The dietary fiber contents in Rf and Df were 42.90 mg/100 g and 58.97 mg/100 g. In both florets, palmitic, linoleic, and linolenic acids were identified as the three most abundant fatty acids, and the saturated ones constitute approximately two-thirds (w/w) of the total fatty acids. Lysine was the limiting amino acid in both florets by World Health Organization standards. Sixteen phenolic compounds, nine free and eight bound, mainly depsides, were identified in florets by RP-HPLC-DAD/ESI-TOF-MS. The free and bound phenolic compounds in Df were higher than in Rf. 1,5-di-O-caffeoylquinic acid was the predominant free phenolic compound in both florets. The present study revealed that the florets of sunflower are rich sources of dietary fiber, Fe, and phenols.

  5. Kinetics modeling of the drying of sunflower stem (Helianthus annuus L.) in a forced convection tunnel

    NASA Astrophysics Data System (ADS)

    López, R.; Vaca, M.; Terres, H.; Lizardi, A.; Morales, J.; Flores, J.; Chávez, S.

    2015-01-01

    The sunflower is an annual plant native to the Americas. It possesses a large inflorescence (flowering head), and its name is derived from the flower's shape and image, which is often used to capture the sun. The plant has a rough, broad, hairy stem, coarsely toothed, with rough leaves, and circular flower heads. The sunflower seeds are appreciated for their oil, which has become a widespread cooking ingredient. Leaves of the sunflower can be used as cattle feed, while the stems contain a fiber that may be used in paper production. Recently this flower has been used in phytoremediation of soils, contaminated with heavy metals. Sunflower has been probed as an efficient phytoextractor of chromium, lead, aluminum, zinc, cadmium from soil. In this work we present the experimental results of the drying of the sunflower stem, cut in 100 mm longitudinal sections, with diameters in the range of 11-18 mm. The aim was to obtain a dry and easy-to-handle final product, since these plants were originally cultivated in order to extract heavy metals from a polluted soil. The dried stems could then be easily confined or sent to recycle premises to concentrate the metals. The drying process was done in forced convection within a hot air tunnel. The used temperature was 60 °C, the velocity of air was 3 m/s and the required times were 8 hours. The initial average wet mass was 28 g and the final value was 5 g, resulting in the aimed product.

  6. Characterization of partially purified milk-clotting enzyme from sunflower (Helianthus annuus) seeds.

    PubMed

    Nasr, Assia I A M; Mohamed Ahmed, Isam A; Hamid, Omer I A

    2016-09-01

    This study was aimed to extract milk-clotting enzyme from sunflower seeds and to determine its potentiality for manufacturing white soft cheese from cows and goats milk. The seeds were blended and extracted using two types of buffers and milk-clotting and proteolytic activities were evaluated. The enzyme was partially purified using ammonium sulfate fractionation techniques. Results indicated that sunflower seeds extracted with 5% NaCl in 50 mmol/L acetate buffer, pH 5.0, had the highest milk-clotting activity (MCA) and lowest coagulation time compared to that extracted with only acetate buffer (pH 5.0). Ammonium sulfate at 30-50% saturation purified the enzyme to 4.3 folds with MCA of 241.0 U/mL and final enzyme yield of 10.9%. The partially purified enzyme was characterized by SDS-PAGE that showed two bands with molecular weight of 120 and 62 kDa. When compared with other plant enzymes, the partially purified sunflower enzyme was found to have higher milk-clotting activity and lower proteolytic activity. Also, both milk sources and enzyme types significantly affected the cheese yield and curd formation time. The cheese made from cow milk using sunflower enzyme had higher yield compared to that obtained using commercial rennet, whereas the opposite was observed when using goat milk. PMID:27625777

  7. Physiological and gene expression responses of sunflower (Helianthus annuus L.) plants differ according to irrigation placement.

    PubMed

    Aguado, Ana; Capote, Nieves; Romero, Fernando; Dodd, Ian C; Colmenero-Flores, José M

    2014-10-01

    To investigate effects of soil moisture heterogeneity on plant physiology and gene expression in roots and leaves, three treatments were implemented in sunflower plants growing with roots split between two compartments: a control (C) treatment supplying 100% of plant evapotranspiration, and two treatments receiving 50% of plant evapotranspiration, either evenly distributed to both compartments (deficit irrigation - DI) or unevenly distributed to ensure distinct wet and dry compartments (partial rootzone drying - PRD). Plants receiving the same amount of water responded differently under the two irrigation systems. After 3 days, evapotranspiration was similar in C and DI, but 20% less in PRD, concomitant with decreased leaf water potential (Ψleaf) and increased leaf xylem ABA concentration. Six water-stress responsive genes were highly induced in roots growing in the drying soil compartment of PRD plants, and their expression was best correlated with local soil water content. On the other hand, foliar gene expression differed significantly from that of the root and correlated better with xylem ABA concentration and Ψleaf. While the PRD irrigation strategy triggered stronger physiological and molecular responses, suggesting a more intense and systemic stress reaction due to local dehydration of the dry compartment of PRD plants, the DI strategy resulted in similar water savings without strongly inducing these responses. Correlating physiological and molecular responses in PRD/DI plants may provide insights into the severity and location of water deficits and may enable a better understanding of long-distance signalling mechanisms.

  8. Sunflower (Helianthus annuus) pollination in California's Central Valley is limited by native bee nest site location.

    PubMed

    Sardiñas, Hillary S; Tom, Kathleen; Ponisio, Lauren Catherine; Rominger, Andrew; Kremen, Claire

    2016-03-01

    The delivery of ecosystem services by mobile organisms depends on the distribution of those organisms, which is, in turn, affected by resources at local and landscape scales. Pollinator-dependent crops rely on mobile animals like bees for crop production, and the spatial relationship between floral resources and nest location for these central-place foragers influences the delivery of pollination services. Current models that map pollination coverage in agricultural regions utilize landscape-level estimates of floral availability and nesting incidence inferred from expert opinion, rather than direct assessments. Foraging distance is often derived from proxies of bee body size, rather than direct measurements of foraging that account for behavioral responses to floral resource type and distribution. The lack of direct measurements of nesting incidence and foraging distances may lead to inaccurate mapping of pollination services. We examined the role of local-scale floral resource presence from hedgerow plantings on nest incidence of ground-nesting bees in field margins and within monoculture, conventionally managed sunflower fields in California's Central Valley. We tracked bee movement into fields using fluorescent powder. We then used these data to simulate the distribution of pollination services within a crop field. Contrary to expert opinion, we found that ground-nesting native bees nested both in fields and edges, though nesting rates declined with distance into field. Further, we detected no effect of field-margin floral enhancements on nesting. We found evidence of an exponential decay rate of bee movement into fields, indicating that foraging predominantly occurred in less than 1% of medium-sized bees' predicted typical foraging range. Although we found native bees nesting within agricultural fields, their restricted foraging movements likely centralize pollination near nest sites. Our data thus predict a heterogeneous distribution of pollination services within sunflower fields, with edges receiving higher coverage than field centers. To generate more accurate maps of services, we advocate directly measuring the autecology of ecosystem service providers, which vary by crop system, pollinator species, and region. Improving estimates of the factors affecting pollinator populations can increase the accuracy of pollination service maps and help clarify the influence of farming practices on wild bees occurring in agricultural landscapes.

  9. Induction of leaf senescence by low nitrogen nutrition in sunflower (Helianthus annuus) plants.

    PubMed

    Agüera, Eloísa; Cabello, Purificación; de la Haba, Purificación

    2010-03-01

    Different parameters which vary during the leaf development in sunflower plants grown with nitrate (2 or 20 mM) for a 42-day period have been determined. The plants grown with 20 mM nitrate (N+) showed greater leaf area and specific leaf mass than the plants grown with 2 mM nitrate (N-). The total chlorophyll content decreased with leaf senescence, like the photosynthetic rate. This decline of photosynthetic activity was greater in plants grown with low nitrogen level (N-), showing more pronounced senescence symptoms than with high nitrogen (N+). In both treatments, soluble sugars increased with aging, while starch content decreased. A significant increase of hexose to sucrose ratio was observed at the beginning of senescence, and this raise was higher in N- plants than in N+ plants. These results show that sugar senescence regulation is dependent on nitrogen, supporting the hypothesis that leaf senescence is regulated by the C/N balance. In N+ and N- plants, ammonium and free amino acid concentrations were high in young leaves and decreased progressively in the senescent leaves. In both treatments, asparagine, and in a lower extent glutamine, increased after senescence start. The drop in the (Glu+Asp)/(Gln+Asn) ratio associated with the leaf development level suggests a greater nitrogen mobilization. Besides, the decline in this ratio occurred earlier and more rapidly in N- plants than in N+ plants, suggesting that the N- remobilization rate correlates with leaf senescence severity. In both N+ and N- plants, an important oxidative stress was generated in vivo during sunflower leaf senescence, as revealed by lipid peroxidation and hydrogen peroxide accumulation. In senescent leaves, the increase in hydrogen peroxide levels occurred in parallel with a decline in the activity of antioxidant enzymes. In N+ plants, the activities of catalase and ascorbate peroxidase (APX) increased to reach their highest values at 28 days, and later decreased during senescence, whereas in N- plants these activities started to decrease earlier, APX after 16 days and catalase after 22 days, suggesting that senescence is accelerated in N-leaves. It is probable that systemic signals, such as a deficit in amino acids or other metabolites associated with the nitrogen metabolism produced in plants grown with low nitrogen, lead to an early senescence and a higher oxidation state of the cells of these plant leaves.

  10. Spectral reflectance as an indicator of foliar concentrations of arsenic in common sunflower (Helianthus annuus)

    NASA Astrophysics Data System (ADS)

    Gandy, Yuridia Patricia Peralta De

    Studies were conducted to investigate the use of spectral reflectance by foliage of common sunflower as a potential indicator of arsenic contamination of soil. Germination method was developed for sunflower seeds, and cohorts of sunflower seedlings in hydroponic tanks were established. The cohorts were exposed to 0 ppm, 5 ppm, 7.5 ppm, and 10 ppm treatments of As (V) and reflectance measurements of foliage were collected using a spectroradiometer during two experiments. Results demonstrated the feasibility of using spectral reflectance by foliage of common sunflower as a potential indicator of arsenic contamination. In both experiments, arsenic concentrations in leaf tissues were directly proportional to arsenic concentrations in hydroponic solutions in which such plants were grown. Although the effect(s) of arsenic accumulation had minimal impact on reflectance of visible wavelengths, the effects on NIR reflectance were substantial and resulted in a progressive decrease in reflectance as arsenic concentrations in foliage increased.

  11. Protein targets of tyrosine nitration in sunflower (Helianthus annuus L.) hypocotyls.

    PubMed

    Chaki, Mounira; Valderrama, Raquel; Fernández-Ocaña, Ana M; Carreras, Alfonso; López-Jaramillo, Javier; Luque, Francisco; Palma, José M; Pedrajas, José R; Begara-Morales, Juan C; Sánchez-Calvo, Beatriz; Gómez-Rodríguez, María V; Corpas, Francisco J; Barroso, Juan B

    2009-01-01

    Tyrosine nitration is recognized as an important post-translational protein modification in animal cells that can be used as an indicator of a nitrosative process. However, in plant systems, there is scant information on proteins that undergo this process. In sunflower hypocotyls, the content of tyrosine nitration (NO(2)-Tyr) and the identification of nitrated proteins were studied by high-performance liquid chromatography with tandem mass spectrometry (LC-MS/MS) and proteomic approaches, respectively. In addition, the cell localization of nitrotyrosine proteins and peroxynitrite were analysed by confocal laser-scanning microscopy (CLSM) using antibodies against 3-nitrotyrosine and 3'-(p-aminophenyl) fluorescein (APF) as the fluorescent probe, in that order. The concentration of Tyr and NO(2)-Tyr in hypocotyls was 0.56 micromol mg(-1) protein and 0.19 pmol mg(-1) protein, respectively. By proteomic analysis, a total of 21 nitrotyrosine-immunopositive proteins were identified. These targets include proteins involved in photosynthesis, and in antioxidant, ATP, carbohydrate, and nitrogen metabolism. Among the proteins identified, S-adenosyl homocysteine hydrolase (SAHH) was selected as a model to evaluate the effect of nitration on SAHH activity using SIN-1 (a peroxynitrite donor) as the nitrating agent. When the hypocotyl extracts were exposed to 0.5 mM, 1 mM, and 5 mM SIN-1, the SAHH activity was inhibited by some 49%, 89%, and 94%, respectively. In silico analysis of the barley SAHH sequence, characterized Tyr448 as the most likely potential target for nitration. In summary, the present data are the first in plants concerning the content of nitrotyrosine and the identification of candidates of protein nitration. Taken together, the results suggest that Tyr nitration occurs in plant tissues under physiological conditions that could constitute an important process of protein regulation in such a way that, when it is overproduced in adverse circumstances, it can be used as a marker of nitrosative stress.

  12. The lipidome and proteome of oil bodies from Helianthus annuus (common sunflower).

    PubMed

    Furse, Samuel; Liddell, Susan; Ortori, Catharine A; Williams, Huw; Neylon, D Cameron; Scott, David J; Barrett, David A; Gray, David A

    2013-04-01

    In this paper we report the molecular profiling, lipidome and proteome, of the plant organelle known as an oil body (OB). The OB is remarkable in that it is able to perform its biological role (storage of triglycerides) whilst resisting the physical stresses caused by changes during desiccation (dehydration) and germination (rehydration). The molecular profile that confers such extraordinary physical stability on OBs was determined using a combination of (31)P/(1)H nuclear magnetic resonance (NMR), high-resolution mass spectrometry and nominal mass-tandem mass spectrometry for the lipidome, and gel-electrophoresis-chromatography-tandem mass spectrometry for the proteome. The integrity of the procedure for isolating OBs was supported by physical evidence from small-angle neutron-scattering experiments. Suppression of lipase activity was crucial in determining the lipidome. There is conclusive evidence that the latter is dominated by phosphatidylcholine (∼60 %) and phosphatidylinositol (∼20 %), with a variety of other head groups (∼20 %). The fatty acid profile of the surface monolayer comprised palmitic, linoleic and oleic acids (2:1:0.25, (1)H NMR) with only traces of other fatty acids (C24:0, C22:0, C18:0, C18:3, C16:2; by MS). The proteome is rich in oleosins (78 %) with the remainder being made up of caleosins and steroleosins. These data are sufficiently detailed to inform an update of the understood model of this organelle and can be used to inform the use of such components in a range of molecular biological, biotechnological and food industry applications. The techniques used in this study for profiling the lipidome throw a new light on the lipid profile of plant cellular compartments. PMID:23532185

  13. Vascular connections between the receptacle and empty achenes in sunflower (Helianthus annuus L.).

    PubMed

    Alkio, Merianne; Grimm, Eckhard

    2003-01-01

    Empty achenes in sunflower, particularly in the centre of the capitulum, may be caused by poor vascularization. This hypothesis was tested by microscopic examination and translocation experiments. Phloem and xylem were identified by fluorescence of aniline-blue-stained callose and autofluorescence, respectively. Vascular strands that extended from the receptacle into empty achenes were regularly found in longitudinal sections. The phloem-mobile probe, carboxyfluorescein, was translocated from the receptacle to the pericarp and the testa of empty achenes. Similarly, (14)CO(2)-derived (14)C-photoassimilates moved into empty achenes. The observations suggest that empty achenes are both structurally and functionally connected with the vascular system of the receptacle. Hence, deficient vascular connections do not prevent seed filling in sunflower. PMID:12493862

  14. Molecular Evolution of Candidate Genes for Crop-Related Traits in Sunflower (Helianthus annuus L.)

    PubMed Central

    Mandel, Jennifer R.; McAssey, Edward V.; Nambeesan, Savithri; Garcia-Navarro, Elena; Burke, John M.

    2014-01-01

    Evolutionary analyses aimed at detecting the molecular signature of selection during crop domestication and/or improvement can be used to identify genes or genomic regions of likely agronomic importance. Here, we describe the DNA sequence-based characterization of a pool of candidate genes for crop-related traits in sunflower. These genes, which were identified based on homology to genes of known effect in other study systems, were initially sequenced from a panel of improved lines. All genes that exhibited a paucity of sequence diversity, consistent with the possible effects of selection during the evolution of cultivated sunflower, were then sequenced from a panel of wild sunflower accessions an outgroup. These data enabled formal tests for the effects of selection in shaping sequence diversity at these loci. When selection was detected, we further sequenced these genes from a panel of primitive landraces, thereby allowing us to investigate the likely timing of selection (i.e., domestication vs. improvement). We ultimately identified seven genes that exhibited the signature of positive selection during either domestication or improvement. Genetic mapping of a subset of these genes revealed co-localization between candidates for genes involved in the determination of flowering time, seed germination, plant growth/development, and branching and QTL that were previously identified for these traits in cultivated × wild sunflower mapping populations. PMID:24914686

  15. Genetic analysis of proline concentration under osmotic stress in sunflower (Helianthus annuus L.)

    PubMed Central

    Khalil, Farghama; Rauf, Saeed; Monneveux, Philippe; Anwar, Shoaib; Iqbal, Zafar

    2016-01-01

    Proline concentration has been often suggested as an indicator of osmotic stress. A better understanding of the genetics of this trait is however needed. In the present study, proline concentration has been assessed, together with root and stem growth, potassium, calcium and total soluble sugars concentration and stress injury symptoms, in seedlings of sunflower hybrids and their parents grown under control and osmotic conditions. Proline strongly accumulated with osmotic stress. Its concentration exhibited a large variation among genotypes and was higher in hybrids than in parental lines. A positive association was noted between proline concentration and osmotic adjustment that was reflected in a reduction of osmotic stress induced injury, as showed by the reduced number of calli in the hybrids with higher proline concentration. Broad and narrow sense heritability was higher under osmotic stress suggesting applying the selection in osmotic stress condition. In the control treatment, dominance effects explained most of the genetic variation for proline concentration while under osmotic stress both dominance and additive variance were high. The importance of dominance and additive effects suggested that several genomic regions are controlling this trait. Good general combiners, presumably carrying positive additive alleles affecting proline concentration, were identified. PMID:27795671

  16. Effect of salinity and sodicity stresses on physiological response and productivity in Helianthus annuus.

    PubMed

    Farghaly, Fatma Aly; Radi, Abeer Ahmed; Abdel-Wahab, Dalia Ahmed; Hamada, Afaf Mohamed

    2016-06-01

    Soil salinity and sodicity (alkalinity) are serious land degradation issues worldwide that are predicted to increase in the future. The objective of the present study is to distinguish the effects of NaCl and Na(2)CO(3) salinity in two concentrations on the growth, lipoxygenase (LOX) activity, membrane integrity, total lipids, yield parameters and fatty acids (FAs) composition of seeds of sunflower cultivar Sakha 53. Plant growth, LOX activity and malondialdehyde (MDA) content were reduced by salts stresses. On the contrary, salinity and alkalinity stress induced stimulatory effects on membrane permeability, leakage of UV-metabolites from leaves and total lipids of sunflower shoots and roots. Crop yield (plant height, head diameter, seed index and number of seeds for each head) that is known as a hallmark of plant stress was decreased by increasing concentrations of NaCl and Na(2)CO(3) in the growth media. Fatty acid methyl esters (FAME) composition of salt-stressed sunflower seeds varied with different levels of NaCl and Na(2)CO(3). PMID:27165529

  17. Gravity Functions of Circumnutation by Hypocotyls of Helianthus annuus in Simulated Hypogravity 12

    PubMed Central

    Chapman, David K.; Venditti, Allen L.; Brown, Allan H.

    1980-01-01

    For more than a decade research on the botanical mechanism responsible for circumnutation has centered on whether or not these nearly ubiquitous oscillations can be attributed to a hunting process whereby the plant organ continuously responds to the gravity force and, by overshooting each stimulus, initiates a sustained oscillation or, driven by a not yet defined autogenic mechanism, performs oscillatory activities that require no external reinforcement to maintain the observed rhythms of differential growth. We explore here the effects of altered gravity force on parameters of circumnutation. Following our earlier publication on circumnutation in hypergravity we report here an exploration of circumnutation in hypogravity. Parameters of circumnutation are recorded as functions of the axially imposed gravity force. The same method was used (two-axes clinostat rotation) to produce sustained gravity forces referred to as hypergravity (1 < g), hypogravity (0 [unk] g < 1), and negative gravity (−1 < g < 0). In these three regions of the g-parameter nutational frequency and nutational amplitude were influenced in different ways. The results of our tests describe the gravity dependence of circumnutation over the full range of real or simulated gravity levels that are available in an earth laboratory. Our results demonstrated that nutational parameters are indeed gravity-dependent but are not inconsistent with the postulate that circumnutation can proceed in the absence of a significant gravity force. PMID:16661229

  18. Ecogeography and utility to plant breeding of the crop wild relatives of sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Crop wild relatives (CWR) are a rich source of genetic diversity for crop improvement. Combining ecogeographic and phylogenetic techniques can inform both conservation and breeding. Geographic occurrence, bioclimatic, and biophysical data were used to predict species distributions, range overlap and...

  19. Physiological and gene expression responses of sunflower (Helianthus annuus L.) plants differ according to irrigation placement.

    PubMed

    Aguado, Ana; Capote, Nieves; Romero, Fernando; Dodd, Ian C; Colmenero-Flores, José M

    2014-10-01

    To investigate effects of soil moisture heterogeneity on plant physiology and gene expression in roots and leaves, three treatments were implemented in sunflower plants growing with roots split between two compartments: a control (C) treatment supplying 100% of plant evapotranspiration, and two treatments receiving 50% of plant evapotranspiration, either evenly distributed to both compartments (deficit irrigation - DI) or unevenly distributed to ensure distinct wet and dry compartments (partial rootzone drying - PRD). Plants receiving the same amount of water responded differently under the two irrigation systems. After 3 days, evapotranspiration was similar in C and DI, but 20% less in PRD, concomitant with decreased leaf water potential (Ψleaf) and increased leaf xylem ABA concentration. Six water-stress responsive genes were highly induced in roots growing in the drying soil compartment of PRD plants, and their expression was best correlated with local soil water content. On the other hand, foliar gene expression differed significantly from that of the root and correlated better with xylem ABA concentration and Ψleaf. While the PRD irrigation strategy triggered stronger physiological and molecular responses, suggesting a more intense and systemic stress reaction due to local dehydration of the dry compartment of PRD plants, the DI strategy resulted in similar water savings without strongly inducing these responses. Correlating physiological and molecular responses in PRD/DI plants may provide insights into the severity and location of water deficits and may enable a better understanding of long-distance signalling mechanisms. PMID:25219304

  20. Quality assessment and yield of sunflower (Helianthus annuus L.) grown at multiple locations in Mississippi

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The hypothesis of this work was that sunflower could be grown as a cash crop in Mississippi and N and cultivar would alter oil yield, content, and composition. This study investigated the effect of N (0, 67, 134, and 202 kg ha-1), cultivar (DKF3875, DKF2990, DKF3510 and DKF3901) and their interactio...

  1. Characterization of partially purified milk-clotting enzyme from sunflower (Helianthus annuus) seeds.

    PubMed

    Nasr, Assia I A M; Mohamed Ahmed, Isam A; Hamid, Omer I A

    2016-09-01

    This study was aimed to extract milk-clotting enzyme from sunflower seeds and to determine its potentiality for manufacturing white soft cheese from cows and goats milk. The seeds were blended and extracted using two types of buffers and milk-clotting and proteolytic activities were evaluated. The enzyme was partially purified using ammonium sulfate fractionation techniques. Results indicated that sunflower seeds extracted with 5% NaCl in 50 mmol/L acetate buffer, pH 5.0, had the highest milk-clotting activity (MCA) and lowest coagulation time compared to that extracted with only acetate buffer (pH 5.0). Ammonium sulfate at 30-50% saturation purified the enzyme to 4.3 folds with MCA of 241.0 U/mL and final enzyme yield of 10.9%. The partially purified enzyme was characterized by SDS-PAGE that showed two bands with molecular weight of 120 and 62 kDa. When compared with other plant enzymes, the partially purified sunflower enzyme was found to have higher milk-clotting activity and lower proteolytic activity. Also, both milk sources and enzyme types significantly affected the cheese yield and curd formation time. The cheese made from cow milk using sunflower enzyme had higher yield compared to that obtained using commercial rennet, whereas the opposite was observed when using goat milk.

  2. Linear glandular trichomes of Helianthus (Asteraceae): morphology, localization, metabolite activity and occurrence

    PubMed Central

    Aschenbrenner, Anna-Katharina; Horakh, Silke; Spring, Otmar

    2013-01-01

    Capitate glandular trichomes of sunflower are well investigated, but detailed studies are lacking for the linear glandular trichomes (LGT), a second type of physiologically active plant hair present on the surface of sunflowers. Light, fluorescence and scanning electron microscopy as well as histochemical staining were used to investigate the structure and metabolite deposition of LGT. Consisting of 6–11 linearly arranged cells, LGT were found on the surface of most plant organs of Helianthus annuus. They were associated with the leaf vascular system, and also occurred along petioles, stems and the abaxial surface of chaffy bracts, ray and disc florets. The highest density was found on the abaxial surface of phyllaries. Phenotypically similar LGT were common in all species of the genus, but also occurred in most other genera of the Helianthinae so far screened. Brownish and fluorescent metabolites of an as yet unknown chemical structure, together with terpenoids, were produced and stored in apical cells of LGT. The deposition of compounds gradually progressed from the tip cell to the basal cells of older trichomes. This process was accompanied by nucleus degradation in metabolite-accumulating cells. The localization of these trichomes on prominent plant parts of the apical bud and the capitulum combined with the accumulation of terpenoids and other as yet unknown compounds suggests a chemo-ecological function of the LGT in plant–insect or plant–herbivore interaction.

  3. Collection of Helianthus exilis, an endemic serpentine sunflower of California

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Helianthus consists of 51 species (14 annual and 37 perennial), all restricted to North America. Serpentine sunflower, Helianthus exilis A. Gray, is endemic to the serpentine soils of the Coastal Range and Sierra Nevada mountains of California and is a potential source of useful genes for ...

  4. Identification and characterization of contrasting sunflower genotypes to early leaf senescence process combining molecular and physiological studies (Helianthus annuus L.).

    PubMed

    López Gialdi, A I; Moschen, S; Villán, C S; López Fernández, M P; Maldonado, S; Paniego, N; Heinz, R A; Fernandez, P

    2016-09-01

    Leaf senescence is a complex mechanism ruled by multiple genetic and environmental variables that affect crop yields. It is the last stage in leaf development, is characterized by an active decline in photosynthetic rate, nutrients recycling and cell death. The aim of this work was to identify contrasting sunflower inbred lines differing in leaf senescence and to deepen the study of this process in sunflower. Ten sunflower genotypes, previously selected by physiological analysis from 150 inbred genotypes, were evaluated under field conditions through physiological, cytological and molecular analysis. The physiological measurement allowed the identification of two contrasting senescence inbred lines, R453 and B481-6, with an increase in yield in the senescence delayed genotype. These findings were confirmed by cytological and molecular analysis using TUNEL, genomic DNA gel electrophoresis, flow sorting and gene expression analysis by qPCR. These results allowed the selection of the two most promising contrasting genotypes, which enables future studies and the identification of new biomarkers associated to early senescence in sunflower. In addition, they allowed the tuning of cytological techniques for a non-model species and its integration with molecular variables.

  5. Sunflower (Helianthus annuus) long-chain acyl-coenzyme A synthetases expressed at high levels in developing seeds.

    PubMed

    Aznar-Moreno, Jose A; Venegas Calerón, Mónica; Martínez-Force, Enrique; Garcés, Rafael; Mullen, Robert; Gidda, Satinder K; Salas, Joaquín J

    2014-03-01

    Long chain fatty acid synthetases (LACSs) activate the fatty acid chains produced by plastidial de novo biosynthesis to generate acyl-CoA derivatives, important intermediates in lipid metabolism. Oilseeds, like sunflower, accumulate high levels of triacylglycerols (TAGs) in their seeds to nourish the embryo during germination. This requires that sunflower seed endosperm supports very active glycerolipid synthesis during development. Sunflower seed plastids produce large amounts of fatty acids, which must be activated through the action of LACSs, in order to be incorporated into TAGs. We cloned two different LACS genes from developing sunflower endosperm, HaLACS1 and HaLACS2, which displayed sequence homology with Arabidopsis LACS9 and LACS8 genes, respectively. These genes were expressed at high levels in developing seeds and exhibited distinct subcellular distributions. We generated constructs in which these proteins were fused to green fluorescent protein and performed transient expression experiments in tobacco cells. The HaLACS1 protein associated with the external envelope of tobacco chloroplasts, whereas HaLACS2 was strongly bound to the endoplasmic reticulum. Finally, both proteins were overexpressed in Escherichia coli and recovered as active enzymes in the bacterial membranes. Both enzymes displayed similar substrate specificities, with a very high preference for oleic acid and weaker activity toward stearic acid. On the basis of our findings, we discuss the role of these enzymes in sunflower oil synthesis.

  6. Ecological patterns and genetic analysis of post-dispersal seed predation in sunflower (Helianthus annuus) crop-wild hybrids.

    PubMed

    Dechaine, Jennifer M; Burger, Jutta C; Burke, John M

    2010-08-01

    Crop-wild hybridization has been documented in many cultivated species, but the ecological and genetic factors that influence the likelihood or rate that cultivar alleles will introgress into wild populations are poorly understood. Seed predation is one factor that could mitigate the spread of otherwise advantageous cultivar alleles into the wild by reducing seedling recruitment of crop-like individuals in hybrid populations. Seed predation has previously been linked to several seed characters that differ between cultivated and wild sunflower, such as seed size and oil content. In this study, seed morphological and nutritional characters were measured in a segregating population of sunflower crop-wild hybrids and wild and cultivated lines. Seed predation rates among lines were then assessed in the field. The relationship between seed predation and seed characters was investigated and quantitative trait loci (QTL) were mapped for all traits. There was no effect of seed type (hybrid vs. parents) on seed predation, although a trend toward more early predation of wild seeds was observed. Within the hybrids, seed predators preferred seeds that contained more oil and energy but were lower in fibre. The relationship between seed predation and oil content was supported by co-localized QTL for these traits on one linkage group. These results suggest that oil content may be a more important determinant of seed predation than seed size and provide molecular genetic evidence for this relationship. The cultivar allele was also found to increase predation at all QTL, indicating that post-dispersal seed predation may mitigate the spread of cultivar alleles into wild populations.

  7. Influence of specific fatty acids on the asymmetric distribution of saturated fatty acids in sunflower (Helianthus annuus L.) triacylglycerols.

    PubMed

    Martínez-Force, Enrique; Ruiz-López, Noemi; Garcés, Rafael

    2009-02-25

    The 1,3-random-2-random theory was proposed several years ago to explain the fatty acid distribution in vegetable oil triacylglycerols. However, by demonstrating an asymmetry between positions sn-1 and sn-3 in olive oil, cocoa butter, sunflower oil, etc., a number of studies have shown that this theory does not hold true for some oils and fatty acids. Accordingly, the distribution of fatty acids in sunflower triacylglycerols has been studied, calculating the alpha coefficient of asymmetry in several combinations of standard linoleic, high-oleic, and high-stearic sunflower oils. The results obtained from the oils of these lines and from single seed oil samples indicate that the asymmetry for saturated fatty acids is greater in high-oleic than in standard linoleic backgrounds. Hence, the distribution of the fatty acids within the triacylglycerol molecule appears to depend not only on the fatty acid under study but also on the other fatty acids in the oil. Thus, it is demonstrated for the first time that certain fatty acids can influence the distribution of other fatty acids within triacylglycerols.

  8. Accumulation of cadmium, zinc, and copper by Helianthus annuus L.: impact on plant growth and uptake of nutritional elements.

    PubMed

    Rivelli, Anna Rita; De Maria, Susanna; Puschenreiter, Markus; Gherbin, Piergiorgio

    2012-04-01

    We investigated the effects on physiological response, trace elements and nutrients accumulation of sunflower plants grown in soil contaminated with: 5 mg kg(-1) of Cd; 5 and 300 mg kg(-1) of Cd and Zn, respectively; 5, 300, and 400 mg kg(-1) of Cd, Zn, and Cu, respectively. Contaminants applied did not produce large effects on growth, except in Cd-Zn-Cu treatment in which leaf area and total dry matter were reduced, by 15%. The contamination with Cd alone did not affect neither growth nor physiological parameters, despite considerable amounts of Cd accumulated in roots and older leaves, with a high bioconcentration factor from soil to plant. By adding Zn and then Cu to Cd in soil, significant were the toxic effects on chlorophyll content and water relations due to greater accumulation of trace elements in tissues, with imbalances in nutrients uptake. Highly significant was the interaction between shoot elements concentration (Cd, Zn, Cu, Fe, Mg, K, Ca) and treatments. Heavy metals concentrations in roots always exceeded those in stem and leaves, with a lower translocation from roots to shoots, suggesting a strategy of sunflower to compartmentalise the potentially toxic elements in physiologically less active parts in order to preserve younger tissues. PMID:22567714

  9. Identification and characterization of contrasting sunflower genotypes to early leaf senescence process combining molecular and physiological studies (Helianthus annuus L.).

    PubMed

    López Gialdi, A I; Moschen, S; Villán, C S; López Fernández, M P; Maldonado, S; Paniego, N; Heinz, R A; Fernandez, P

    2016-09-01

    Leaf senescence is a complex mechanism ruled by multiple genetic and environmental variables that affect crop yields. It is the last stage in leaf development, is characterized by an active decline in photosynthetic rate, nutrients recycling and cell death. The aim of this work was to identify contrasting sunflower inbred lines differing in leaf senescence and to deepen the study of this process in sunflower. Ten sunflower genotypes, previously selected by physiological analysis from 150 inbred genotypes, were evaluated under field conditions through physiological, cytological and molecular analysis. The physiological measurement allowed the identification of two contrasting senescence inbred lines, R453 and B481-6, with an increase in yield in the senescence delayed genotype. These findings were confirmed by cytological and molecular analysis using TUNEL, genomic DNA gel electrophoresis, flow sorting and gene expression analysis by qPCR. These results allowed the selection of the two most promising contrasting genotypes, which enables future studies and the identification of new biomarkers associated to early senescence in sunflower. In addition, they allowed the tuning of cytological techniques for a non-model species and its integration with molecular variables. PMID:27457982

  10. Differential expression of seven conserved microRNAs in response to abiotic stress and their regulatory network in Helianthus annuus.

    PubMed

    Ebrahimi Khaksefidi, Reyhaneh; Mirlohi, Shirin; Khalaji, Fahimeh; Fakhari, Zahra; Shiran, Behrouz; Fallahi, Hossein; Rafiei, Fariba; Budak, Hikmet; Ebrahimie, Esmaeil

    2015-01-01

    Biotic and abiotic stresses affect plant development and production through alternation of the gene expression pattern. Gene expression itself is under the control of different regulators such as miRNAs and transcription factors (TFs). MiRNAs are known to play important roles in regulation of stress responses via interacting with their target mRNAs. Here, for the first time, seven conserved miRNAs, associated with drought, heat, salt and cadmium stresses were characterized in sunflower. The expression profiles of miRNAs and their targets were comparatively analyzed between leaves and roots of plants grown under the mentioned stress conditions. Gene ontology analysis of target genes revealed that they are involved in several important pathways such as auxin and ethylene signaling, RNA mediated silencing and DNA methylation processes. Gene regulatory network highlighted the existence of cross-talks between these stress-responsive miRNAs and the other stress responsive genes in sunflower. Based on network analysis, we suggest that some of these miRNAs in sunflower such as miR172 and miR403 may play critical roles in epigenetic responses to stress. It seems that depending on the stress type, theses miRNAs target several pathways and cellular processes to help sunflower to cope with drought, heat, salt and cadmium stress conditions in a tissue-associated manner. PMID:26442054

  11. Enhanced Accumulation of Copper and Lead in Amaranth (Amaranthus paniculatus), Indian Mustard (Brassica juncea) and Sunflower (Helianthus annuus)

    PubMed Central

    Rahman, Motior M.; Azirun, Sofian M.; Boyce, Amru N.

    2013-01-01

    Background Soil contamination by copper (Cu) and lead (Pb) is a widespread environmental problem. For phytoextraction to be successful and viable in environmental remediation, strategies that can improve plant uptake must be identified. In the present study we investigated the use of nitrogen (N) fertilizer as an efficient way to enhance accumulation of Cu and Pb from contaminated industrial soils into amaranth, Indian mustard and sunflower. Methods/Principal Findings Plants were grown in a greenhouse and fertilized with N fertilizer at rates of 0, 190 and 380 mg kg−1 soil. Shoots, roots and total accumulation of Cu and Pb, transfer factor (TF), translocation index were assessed to evaluate the transport and translocation ability of tested plants. Addition of N fertilizer acidified the industrial soil and caused the pH to decrease to 5.5 from an initial pH of 6.9. Industrial soil amended with N fertilizer resulted in the highest accumulation of Pb and Cu (for Pb 10.1–15.5 mg kg−1, for Cu 11.6–16.8 mg kg−1) in the shoots, which was two to four folds higher relative to the concentration in roots in all the three plants used. Sunflower removed significantly higher Pb (50–54%) and Cu (34–38%) followed by amaranth and Indian mustard from industrial soils with the application of N fertilizer. The TF was <1 while the shoot and root concentration (SC/RC) ratios of Pb and Cu were between 1.3–4.3 and 1.8–3.8, respectively, regardless of plant species. Conclusions Sunflower is the best plant species to carry out phytoextraction of Pb and Cu. In contrast, Pb and Cu removal by Indian mustard and amaranth shows great potential as quick and short duration vegetable crops. The results suggest that the application of N fertilizer in contaminated industrial soil is an effective amendment for the phytoextraction of Pb and Cu from contaminated industrial soils. PMID:23667546

  12. Anther culture in Helianthus annuus L., influence of genotype and culture conditions on embryo induction and plant regeneration.

    PubMed

    Thengane, S R; Joshi, M S; Khuspe, S S; Mascarenhas, A F

    1994-01-01

    Production of microspore-derived embryos from cultured anthers is now a well established technique for the isolation of homozygous lines in many crop plants. We describe here a culture method for embryo induction and plant regeneration from anthers of four sunflower genotypes. For preliminary experiments, anthers of uninucleate microspores were cultured on four types of basal media viz., Murashige and Skoog's MS, Gamborg's B5, Nitsch and Nitsch, and White's W, supplemented with 1.0 mg/l 2,4 dichlorophenoxy acetic acid and 0.5 mg/l 6-benzylaminopurine and 40 g/l sucrose. MS basal medium, being more responsive for embryo induction, was used for further experimentation. To optimise the culture requirement MS basal medium was supplemented with 0.2-2.0 mg/l 2,4 dichlorophenoxy acetic acid and 0.5 and 1.0 mg/l 6-benzylaminopurine. The effect of cold pretreatment, hormone regime and sucrose concentration were tested for embryogenic efficiency. Genotype had a significant effect on the capacity of embryo induction. Addition of silver nitrate (2.5 mg/l), an ethylene inhibitor, stimulated embryo germination. Plantlets were obtained (10-15%) from embryos of only one genotype.

  13. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.).

    PubMed

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander

    2015-12-01

    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact.

  14. Morphological variation of mutant sunflowers (Helianthus annuus) induced by space flight and their genetic background detection by SSR primers.

    PubMed

    Yang, J; Shen, S; Zhang, T; Chen, G D; Liu, H; Ma, X B; Chen, W Y; Peng, Z S

    2012-09-25

    After sunflower seeds were exposed to space conditions, various mutant plants were screened from the descendent plants. The morphological characters of plants changed in flower color from golden to yellow, light yellow, or even to yellowish green. The ligulate petals of the unisexual floret broadened, or became thin, while the short tubular petals of bisexual floret elongated to some extent, or even turned into semi-ligulate petals or ligulate petals, making the phenotype of the whole inflorescence like a chrysanthemum. The shape and thickness of leaves varied in some of these plants. Absolute sterile plants in mutant plants were found to possess neither normal bisexual florets nor unisexual florets, but the "pseudo-floret" only consisted of pieces of shield-like bracts on protuberant floral disc. Thirty-five pairs of simple sequence of repeat primers were used to detect the genetic variation of the plants, and the results showed that only a variation was tested in the mutant plants from 4 primers. The different PCR products obtained were extracted for sequencing and alignment analysis, and the aligned results showed that the DNA sequence changed by deletion, insertion and replacement that occurred at some sites. The results proved the high mutagenic efficacy of space flight, and ways of DNA transformation due to space conditions.

  15. Glycolytic enzymatic activities in developing seeds involved in the differences between standard and low oil content sunflowers (Helianthus annuus L.).

    PubMed

    Troncoso-Ponce, M Adrián; Garcés, Rafael; Martínez-Force, Enrique

    2010-12-01

    As opposed to other oilseeds, developing sunflower seeds do not accumulate starch initially. They rely on the sucrose that comes from the mother plant to synthesise lipid precursors. Glycolysis is the principal source of carbon skeletons and reducing power for lipid biosynthesis. In this work, glycolytic initial metabolites and enzyme activities from developing seed of two different sunflower lines, of high and low oil content, were compared during storage lipid synthesis. These two lines showed different kinetic lipid accumulation in the developing embryos. Fatty acids levels during the initial and final stage of lipid synthesis were higher in CAS-6 than in ZEN-8. The analysis of the photosynthate and sugars content suggests that, although the hexoses levels were quite similar in both lines, the amount of sucrose produced by the mother plant and available for lipid synthesis was higher in CAS-6. Although, a smaller amount of sucrose is available in the ZEN-8 line, its seeds maintain the levels of intermediate sugars in the initial steps of glycolysis due to an increase in the levels of the invertase, hexokinase and phosphoglucose isomerase activities in ZEN-8, with respect to CAS-6. Also, a readjustment in the final part of this metabolic route took place, with the activities of phosphoglycerate kinase and enolase in CAS-6 being higher, allowing increased synthesis of phosphoenolpiruvate, the intermediate carbon donor for fatty acid synthesis. In addition, recently, it has been shown that Arabidopsis mutants with a lower fat content in their seeds have a higher amount of sucrose. These data together point to these last two enzymatic activities, phosphoglycerate kinase and enolase, as being responsible for the lower fat content in the ZEN-8 line.

  16. Impact of extraneous proteins on the gastrointestinal fate of sunflower seed (Helianthus annuus) oil bodies: a simulated gastrointestinal tract study.

    PubMed

    Makkhun, Sakunkhun; Khosla, Amit; Foster, Tim; McClements, David Julian; Grundy, Myriam M L; Gray, David A

    2015-01-01

    In this study, we examined the physicochemical nature of sunflower seed oil bodies (in the absence and presence of added protein) exposed to gastrointestinal conditions in vitro: crude oil bodies (COB); washed oil bodies (WOB); whey protein isolate-enriched oil bodies (WOB-WPI); and, sodium caseinate enriched-oil bodies (WOB-SC). All oil body emulsions were passed through an in vitro digestion model that mimicked the stomach and duodenal environments, and their physicochemical properties were measured before, during, and after digestion. Oil bodies had a positive charge under gastric conditions because the pH was below the isoelectric point of the adsorbed protein layer, but they had a negative charge under duodenal conditions which was attributed to changes in interfacial composition resulting from adsorption of bile salts. Oil bodies were highly susceptible to flocculation and coalescence in both gastric and duodenal conditions. SDS-PAGE analysis indicated degradation of oleosin proteins (ca. 18-21 kDa) to a greater or lesser extent (dependent on the emulsion) during the gastric phase in all emulsions tested; there is evidence that some oleosin remained intact in the crude oil body preparation during this phase of the digestion process. Measurements of protein displacement from the surface of COBs during direct exposure to bile salts, without inclusion of a gastric phase, indicated the removal of intact oleosin from native oil bodies.

  17. Physical behavior of purified and crude wax obtained from sunflower (Helianthus annuus) seed oil refineries and seed hulls.

    PubMed

    Kanya, T C Sindhu; Sankar, K Udaya; Sastry, M C Shamnathaka

    2003-01-01

    The sunflower seed waxes obtained from two sources (i) seed hull as a standard and (ii) crude wax from oil refineries were studied for their crystallization, melting characteristics and morphology of crystals. The results of differential scanning calorimetry of wax obtained from seed hulls showed the melting temperature range of 13.18 degrees C with the onset at 62.32 degrees C, for purified wax, compared to the melting range of 24.73 degrees C with the onset at 42.3 degrees C. for crude wax. The enthalpy of fusion for both waxes were 57.55 mcal/mg and 7.63 mcal/mg, respectively. The DSC melt crystallization temperature range was 15.79 degrees C with the onset of 64.58 degrees C for purified wax and temperature range of 31.45 degrees C with an onset of 57.76 degrees C for crude wax. A similar pattern was observed of wax obtained from the crude wax of oil refineries. The enthalpy of crystallization was -64.27 mcal/mg and -7.67 mcal/mg, respectively. The purified wax obtained from the two sources (i) and (ii) were comparable with completion temperatures of 75.5 degrees C and 75.1 degrees C, respectively. The effect of inhibitor (lecithin) on crystallization of purified wax under light microscope and surface structure by scanning electron microscope were observed. Lecithin at 0.2% inhibited the crystallization but nucleation was unaltered. The wax crystal was inhibited to around 60% of the original size with 0.2% lecithin. It is concluded that the sunflower waxes studied were not comparable in their crystal properties of crude and purified states. Lecithin inhibited the crystallization of sunflower seed wax.

  18. Ecological patterns and genetic analysis of post-dispersal seed predation in sunflower (Helianthus annuus) crop-wild hybrids.

    PubMed

    Dechaine, Jennifer M; Burger, Jutta C; Burke, John M

    2010-08-01

    Crop-wild hybridization has been documented in many cultivated species, but the ecological and genetic factors that influence the likelihood or rate that cultivar alleles will introgress into wild populations are poorly understood. Seed predation is one factor that could mitigate the spread of otherwise advantageous cultivar alleles into the wild by reducing seedling recruitment of crop-like individuals in hybrid populations. Seed predation has previously been linked to several seed characters that differ between cultivated and wild sunflower, such as seed size and oil content. In this study, seed morphological and nutritional characters were measured in a segregating population of sunflower crop-wild hybrids and wild and cultivated lines. Seed predation rates among lines were then assessed in the field. The relationship between seed predation and seed characters was investigated and quantitative trait loci (QTL) were mapped for all traits. There was no effect of seed type (hybrid vs. parents) on seed predation, although a trend toward more early predation of wild seeds was observed. Within the hybrids, seed predators preferred seeds that contained more oil and energy but were lower in fibre. The relationship between seed predation and oil content was supported by co-localized QTL for these traits on one linkage group. These results suggest that oil content may be a more important determinant of seed predation than seed size and provide molecular genetic evidence for this relationship. The cultivar allele was also found to increase predation at all QTL, indicating that post-dispersal seed predation may mitigate the spread of cultivar alleles into wild populations. PMID:20637050

  19. Differential expression of seven conserved microRNAs in response to abiotic stress and their regulatory network in Helianthus annuus

    PubMed Central

    Ebrahimi Khaksefidi, Reyhaneh; Mirlohi, Shirin; Khalaji, Fahimeh; Fakhari, Zahra; Shiran, Behrouz; Fallahi, Hossein; Rafiei, Fariba; Budak, Hikmet; Ebrahimie, Esmaeil

    2015-01-01

    Biotic and abiotic stresses affect plant development and production through alternation of the gene expression pattern. Gene expression itself is under the control of different regulators such as miRNAs and transcription factors (TFs). MiRNAs are known to play important roles in regulation of stress responses via interacting with their target mRNAs. Here, for the first time, seven conserved miRNAs, associated with drought, heat, salt and cadmium stresses were characterized in sunflower. The expression profiles of miRNAs and their targets were comparatively analyzed between leaves and roots of plants grown under the mentioned stress conditions. Gene ontology analysis of target genes revealed that they are involved in several important pathways such as auxin and ethylene signaling, RNA mediated silencing and DNA methylation processes. Gene regulatory network highlighted the existence of cross-talks between these stress-responsive miRNAs and the other stress responsive genes in sunflower. Based on network analysis, we suggest that some of these miRNAs in sunflower such as miR172 and miR403 may play critical roles in epigenetic responses to stress. It seems that depending on the stress type, theses miRNAs target several pathways and cellular processes to help sunflower to cope with drought, heat, salt and cadmium stress conditions in a tissue-associated manner. PMID:26442054

  20. Selection on crop-derived traits and QTL in sunflower (Helianthus annuus) crop-wild hybrids under water stress.

    PubMed

    Owart, Birkin R; Corbi, Jonathan; Burke, John M; Dechaine, Jennifer M

    2014-01-01

    Locally relevant conditions, such as water stress in irrigated agricultural regions, should be considered when assessing the risk of crop allele introgression into wild populations following hybridization. Although research in cultivars has suggested that domestication traits may reduce fecundity under water stress as compared to wild-like phenotypes, this has not been investigated in crop-wild hybrids. In this study, we examine phenotypic selection acting on, as well as the genetic architecture of vegetative, reproductive, and physiological characteristics in an experimental population of sunflower crop-wild hybrids grown under wild-like low water conditions. Crop-derived petiole length and head diameter were favored in low and control water environments. The direction of selection differed between environments for leaf size and leaf pressure potential. Interestingly, the additive effect of the crop-derived allele was in the direction favored by selection for approximately half the QTL detected in the low water environment. Selection favoring crop-derived traits and alleles in the low water environment suggests that a subset of these alleles would be likely to spread into wild populations under water stress. Furthermore, differences in selection between environments support the view that risk assessments should be conducted under multiple locally relevant conditions.

  1. Evaluation and characterisation of Citrullus colocynthis (L.) Schrad seed oil: Comparison with Helianthus annuus (sunflower) seed oil.

    PubMed

    Nehdi, Imededdine Arbi; Sbihi, Hassen; Tan, Chin Ping; Al-Resayes, Saud Ibrahim

    2013-01-15

    The physicochemical properties, fatty acid, tocopherol, thermal properties, (1)H NMR, FTIR and profiles of non-conventional oil extracted from Citrullus colocynthis (L.) Schrad seeds were evaluated and compared with conventional sunflower seed oil. In addition, the antioxidant properties of C. colocynthis seed oil were also evaluated. The oil content of the C. colocynthis seeds was 23.16%. The main fatty acids in the oil were linoleic acid (66.73%) followed by oleic acid (14.78%), palmitic acid (9.74%), and stearic acid (7.37%). The tocopherol content was 121.85 mg/100g with γ-tocopherol as the major one (95.49%). The thermogravimetric analysis showed that the oil was thermally stable up to 286.57°C, and then began to decompose in four stages namely at 377.4°C, 408.4°C, 434.9°C and 559.2°C. The present study showed that this non-conventional C. colocynthis seed oil can be used for food and non-food applications to supplement or replace some of the conventional oils.

  2. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.).

    PubMed

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander

    2015-12-01

    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact. PMID:26194244

  3. Selection on Crop-Derived Traits and QTL in Sunflower (Helianthus annuus) Crop-Wild Hybrids under Water Stress

    PubMed Central

    Owart, Birkin R.; Corbi, Jonathan; Burke, John M.; Dechaine, Jennifer M.

    2014-01-01

    Locally relevant conditions, such as water stress in irrigated agricultural regions, should be considered when assessing the risk of crop allele introgression into wild populations following hybridization. Although research in cultivars has suggested that domestication traits may reduce fecundity under water stress as compared to wild-like phenotypes, this has not been investigated in crop-wild hybrids. In this study, we examine phenotypic selection acting on, as well as the genetic architecture of vegetative, reproductive, and physiological characteristics in an experimental population of sunflower crop-wild hybrids grown under wild-like low water conditions. Crop-derived petiole length and head diameter were favored in low and control water environments. The direction of selection differed between environments for leaf size and leaf pressure potential. Interestingly, the additive effect of the crop-derived allele was in the direction favored by selection for approximately half the QTL detected in the low water environment. Selection favoring crop-derived traits and alleles in the low water environment suggests that a subset of these alleles would be likely to spread into wild populations under water stress. Furthermore, differences in selection between environments support the view that risk assessments should be conducted under multiple locally relevant conditions. PMID:25048600

  4. Rhizosphere colonization and arsenic translocation in sunflower (Helianthus annuus L.) by arsenate reducing Alcaligenes sp. strain Dhal-L.

    PubMed

    Cavalca, Lucia; Corsini, Anna; Bachate, Sachin Prabhakar; Andreoni, Vincenza

    2013-10-01

    In the present study, six arsenic-resistant strains previously isolated were tested for their plant growth promoting characteristics and heavy metal resistance, in order to choose one model strain as an inoculum for sunflower plants in pot experiments. The aim was to investigate the effect of arsenic-resistant strain on sunflower growth and on arsenic uptake from arsenic contaminated soil. Based on plant growth promoting characteristics and heavy metal resistance, Alcaligenes sp. strain Dhal-L was chosen as an inoculum. Beside the ability to reduce arsenate to arsenite via an Ars operon, the strain exhibited 1-amino-cyclopropane-1-carboxylic acid deaminase activity and it was also able to produce siderophore and indole acetic acid. Pot experiments were conducted with an agricultural soil contaminated with arsenic (214 mg kg⁻¹). A real time PCR method was set up based on the quantification of ACR3(2) type of arsenite efflux pump carried by Alcaligenes sp. strain Dhal-L, in order to monitor presence and colonisation of the strain in the bulk and rhizospheric soil. As a result of strain inoculation, arsenic uptake by plants was increased by 53 %, whereas ACR3(2) gene copy number in rhizospheric soil was 100 times higher in inoculated than in control pots, indicating the colonisation of strain. The results indicated that the presence of arsenate reducing strains in the rhizosphere of sunflower influences arsenic mobilization and promotes arsenic uptake by plant.

  5. Search for Allergens from the Pollen Proteome of Sunflower (Helianthus annuus L.): A Major Sensitizer for Respiratory Allergy Patients

    PubMed Central

    Saha, Bodhisattwa; Pandey, Naren; Gupta Bhattacharya, Swati

    2015-01-01

    Background Respiratory allergy triggered by pollen allergens is increasing at an alarming rate worldwide. Sunflower pollen is thought to be an important source of inhalant allergens. Present study aims to identify the prevalence of sunflower pollinosis among the Indian allergic population and characterizes the pollen allergens using immuno-proteomic tools. Methodology Clinico-immunological tests were performed to understand the prevalence of sensitivity towards sunflower pollen among the atopic population. Sera from selected sunflower positive patients were used as probe to detect the IgE-reactive proteins from the one and two dimensional electrophoretic separated proteome of sunflower pollen. The antigenic nature of the sugar moiety of the glycoallergens was studied by meta-periodate modification of IgE-immunoblot. Finally, these allergens were identified by mass-spectrometry. Results Prevalence of sunflower pollen sensitization was observed among 21% of the pollen allergic population and associated with elevated level of specific IgE and histamine in the sera of these patients. Immunoscreening of sunflower pollen proteome with patient sera detected seven IgE-reactive proteins with varying molecular weight and pI. Hierarchical clustering of 2D-immunoblot data highlighted three allergens characterized by a more frequent immuno-reactivity and increased levels of IgE antibodies in the sera of susceptible patients. These allergens were considered as the major allergens of sunflower pollen and were found to have their glycan moiety critical for inducing IgE response. Homology driven search of MS/MS data of these IgE-reactive proteins identified seven previously unreported allergens from sunflower pollen. Three major allergenic proteins were identified as two pectate lyases and a cysteine protease. Conclusion Novelty of the present report is the identification of a panel of seven sunflower pollen allergens for the first time at immuno-biochemical and proteomic level, which substantiated the clinical evidence of sunflower allergy. Further purification and recombinant expression of these allergens will improve component-resolved diagnosis and therapy of pollen allergy. PMID:26418046

  6. Modelled hydraulic redistribution by sunflower (Helianthus annuus L.) matches observed data only after including night-time transpiration.

    PubMed

    Neumann, Rebecca B; Cardon, Zoe G; Teshera-Levye, Jennifer; Rockwell, Fulton E; Zwieniecki, Maciej A; Holbrook, N Michele

    2014-04-01

    The movement of water from moist to dry soil layers through the root systems of plants, referred to as hydraulic redistribution (HR), occurs throughout the world and is thought to influence carbon and water budgets and ecosystem functioning. The realized hydrologic, biogeochemical and ecological consequences of HR depend on the amount of redistributed water, whereas the ability to assess these impacts requires models that correctly capture HR magnitude and timing. Using several soil types and two ecotypes of sunflower (Helianthus annuus L.) in split-pot experiments, we examined how well the widely used HR modelling formulation developed by Ryel et al. matched experimental determination of HR across a range of water potential driving gradients. H. annuus carries out extensive night-time transpiration, and although over the last decade it has become more widely recognized that night-time transpiration occurs in multiple species and many ecosystems, the original Ryel et al. formulation does not include the effect of night-time transpiration on HR. We developed and added a representation of night-time transpiration into the formulation, and only then was the model able to capture the dynamics and magnitude of HR we observed as soils dried and night-time stomatal behaviour changed, both influencing HR.

  7. Broomrape (Orobanche cumana Wallr.) resistance breeding utilizing wild Helianthus species

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wild Helianthus species possess valuable resistance genes for sunflower broomrape (Orobanche cumana Wallr.), especially the 39 largely under-utilized perennial species. Resistance to race F has been transferred into cultivated background via bridging of interspecific amphiploids. More recently, a si...

  8. Helianthus Porteri as a Potential Source for Enhancing the Linoleic Acid Concentration in Sunflower Oil

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Confederate Daisy, or Porter's Golden-Eye, Helianthus porteri, formerly known as Viguiera porteri, is an annual sunflower that was recently transferred to the genus Helianthus. It occurs in and around granite outcroppings in the Piedmont regions of North and South Carolina, Alabama, and Georgia. Wil...

  9. Evaluation of Helianthus porteri Achenes for Oil Concentration and Fatty Acid Composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Confederate daisy, or Porter's Golden-Eye, Helianthus porteri, formerly known as Viguiera porteri is an annual sunflower that was recently transferred to the genus Helianthus. It is an endemic species that occurs in and around granite outcroppings in the Piedmont regions of North and South Carolina,...

  10. Helianthus porteri as a Potential Source for Enhancing Linoleic Acid Concentration in Sunflower Oil

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Confederate Daisy, or Porter's Golden-Eye, Helianthus porteri, formerly known as Viguiera porteri, is an annual sunflower that was recently transferred to the genus Helianthus. It occurs in and around granite outcroppings in the Piedmont regions of North and South Carolina, Alabama, and Georgia. Wil...

  11. Evaluation of achene oil of Helianthus porteri for fatty acid composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Confederate daisy, or Porter's Golden-Eye, Helianthus porteri (A. Gray) Pruski, formerly known as Viguiera porteri (A. Gray) S.F. Blake, is an annual sunflower that was recently transferred to the genus Helianthus. It occurs in and around granite outcroppings in the Piedmont regions of North and Sou...

  12. Transferring sclerotinia resistance genes from wild perennial Helianthus species into cultivated sunflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Due to the lack of highly tolerant cultivated sunflower germplasm, new sources of Sclerotinia resistance from wild Helianthus species need to be identified and incorporated into a cultivated background. Wild perennial Helianthus species are highly resistant to Sclerotinia and have provided good sou...

  13. Potential of Brassic rapa, Cannabis sativa, Helianthus annuus and Zea mays for phytoextraction of heavy metals from calcareous dredged sediment derived soils.

    PubMed

    Meers, E; Ruttens, A; Hopgood, M; Lesage, E; Tack, F M G

    2005-10-01

    Remediation of soil pollution is one of the many current environmental challenges. Anthropogenic activity has resulted in the contamination of extended areas of land, the remediation of which is both invasive and expensive by conventional means. Phytoextraction of heavy metals from contaminated soils has the prospect of being a more economic in situ alternative. In addition, phytoextraction targets ecotoxicologically the most relevant soil fraction of these metals, i.e. the bioavailable fraction. Greenhouse experiments were carried out to evaluate the potential of four high biomass crop species in their potential for phytoextraction of heavy metals, with or without with the use of soil amendments (EDTA or EDDS). A calcareous dredged sediment derived surface soil, with high organic matter and clay content and moderate levels of heavy metal pollution, was used in the experiments. No growth depression was observed in EDTA or EDDS treated pots in comparison to untreated controls. Metal accumulation was considered to be low for phytoextraction purposes, despite the use of chelating agents. The low observed shoot concentrations of heavy metals were attributed to the low phytoavailability of heavy metals in this particular soil substrate. The mobilising effects induced by EDTA in the soil were found to be too long-lived for application as a soil amendment in phytoextraction. Although EDDS was found to be more biodegradable, higher effect half lives were observed than reported in literature or observed in previous experiments. These findings caution against the use of any amendment, biodegradable or otherwise, without proper investigation of its effects and the longevity thereof.

  14. Relocation of a rust resistance gene R2 and its marker-assisted gene pyramiding in confection sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Rust (caused by Puccinia helianthi Schwein.) is a major disease of sunflower worldwide. Due to the frequent evolution of new pathogen races, the disease is a recurring threat to sunflower production especially in North America, Argentina, and Australia. The inbred line MC29 carries the rust resistan...

  15. Influence of thiourea application on some physiological and molecular criteria of sunflower (Helianthus annuus L.) plants under conditions of heat stress.

    PubMed

    Akladious, Samia Ageeb

    2014-05-01

    High temperature is a major factor limiting the growth of plant species during summer. Understanding the mechanisms of plant tolerance to high temperature would help in developing effective management practices and heat-tolerant cultivars through breeding or biotechnology. The present investigation was carried out to study the role of thiourea in enhancing the tolerance of sunflower plants to heat stress. Sunflower plants were subjected to temperature stress by exposing plants to 35 or 45 °C for 12 h. Two levels of thiourea (10 and 20 mM) were applied before sowing (seed treatment). The results indicated that the plants exposed to temperature stress exhibited a significant decline in growth parameters, chlorophylls, relative leaf water content, oil content, leaf nutrient status, and nitrate reductase activity. Treatment with thiourea, especially when applied at 10 mM, improved the above parameters and induced non-enzymatic and enzymatic antioxidants responsible for antioxidation. SDS-PAGE of protein revealed that high-temperature treatments alone or in combination with thiourea were associated with the disappearance of some bands or the appearance of unique ones. The result of RAPD analysis using five primers showed variable qualitative and quantitative changes. These findings confirm the effectiveness of applying thiourea on alleviating heat injuries in sunflower plants.

  16. Mapping and analysis of quantitative trait loci for grain oil content and agronomic traits using AFLP and SSR in sunflower ( Helianthus annuus L.).

    PubMed

    Mokrani, L; Gentzbittel, L; Azanza, F; Fitamant, L; Al-Chaarani, G; Sarrafi, A

    2002-12-01

    Crosses were made between two inbred lines of sunflower. Parents and 118 F(3) families were planted in the field in a randomized complete block design in two replications. Genetic control for some agronomical traits: grain weight by plant (GWP), 1,000-grain weight (TGW), percentage of oil in grain (POG) and sowing to flowering date (STF) was investigated in F(3) families and their parents. Genetic variability was observed among the 118 F(3) families for all the traits studied. Genetic gain was obtained when the best F(3) family, or the mean of 10% of the selected families was compared with the best parent for GWP, TWG and POG. Heritability was 0.23 for GWP, 0.55 for TGW, 0.57 for POG and 0.32 for STF. A set of 244 F(3) families from the same cross, including the above 118 mentioned families and their two parents, were screened with 276 AFLP and microsatellite markers and a linkage map was constructed based on 170 markers. Two putative QTLs for the GWP trait ( gmp), one QTL for TGW ( tgw), six QTLs for POG ( pog) and two for STF ( stf) were detected. The percentage of phenotypic variance explained by each QTL ranged from 2.6% to 70.9%. The percentage of total phenotypic variance explained was 50.7% for GWP, 5.4% for TGW, 90.4% for POG and 89.3% for STF. Although these regions need to be more-precisely mapped, the information obtained should help in marker-assisted selection.

  17. The effect of subambient to elevated atmospheric CO2 concentration on vascular function in Helianthus annuus: Implications for plant response to climate change

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Plant gas-exchange is regulated by stomata, which co-ordinate leaf-level water loss with xylem transport. Stomatal opening responds to internal levels of CO2 in the leaf but changing CO2 can also lead to changes in stomatal density that influence transpiration. Given that stomatal conductance increa...

  18. Oleate Coated Magnetic Cores Based on Magnetite, Zn Ferrite and Co Ferrite Nanoparticles - Preparation, Physical Characterization and Biological Impact on Helianthus Annuus Photosynthesis

    SciTech Connect

    Ursache-Oprisan, Manuela; Foca-nici, Ecaterina; Cirlescu, Aurelian; Caltun, Ovidiu; Creanga, Dorina

    2010-12-02

    Sodium oleate was used as coating shell for magnetite, Zn ferrite and Co ferrite powders to stabilize them in the form of aqueous magnetic suspensions. The physical characterization was carried out by applying X-ray diffraction and magnetization measurements. Both crystallite size and magnetic core diameter ranged between 7 and 11 nm. The influence of magnetic nanoparticle suspensions (corresponding to magnetic nanoparticle levels of 10{sup -14}-10{sup -15}/cm{sup 3}) on sunflower seedlings was studied considering the changes in the photosynthesis pigment levels. Similar responses were obtained for magnetite and cobalt ferrite nanoparticle treatment consisting in the apparent inhibition of chlorophyll biosynthesis while for zinc ferrite nanoparticles some concentrations seemed to have stimulatory effects on the chlorophylls as well as on the carotene levels. But the chlorophyll ratio was diminished in the case of all three types of magnetic nanoparticles meaning their slight negative effect on the light harvesting complex II (LHC II) from the chloroplast membranes and consequently on the photosynthesis efficiency.

  19. Map saturation and SNP marker development for the rust resistance genes (R4, R5, R13a, and R13b) in sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower rust, which is incited by the fungus Puccinia helianthi Schwein., is the most common disease in Australia, Argentina, South Africa, and North America. Three independent genes, R5, R4, and R13 with two alleles R13a and R13b, were discovered in sunflower and are promising sources of resistan...

  20. [Polymorphism among RFL-PPR homologs in sunflower (Helianthus annuus L.) lines with varying ability for the suppression of the cytoplasmic male sterility phenotype].

    PubMed

    Anisimova, I N; Alpatieva, N V; Rozhkova, V T; Kuznetsova, E B; Pinaev, A G; Gavrilova, V A

    2014-07-01

    A complex comparative genetic approach was used for the investigation of the structural and functional diversity of genes for the restoration of sunflower pollen fertility. It includes (i) hybridological analysis; (ii) analysis of polymorphism among EST fragments.homologous to the known Rf genes that contain repeated motives of 35 amino acids (RFL-PPR); (iii) the development of molecular markers. Monogenic segregation in three interline cross combinations and the results of molecular marker analysis confirmed the allelic differences of parental lines in the Mendelian locus for CMS PET1 pollen fertility restoration. Introns were found in two RFL-PPR fragments. Two allelic variants of the QHL12D20 fragment were detected among the sixty lines of the sunflower genetic collection. An intron of QHL12D20 fragment was homologous to an intron of the AHBP-1B gene; the product of this gene-has a similarity with the transcription factor of the bZIP-family of Arabidopsis. A relationship between the QHL12D20 polymorphism and the functional state of the Rfl locus was revealed.

  1. Excisions of a defective transposable CACTA element (Tetu1) generate new alleles of a CYCLOIDEA-like gene of Helianthus annuus.

    PubMed

    Fambrini, Marco; Basile, Alice; Salvini, Mariangela; Pugliesi, Claudio

    2014-10-01

    Tubular ray flower (turf) is a sunflower mutant that caught attention because it bears actinomorphic ray flowers, due to the presence of an active, although non-autonomous CACTA transposon (Tetu1) in the TCP domain of a CYCLOIDEA-like gene, HaCYC2c, a major regulator of sunflower floral symmetry. Here, we analyzed its excision rates in F3 population deriving from independent crosses of turf with common sunflower accessions. Our results suggest that the excision rate, ranging from 1.21 to 6.29%, depends on genetic background; moreover, the absence of somatic sectors in inflorescences of revertant individuals analyzed (182) and genetic analyses suggests a tight developmental control of Tetu1 excision, likely restricted to germinal cells. We individuate events of Tetu1 excision through molecular analysis that restore the wild type (WT) HaCYC2c allele, but even transposon excisions during which footprints are left. All mutations we detected occurred at the TCP basic motif and cause a change in ray flower phenotype. In particular, we selected five mutants with a one-to-four amino acid change that influence the capacity of reproductive organ development and ray flower corolla shaping (MUT-1, -2, -3, -4, -5). Revertant alleles not affecting turf phenotype (i.e. reading frame mutations) have also been identified (MUT-6). In all mutants, Real-time quantitative PCR (qPCR) experiments revealed variations of the steady state level of HaCYC2c mRNA. MUT-1 and MUT-4 showed a significant HaCYC2c down-regulation with respect to WT. A large variation within the biological replicates of MUT-2, MUT-3 and MUT-5 was detected and not significant differences in transcription levels between mutants and WT were observed. We detected low steady state level of HaCYC2c mRNA both in turf as in MUT-6. A three dimensional (3D) structure prediction tool let us predict an incorrect folding of the TCP protein already after a single amino acid deletion. This in turn is detectable as the restore of traits that are not peculiar of WT ray flowers, such as male fertility. Our analysis of an active TE sheds light on the TCP motif of the HaCYC2c gene and suggests that Tetu1 may be useful to obtain new natural mutants and for transposon tagging in different inbred lines of sunflower.

  2. Genetics and mapping of the R11 gene conferring resistance to recently emerged rust races, tightly linked to male fertility restoration, in sunflower (Helianthus annuus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower oil is one of the major sources of edible oil. As the second largest hybrid crop in the world, hybrid sunflowers are developed by using the PET1 cytoplasmic male sterility system that contributes a 20% yield advantage over the open-pollinated varieties. However, sunflower production in Nor...

  3. Comparative genetic analysis of quantitative traits in sunflower (Helianthus annuus L.). 2. Characterisation of QTL involved in developmental and agronomic traits.

    PubMed

    Bert, P-F; Jouan, I; Tourvieille de Labrouhe, D; Serre, F; Philippon, J; Nicolas, P; Vear, F

    2003-06-01

    Seed weight and oil content are important properties of cultivated sunflower under complex genetic and environmental control, and associated with morphological and developmental characteristics such as plant height or flowering dates. Using a genetic map with 290 markers for a cross between two inbred sunflower lines and 2 years of observations on F3 families, QTL controlling seed weight, oil content, plant height, plant lodging, flowering dates, maturity dates and delay from flowering to maturity were detected. QTL detected were compared between the F2 and F3 generations and between the 2 years of testing for the F3 families in 1997 and 1999. Some of the QTL controlling seed weight overlapped with those controlling oil content. Several other co-localisations of QTL controlling developmental or morphological characteristics were observed and the relationships between the traits were also shown by correlation analyses. The relationships between all these traits and with resistance to Sclerotinia sclerotiorum and Diaporthe helianthi are discussed.

  4. Potential of Brassic rapa, Cannabis sativa, Helianthus annuus and Zea mays for phytoextraction of heavy metals from calcareous dredged sediment derived soils.

    PubMed

    Meers, E; Ruttens, A; Hopgood, M; Lesage, E; Tack, F M G

    2005-10-01

    Remediation of soil pollution is one of the many current environmental challenges. Anthropogenic activity has resulted in the contamination of extended areas of land, the remediation of which is both invasive and expensive by conventional means. Phytoextraction of heavy metals from contaminated soils has the prospect of being a more economic in situ alternative. In addition, phytoextraction targets ecotoxicologically the most relevant soil fraction of these metals, i.e. the bioavailable fraction. Greenhouse experiments were carried out to evaluate the potential of four high biomass crop species in their potential for phytoextraction of heavy metals, with or without with the use of soil amendments (EDTA or EDDS). A calcareous dredged sediment derived surface soil, with high organic matter and clay content and moderate levels of heavy metal pollution, was used in the experiments. No growth depression was observed in EDTA or EDDS treated pots in comparison to untreated controls. Metal accumulation was considered to be low for phytoextraction purposes, despite the use of chelating agents. The low observed shoot concentrations of heavy metals were attributed to the low phytoavailability of heavy metals in this particular soil substrate. The mobilising effects induced by EDTA in the soil were found to be too long-lived for application as a soil amendment in phytoextraction. Although EDDS was found to be more biodegradable, higher effect half lives were observed than reported in literature or observed in previous experiments. These findings caution against the use of any amendment, biodegradable or otherwise, without proper investigation of its effects and the longevity thereof. PMID:16202810

  5. Influence of substituting dietary soybean for air-classified sunflower (Helianthus annuus L.) meal on egg production and steroid hormones in early-phase laying hens.

    PubMed

    Laudadio, V; Ceci, E; Nahashon, S N; Introna, M; Lastella, N M B; Tufarelli, V

    2014-02-01

    Soybean meal (SBM) is the most widely and expensive protein source used in the formulation of poultry diets; however, when the price of SBM increases, poultry nutritionists seek alternative sources that are more economical in formulating least-cost rations. This research aimed to evaluate the effects of dietary air-classified sunflower meal (SFM) on some productive parameters and plasma steroid hormones in laying hens. In this trial, 20-week-old laying hens (ISA Brown strain) in the early phase of production were randomly assigned to two groups and fed wheat middlings-based diets containing soybean (135 g/kg; 48% CP) or air-classified SFM (160 g/kg; 41% CP) as the main protein source. Laying performance, egg size and feed conversion ratio were evaluated for 10 week. Plasma steroid hormones (progesterone and oestradiol) in the hens were quantified weekly. Substituting SBM with air-classified SFM did not change (p > 0.05) the hens' growth performance, whereas feed consumption and efficiency were positively influenced (p < 0.05) by SFM treatment. Egg production rate was improved in hens fed the SFM diet (p < 0.05), as well as the percentage of medium-size eggs that was higher for SFM treatment (p < 0.05). Steroid hormones levels were affected by dietary treatment (p < 0.01). From our findings, it could be effective to include air-classified SFM in early-phase laying hen diets as an alternative protein source substituting SBM, without negative influence on productive performance and egg traits, reducing also the production costs.

  6. Mechanical wounding induces a nitrosative stress by down-regulation of GSNO reductase and an increase in S-nitrosothiols in sunflower (Helianthus annuus) seedlings.

    PubMed

    Chaki, Mounira; Valderrama, Raquel; Fernández-Ocaña, Ana M; Carreras, Alfonso; Gómez-Rodríguez, Maria V; Pedrajas, José R; Begara-Morales, Juan C; Sánchez-Calvo, Beatriz; Luque, Francisco; Leterrier, Marina; Corpas, Francisco J; Barroso, Juan B

    2011-03-01

    Nitric oxide (NO) and related molecules such as peroxynitrite, S-nitrosoglutathione (GSNO), and nitrotyrosine, among others, are involved in physiological processes as well in the mechanisms of response to stress conditions. In sunflower seedlings exposed to five different adverse environmental conditions (low temperature, mechanical wounding, high light intensity, continuous light, and continuous darkness), key components of the metabolism of reactive nitrogen species (RNS) and reactive oxygen species (ROS), including the enzyme activities L-arginine-dependent nitric oxide synthase (NOS), S-nitrosogluthathione reductase (GSNOR), nitrate reductase (NR), catalase, and superoxide dismutase, the content of lipid hydroperoxide, hydrogen peroxide, S-nitrosothiols (SNOs), the cellular level of NO, GSNO, and GSNOR, and protein tyrosine nitration [nitrotyrosine (NO(2)-Tyr)] were analysed. Among the stress conditions studied, mechanical wounding was the only one that caused a down-regulation of NOS and GSNOR activities, which in turn provoked an accumulation of SNOs. The analyses of the cellular content of NO, GSNO, GSNOR, and NO(2)-Tyr by confocal laser scanning microscopy confirmed these biochemical data. Therefore, it is proposed that mechanical wounding triggers the accumulation of SNOs, specifically GSNO, due to a down-regulation of GSNOR activity, while NO(2)-Tyr increases. Consequently a process of nitrosative stress is induced in sunflower seedlings and SNOs constitute a new wound signal in plants.

  7. Mechanical wounding induces a nitrosative stress by down-regulation of GSNO reductase and an increase in S-nitrosothiols in sunflower (Helianthus annuus) seedlings

    PubMed Central

    Chaki, Mounira; Valderrama, Raquel; Fernández-Ocaña, Ana M.; Carreras, Alfonso; Gómez-Rodríguez, Maria. V.; Pedrajas, José R.; Begara-Morales, Juan C.; Sánchez-Calvo, Beatriz; Luque, Francisco; Leterrier, Marina; Corpas, Francisco J.; Barroso, Juan B.

    2011-01-01

    Nitric oxide (NO) and related molecules such as peroxynitrite, S-nitrosoglutathione (GSNO), and nitrotyrosine, among others, are involved in physiological processes as well in the mechanisms of response to stress conditions. In sunflower seedlings exposed to five different adverse environmental conditions (low temperature, mechanical wounding, high light intensity, continuous light, and continuous darkness), key components of the metabolism of reactive nitrogen species (RNS) and reactive oxygen species (ROS), including the enzyme activities L-arginine-dependent nitric oxide synthase (NOS), S-nitrosogluthathione reductase (GSNOR), nitrate reductase (NR), catalase, and superoxide dismutase, the content of lipid hydroperoxide, hydrogen peroxide, S-nitrosothiols (SNOs), the cellular level of NO, GSNO, and GSNOR, and protein tyrosine nitration [nitrotyrosine (NO2-Tyr)] were analysed. Among the stress conditions studied, mechanical wounding was the only one that caused a down-regulation of NOS and GSNOR activities, which in turn provoked an accumulation of SNOs. The analyses of the cellular content of NO, GSNO, GSNOR, and NO2-Tyr by confocal laser scanning microscopy confirmed these biochemical data. Therefore, it is proposed that mechanical wounding triggers the accumulation of SNOs, specifically GSNO, due to a down-regulation of GSNOR activity, while NO2-Tyr increases. Consequently a process of nitrosative stress is induced in sunflower seedlings and SNOs constitute a new wound signal in plants. PMID:21172815

  8. Oleate Coated Magnetic Cores Based on Magnetite, Zn Ferrite and Co Ferrite Nanoparticles—Preparation, Physical Characterization and Biological Impact on Helianthus Annuus Photosynthesis

    NASA Astrophysics Data System (ADS)

    Ursache-Oprisan, Manuela; Foca-nici, Ecaterina; Cirlescu, Aurelian; Caltun, Ovidiu; Creanga, Dorina

    2010-12-01

    Sodium oleate was used as coating shell for magnetite, Zn ferrite and Co ferrite powders to stabilize them in the form of aqueous magnetic suspensions. The physical characterization was carried out by applying X-ray diffraction and magnetization measurements. Both crystallite size and magnetic core diameter ranged between 7 and 11 nm. The influence of magnetic nanoparticle suspensions (corresponding to magnetic nanoparticle levels of 10-14-10-15/cm3) on sunflower seedlings was studied considering the changes in the photosynthesis pigment levels. Similar responses were obtained for magnetite and cobalt ferrite nanoparticle treatment consisting in the apparent inhibition of chlorophyll biosynthesis while for zinc ferrite nanoparticles some concentrations seemed to have stimulatory effects on the chlorophylls as well as on the carotene levels. But the chlorophyll ratio was diminished in the case of all three types of magnetic nanoparticles meaning their slight negative effect on the light harvesting complex II (LHC II) from the chloroplast membranes and consequently on the photosynthesis efficiency.

  9. Effects of crop residues of sunflower (Helianthus annuus), maize (Zea mays L.) and soybean (Glycine max) on growth and seed yields of sunflower.

    PubMed

    Srisa-Ard, K

    2007-04-15

    This pot experiment was carried out at Suranaree Technology University Experimental Farm, Northeast Thailand to investigate effects of crop residues of sunflower, maize and soybean on total dry weight, top dry weight, plant height, root dry weight and seed yield of sunflower plants with the use of Korat soil series (Oxic Paleustults) during the rainy season (July-October) of the 2001. The experiment was laid in a split plot arranged in a Completely Randomized Design (CRD) with four replications where the crop residues of maize, sunflower and soybean were used as main plots. Whilst crop residues of roots, top growth and roots+top growth were used as subplots. The results showed that crop residues derived from roots of both sunflower and soybean plants had their significant inhibition effects of allelopathic substances on plant height, root dry weight, top growth dry weight and total dry weight plant(-1) of the sunflower plants than those derived from top growth of both crops alone (sunflower and soybean). Maize plant residues had no significant inhibition effect on growth of subsequent crop of sunflower.

  10. Genetic control of water use efficiency and leaf carbon isotope discrimination in sunflower (Helianthus annuus L.) subjected to two drought scenarios.

    PubMed

    Adiredjo, Afifuddin Latif; Navaud, Olivier; Muños, Stephane; Langlade, Nicolas B; Lamaze, Thierry; Grieu, Philippe

    2014-01-01

    High water use efficiency (WUE) can be achieved by coordination of biomass accumulation and water consumption. WUE is physiologically and genetically linked to carbon isotope discrimination (CID) in leaves of plants. A population of 148 recombinant inbred lines (RILs) of sunflower derived from a cross between XRQ and PSC8 lines was studied to identify quantitative trait loci (QTL) controlling WUE and CID, and to compare QTL associated with these traits in different drought scenarios. We conducted greenhouse experiments in 2011 and 2012 by using 100 balances which provided a daily measurement of water transpired, and we determined WUE, CID, biomass and cumulative water transpired by plants. Wide phenotypic variability, significant genotypic effects, and significant negative correlations between WUE and CID were observed in both experiments. A total of nine QTL controlling WUE and eight controlling CID were identified across the two experiments. A QTL for phenotypic response controlling WUE and CID was also significantly identified. The QTL for WUE were specific to the drought scenarios, whereas the QTL for CID were independent of the drought scenarios and could be found in all the experiments. Our results showed that the stable genomic regions controlling CID were located on the linkage groups 06 and 13 (LG06 and LG13). Three QTL for CID were co-localized with the QTL for WUE, biomass and cumulative water transpired. We found that CID and WUE are highly correlated and have common genetic control. Interestingly, the genetic control of these traits showed an interaction with the environment (between the two drought scenarios and control conditions). Our results open a way for breeding higher WUE by using CID and marker-assisted approaches and therefore help to maintain the stability of sunflower crop production.

  11. Collection of Helianthus porteri, an endemic sunflower of granite outcrops in the southeastern United States

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Helianthus comprises 51 species, 14 annual and 37 perennial, all native to North America. The narrow genetic base of cultivated sunflower has been broadened by the infusion of genes from the wild species, which have provided a continued source of desirable agronomic traits. Confederate dai...

  12. Collection and evaluation of wild perennial Helianthus pumilus achenes for oil concentration and fatty acid composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Helianthus consists of 52 species and 19 subspecies with 14 annual and 38 perennial species. The narrow genetic base of cultivated sunflower has been broadened by the infusion of genes from the wild species, which have provided a continued source of desirable agronomic traits. There has ...

  13. Collection and evaluation of Helianthus verticillatus, an endemic sunflower of the Southeast US

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Helianthus comprises 51 species, 14 annual and 37 perennial, and all native to North America. The narrow genetic base of cultivated sunflower has been broadened by the infusion of genes from the wild species, which have provided a continued source of desirable agronomic traits. Whorled sun...

  14. Collection and evaluation of wild perennial Helianthus pumilus achenes for oil concentration and fatty acid composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Helianthus consists of 51 species and 19 subspecies with 14 annual and 37 perennial species. The narrow genetic base of cultivated sunflower has been broadened by the infusion of genes from the wild species, which have provided a continued source of desirable agronomic traits. There has ...

  15. Comparison of fatty acid composition of oil from original and regenerated populations of wild Helianthus species

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Monitoring and protecting germplasm in genebanks using in situ collections while preserving its original genetic integrity is a priority of germplasm curation. Many germplasm accessions need to be regenerated from seed due to demand and/or seed condition. The regeneration of wild Helianthus species ...

  16. Genomic variation in Helianthus: learning from the past and looking to the future.

    PubMed

    Kantar, Michael B; Baute, Gregory J; Bock, Dan G; Rieseberg, Loren H

    2014-07-01

    Helianthus is an economically important and genetically diverse genus, containing both evolutionary model species and cultivated species. Genetic variation within this genus has been examined at many different scales, from genome size changes to chromosomal structure to nucleotide variation. The growing amount of genomic resources within the genus has yielded insights into the importance of paleopolyploid events, and how transposable elements can cause rapid genome size increases. The rapidly evolving chromosomes in Helianthus have provided a system whereby it has been possible to study how chromosomal rearrangements impact speciation, adaptation and introgression. Population and quantitative genetic studies have used the abundant nucleotide variation to identify a number of candidate genes which may be involved in both local adaptation and domestication. The results from these investigations have provided basic knowledge about evolution and how to utilize genetic resources for both agriculture and conservation. Targeting Helianthus for further study as new technologies emerge will allow for a better understanding of how different types of genomic variation interact and contribute to phenotypic variation in a complex system that is ecologically and economically significant.

  17. Volatiles from intact and Lygus-damaged Erigeron annuus (L.) Pers. are highly attractive to ovipositing Lygus and its parasitoid Peristenus relictus Ruthe.

    PubMed

    Halloran, Sean T; Mauck, Kerry E; Fleischer, Shelby J; Fleisher, Shelby F; Tumlinson, James H

    2013-08-01

    Trap cropping and biological control can provide a sustainable means of controlling insect pests. Insects in the genus Lygus (Hemiptera: Miridae) are major pests on cotton and horticultural crops throughout the United States, and pesticide resistance within Lygus populations necessitates more sustainable long-term management techniques. Here, we explore behavioral responses of Lygus bugs (L. rubrosignatus Knight) and an introduced parasitoid, Peristenus relictus (Hymenoptera: Braconidae), to a common field edge plant, Erigeron annuus, which has the potential to serve as a trap host. Erigeron annuus is attractive to Lygus in the field, with Lygus preferentially moving to Erigeron patches compared to more abundant cotton plants. To determine the role of odor cues in mediating this attraction, we collected volatiles from E. annuus with and without Lygus damage, and then tested the attractiveness of these volatiles vs. those of cotton to Lygus females and female P. relictus wasps using Y-tube and wind tunnel bioassays. We found that undamaged E. annuus emits high concentrations of a complex volatile blend (60+ compounds), with novel compounds induced and constitutive compounds up-regulated in response to damage. Additionally, both female Lygus bugs and female P. relictus wasps are highly attracted to E. annuus volatiles over those of cotton in almost every combination of damage treatments. Our results suggest that Erigeron annuus would be an effective trap plant to control Lygus in cotton, since it is highly attractive to both the pest and its natural enemy. PMID:23982679

  18. White mold of Jerusalem artichoke

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Jerusalem artichoke (Helianthus tuberosus) is a Native American food plant closely related to the common sunflower (Helianthus annuus). Tubers of Jerusalem artichoke are increasingly available in retail grocery outlets. White mold (Sclerotinia stem rot), caused by the fungus, Sclerotinia sclerotioru...

  19. Helianthus tuberosus and polyamine research: past and recent applications of a classical growth model.

    PubMed

    Tassoni, Annalisa; Bagni, Nello; Ferri, Maura; Franceschetti, Marina; Khomutov, Alex; Marques, Maria Paula; Fiuza, Sonia M; Simonian, Alina R; Serafini-Fracassini, Donatella

    2010-07-01

    The earliest studies concerning polyamines (PAs) in plants were performed by using in vitro cultured explants of Helianthus tuberosus dormant tuber. This parenchyma tissue was particularly useful due to its susceptibility to several growth substances, including PAs. During tuber dormancy, PA levels are too low to sustain cell division; thus Helianthus represents a natural PA-deficient model. When cultivated in vitro in the presence of auxins, Helianthus tuber dormant parenchyma cells at the G(0) stage start to divide synchronously acquiring meristematic characteristics. The requirement for auxins to induce cell division can be substituted by aliphatic PAs such as putrescine, spermidine or spermine. Cylinders or slices of explanted homogeneous tuber parenchyma were cultured in liquid medium for short-term studies on the cell cycle, or on solid agar medium for long-term experiments. Morphological and physiological modifications of synchronously dividing cells were studied during the different phases of the cell cycle in relation to PAs biosynthesis and oxidation. Long-term experiments led to the identification of the PAs as plant growth regulators, as the sole nitrogen source, as tuber storage substances and as essential factors for morphogenetic processes and cell homeostasis. More recently this system was used to study the effects on plant cell proliferation of platinum- or palladium-derived drugs (cisplatin and platinum or palladium bi-substituted spermine) that are used in human cancer cell lines as antiproliferative and cytotoxic agents. Cisplatin was the most active both in cell proliferation inhibition and on PA metabolism. Similar experiments were performed using three agmatine analogous. Different effects of these compounds were observed on cell proliferation, free PA levels and enzyme activities, leading to a hypothesis of a correlation between their chemical structure and the agmatine metabolism in plants.

  20. Evaluation of achenes of Helianthus verticillatus, an endemic sunflower of the southeastern US for oil concentration and fatty acid composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The narrow genetic base of cultivated sunflower has been broadened by the infusion of genes from the wild species which have provided a continued source of desirable agronomic traits. The genus Helianthus comprises 51 species, 14 annual and 37 perennial, all native to North America. Whorled sunflowe...

  1. High genetic diversity and low population structure in Porter's sunflower (Helianthus porteri).

    PubMed

    Gevaert, Scott D; Mandel, Jennifer R; Burke, John M; Donovan, Lisa A

    2013-01-01

    Granite outcrops in the southeastern United States are rare and isolated habitats that support edaphically controlled communities dominated by herbaceous plants. They harbor rare and endemic species that are expected to have low genetic variability and high population structure due to small population sizes and their disjunct habitat. We test this expectation for an annual outcrop endemic, Helianthus porteri (Porter's sunflower). Contrary to expectation, H. porteri has relatively high genetic diversity (H e = 0.681) and relatively low genetic structure among the native populations (F ST = 0.077) when compared to 5 other Helianthus species (N = 288; 18 expressed sequence tag-SSR markers). These findings suggest greater gene flow than expected. The potential for gene flow is supported by the analysis of transplant populations established with propagules from a common source in 1959. One population established close to a native population (1.5 km) at the edge of the natural range is genetically similar to and shares rare alleles with the adjacent native population and is distinct from the central source population. In contrast, a transplant population established north of the native range has remained similar to the source population. The relatively high genetic diversity and low population structure of this species, combined with the long-term success of transplanted populations, bode well for its persistence as long as the habitat persists. PMID:23487323

  2. High genetic diversity and low population structure in Porter's sunflower (Helianthus porteri).

    PubMed

    Gevaert, Scott D; Mandel, Jennifer R; Burke, John M; Donovan, Lisa A

    2013-01-01

    Granite outcrops in the southeastern United States are rare and isolated habitats that support edaphically controlled communities dominated by herbaceous plants. They harbor rare and endemic species that are expected to have low genetic variability and high population structure due to small population sizes and their disjunct habitat. We test this expectation for an annual outcrop endemic, Helianthus porteri (Porter's sunflower). Contrary to expectation, H. porteri has relatively high genetic diversity (H e = 0.681) and relatively low genetic structure among the native populations (F ST = 0.077) when compared to 5 other Helianthus species (N = 288; 18 expressed sequence tag-SSR markers). These findings suggest greater gene flow than expected. The potential for gene flow is supported by the analysis of transplant populations established with propagules from a common source in 1959. One population established close to a native population (1.5 km) at the edge of the natural range is genetically similar to and shares rare alleles with the adjacent native population and is distinct from the central source population. In contrast, a transplant population established north of the native range has remained similar to the source population. The relatively high genetic diversity and low population structure of this species, combined with the long-term success of transplanted populations, bode well for its persistence as long as the habitat persists.

  3. Macroevolution of leaf defenses and secondary metabolites across the genus Helianthus.

    PubMed

    Mason, Chase M; Bowsher, Alan W; Crowell, Breanna L; Celoy, Rhodesia M; Tsai, Chung-Jui; Donovan, Lisa A

    2016-03-01

    Leaf defenses are widely recognized as key adaptations and drivers of plant evolution. Across environmentally diverse habitats, the macroevolution of leaf defenses can be predicted by the univariate trade-off model, which predicts that defenses are functionally redundant and thus trade off, and the resource availability hypothesis, which predicts that defense investment is determined by inherent growth rate and that higher defense will evolve in lower resource environments. Here, we examined the evolution of leaf physical and chemical defenses and secondary metabolites in relation to environmental characteristics and leaf economic strategy across 28 species of Helianthus (the sunflowers). Using a phylogenetic comparative approach, we found few evolutionary trade-offs among defenses and no evidence for defense syndromes. We also found that leaf defenses are strongly related to leaf economic strategy, with higher defense in more resource-conservative species, although there is little support for the evolution of higher defense in low-resource habitats. A wide variety of physical and chemical defenses predict resistance to different insect herbivores, fungal pathogens, and a parasitic plant, suggesting that most sunflower defenses are not redundant in function and that wild Helianthus represents a rich source of variation for the improvement of crop sunflower. PMID:26583880

  4. Macroevolution of leaf defenses and secondary metabolites across the genus Helianthus.

    PubMed

    Mason, Chase M; Bowsher, Alan W; Crowell, Breanna L; Celoy, Rhodesia M; Tsai, Chung-Jui; Donovan, Lisa A

    2016-03-01

    Leaf defenses are widely recognized as key adaptations and drivers of plant evolution. Across environmentally diverse habitats, the macroevolution of leaf defenses can be predicted by the univariate trade-off model, which predicts that defenses are functionally redundant and thus trade off, and the resource availability hypothesis, which predicts that defense investment is determined by inherent growth rate and that higher defense will evolve in lower resource environments. Here, we examined the evolution of leaf physical and chemical defenses and secondary metabolites in relation to environmental characteristics and leaf economic strategy across 28 species of Helianthus (the sunflowers). Using a phylogenetic comparative approach, we found few evolutionary trade-offs among defenses and no evidence for defense syndromes. We also found that leaf defenses are strongly related to leaf economic strategy, with higher defense in more resource-conservative species, although there is little support for the evolution of higher defense in low-resource habitats. A wide variety of physical and chemical defenses predict resistance to different insect herbivores, fungal pathogens, and a parasitic plant, suggesting that most sunflower defenses are not redundant in function and that wild Helianthus represents a rich source of variation for the improvement of crop sunflower.

  5. Effects of different doses of low power continuous wave he-ne laser radiation on some seed thermodynamic and germination parameters, and potential enzymes involved in seed germination of sunflower (Helianthus annuus L.).

    PubMed

    Perveen, Rashida; Ali, Qasim; Ashraf, Muhammad; Al-Qurainy, Fahad; Jamil, Yasir; Raza Ahmad, Muhammad

    2010-01-01

    In this study, water-soaked seeds of sunflower were exposed to He-Ne laser irradiation of different energies to determine whether or not He-Ne laser irradiation caused changes to seed thermodynamic and germination parameters as well as effects on the activities of germination enzymes. The experiment comprised four energy levels: 0 (control), 100, 300 and 500mJ of laser energy and each treatment replicated four times arranged in a completely randomized design. The experimentation was performed under the greenhouse conditions in the net-house of the Department of Botany, University of Agriculture, Faisalabad. The seed thermodynamic parameters were calculated according to seed germination thermograms determined with a calorimeter at 25.8°C for 72h. Various thermodynamic parameters of seed (ΔH, (ΔS)(e), (ΔS)(c), (ΔS)(e) /Δt and (ΔS)(c) /Δt) were affected significantly due to presowing laser treatment. Significant changes in seed germination parameters and enzyme activities were observed in seeds treated with He-Ne laser. The He-Ne laser seed treatment resulted in increased activities of amylase and protease. These results indicate that the low power continuous wave He-Ne laser light seed treatment has considerable biological effects on seed metabolism. This seed treatment technique can be potentially employed to enhance agricultural productivity. PMID:20670360

  6. Talc based exopolysaccharides formulation enhancing growth and production of Hellianthus annuus under saline conditions.

    PubMed

    Tewari, S; Arora, K

    2014-01-01

    Stress tolerating strain of Pseudomonas aeruginosa PF07 possessing plant growth promoting activity was screened for the production of exopolysaccharides (EPS). EPS production was monitored in the cell free culture supernatant (CFCS) and extracted EPS was further purified by thin layer chromatography. EPS producing cells were taken to design talc based formulation and its efficacy was checked on oilseed crop sunflower (Hellianthus annuus), under in vivo saline conditions (soil irrigated with 125 mM of saline water). Application of bioformulation significantly enhanced the yield and growth attributes of the plant in comparison to control (untreated seeds) under stress and non—stress conditions. Germination rate, plant length, dry weight and seed weight increased remarkably. The above findings suggest the application and benefits of utilizing EPS formulation in boosting early seedling emergence, enhancing plant growth parameters, increasing seed weight and mitigating stress in saline affected regions. Such bioformulation may enhance RAS/RT (Root Adhering Soil to Root Tissue ratio), texture of the soil, increase porosity, improve uptake of nutrients, and hence may be considered as commercially important formulation for renovation of stressed sites and enhancing plant growth. PMID:25535716

  7. Enzymatic browning and after-cooking darkening of Jerusalem artichoke tubers (Helianthus tuberosus L.).

    PubMed

    Bach, Vibe; Jensen, Sidsel; Clausen, Morten R; Bertram, Hanne C; Edelenbos, Merete

    2013-11-15

    Jerusalem artichoke tubers (Helianthus tuberosus L.) undergo enzymatic browning when peeled or cut, and turn grey after boiling, due to after-cooking darkening reactions between iron and phenolic acids. In an attempt to reveal the components responsible for these discolouration reactions, sensory evaluation and instrumental colour measurements were related to contents of total phenolics, phenolic acids, organic acids and iron in three varieties of raw and boiled Jerusalem artichoke tubers harvested in the autumn and the spring. No differences were found between varieties in sensory evaluated enzymatic browning, but Rema and Draga had higher scores than Mari in after-cooking darkening. Jerusalem artichoke tubers had higher contents of total phenolics, phenolic acids and citric acid in the autumn and low contents in the spring, while it was the opposite for malic acid. None of the chemical parameters investigated could explain the discolouration of the Jerusalem artichoke tubers.

  8. Enzymatic browning and after-cooking darkening of Jerusalem artichoke tubers (Helianthus tuberosus L.).

    PubMed

    Bach, Vibe; Jensen, Sidsel; Clausen, Morten R; Bertram, Hanne C; Edelenbos, Merete

    2013-11-15

    Jerusalem artichoke tubers (Helianthus tuberosus L.) undergo enzymatic browning when peeled or cut, and turn grey after boiling, due to after-cooking darkening reactions between iron and phenolic acids. In an attempt to reveal the components responsible for these discolouration reactions, sensory evaluation and instrumental colour measurements were related to contents of total phenolics, phenolic acids, organic acids and iron in three varieties of raw and boiled Jerusalem artichoke tubers harvested in the autumn and the spring. No differences were found between varieties in sensory evaluated enzymatic browning, but Rema and Draga had higher scores than Mari in after-cooking darkening. Jerusalem artichoke tubers had higher contents of total phenolics, phenolic acids and citric acid in the autumn and low contents in the spring, while it was the opposite for malic acid. None of the chemical parameters investigated could explain the discolouration of the Jerusalem artichoke tubers. PMID:23790937

  9. Chemical composition of the tuber essential oil from Helianthus tuberosus L. (Asteraceae).

    PubMed

    Radulović, Niko S; Đorđević, Miljana R

    2014-03-01

    Helianthus tuberosus L. (Jerusalem artichoke) is cultivated in Europe and other parts of the world as a food crop and ornamental plant. The volatile oils of the aerial parts of H. tuberosus were investigated more than 30 years ago, but no study could be found to date on the constituents of the tuber essential oil. Herein, the first characterization by GC-FID, GC/MS, and (13) C-NMR analyses of a hydrodistilled essential oil of Jerusalem artichoke tubers was reported. Fresh plant material collected in Serbia (Sample A) and a commercial sample (Sample B) yielded only small amounts of oil (0.0014 and 0.0021% (w/w), resp.). In total, 195 constituents were identified, representing 88.2 and 93.6% of the oil compositions for Samples A and B, respectively. The main constituents identified were β-bisabolene (1; 22.9-30.5%), undecanal (0-12.7%), α-pinene (7.6-0.8%), kauran-16-ol (2; 6.9-9.8%), 2-pentylfuran (0.0-5.7%), and (E)-tetradec-2-enal (0.0-4.9%). Several rare compounds characteristic for Helianthus ssp. were also detected: helianthol A (6; 2.1-1.9%), dihydroeuparin (10; 0.0-2.3%), euparin (9; 0.0-0.4%), desmethoxyencecalin (7; traces - 0.2%), desmethylencecalin (8; 0.0-0.4%), and an isomer of desmethylencecalin (0.0%-traces). The essential oils isolated from the tuber and the aerial parts share the common major component 1.

  10. Coyote, Canis latrans, use of commercial sunflower, Helianthus spp., Seeds as a food source in western Kansas

    USGS Publications Warehouse

    Sovada, M.A.; Telesco, D.J.; Roy, C.C.

    2000-01-01

    Food habits of Coyotes (Canis latrans) were determined by analysis of scats collected in western Kansas in 1996. Mammals were the most frequently occurring food of Coyotes (100% of scats), followed by plants (39%), insects (30%) and birds (9%). Commercial sunflower (Helianthus spp.) seeds were found in 9 of 23 scats. When present, they composed a high volume of individual scats (X= 31%). Substantial use of commercial sunflower seeds as a food source by Coyotes has not been previously documented.

  11. Economically Viable Components from Jerusalem Artichoke (Helianthus tuberosus L.) in a Biorefinery Concept

    PubMed Central

    Johansson, Eva; Prade, Thomas; Angelidaki, Irini; Svensson, Sven-Erik; Newson, William R.; Gunnarsson, Ingólfur Bragi; Persson Hovmalm, Helena

    2015-01-01

    Biorefinery applications are receiving growing interest due to climatic and waste disposal issues and lack of petroleum resources. Jerusalem artichoke (Helianthus tuberosus L.) is suitable for biorefinery applications due to high biomass production and limited cultivation requirements. This paper focuses on the potential of Jerusalem artichoke as a biorefinery crop and the most viable products in such a case. The carbohydrates in the tubers were found to have potential for production of platform chemicals, e.g., succinic acid. However, economic analysis showed that production of platform chemicals as a single product was too expensive to be competitive with petrochemically produced sugars. Therefore, production of several products from the same crop is a must. Additional products are protein based ones from tubers and leaves and biogas from residues, although both are of low value and amount. High bioactive activity was found in the young leaves of the crop, and the sesquiterpene lactones are of specific interest, as other compounds from this group have shown inhibitory effects on several human diseases. Thus, future focus should be on understanding the usefulness of small molecules, to develop methods for their extraction and purification and to further develop sustainable and viable methods for the production of platform chemicals. PMID:25913379

  12. Economically viable components from Jerusalem artichoke (Helianthus tuberosus L.) in a biorefinery concept.

    PubMed

    Johansson, Eva; Prade, Thomas; Angelidaki, Irini; Svensson, Sven-Erik; Newson, William R; Gunnarsson, Ingólfur Bragi; Hovmalm, Helena Persson

    2015-04-22

    Biorefinery applications are receiving growing interest due to climatic and waste disposal issues and lack of petroleum resources. Jerusalem artichoke (Helianthus tuberosus L.) is suitable for biorefinery applications due to high biomass production and limited cultivation requirements. This paper focuses on the potential of Jerusalem artichoke as a biorefinery crop and the most viable products in such a case. The carbohydrates in the tubers were found to have potential for production of platform chemicals, e.g., succinic acid. However, economic analysis showed that production of platform chemicals as a single product was too expensive to be competitive with petrochemically produced sugars. Therefore, production of several products from the same crop is a must. Additional products are protein based ones from tubers and leaves and biogas from residues, although both are of low value and amount. High bioactive activity was found in the young leaves of the crop, and the sesquiterpene lactones are of specific interest, as other compounds from this group have shown inhibitory effects on several human diseases. Thus, future focus should be on understanding the usefulness of small molecules, to develop methods for their extraction and purification and to further develop sustainable and viable methods for the production of platform chemicals.

  13. Transcriptome resources for the perennial sunflower Helianthus maximiliani obtained from ecologically divergent populations.

    PubMed

    Kawakami, Takeshi; Darby, Brian J; Ungerer, Mark C

    2014-07-01

    Next-generation sequencing (NGS) technologies provide a rapid means to generate genomic resources for species exhibiting interesting ecological and evolutionary variation but for which such resources are scant or nonexistent. In the current report, we utilize 454 pyrosequencing to obtain transcriptome information for multiple individuals and tissue types from geographically disparate and ecologically differentiated populations of the perennial sunflower species Helianthus maximiliani. A total of 850 275 raw reads were obtained averaging 355 bp in length. Reads were assembled, postprocessing, into 16 681 unique contigs with an N50 of 898 bp and a total length of 13.6 Mb. A majority (67%) of these contigs were annotated based on comparison with the Arabidopsis thaliana genome (TAIR10). Contigs were identified that exhibit high similarity to genes associated with natural variation in flowering time and freezing tolerance in other plant species and will facilitate future studies aimed at elucidating the molecular basis of clinal life history variation and adaptive differentiation in H. maximiliani. Large numbers of gene-associated simple sequence repeats (SSRs) and single-nucleotide polymorphisms (SNPs) also were identified that can be deployed in mapping and population genomic analyses.

  14. Preliminary enrichment and separation of chlorogenic acid from Helianthus tuberosus L. leaves extract by macroporous resins.

    PubMed

    Sun, Peng-Cheng; Liu, Ying; Yi, Yue-Tao; Li, Hong-Juan; Fan, Ping; Xia, Chuan-Hai

    2015-02-01

    In the present study, a simple and efficient method for the preparative separation of 3-CQA from the extract of Helianthus tuberosus leaves with macroporous resins was studied. ADS-21 showed much higher adsorption capacity and better adsorption/desorption properties for 3-CQA among the tested resins. The adsorption of 3-CQA on ADS-21 resin at 25°C was fitted best to the Langmuir isotherm model and pseudo-second-order kinetic model. Dynamic adsorption/desorption experiments were carried out in a glass column packed with ADS-21 to optimise the separation process of 3-CQA from H. tuberosus leaves extract. After one treatment with ADS-21, the content of 3-CQA in the product was increased 5.42-fold, from 12.0% to 65.2%, with a recovery yield of 89.4%. The results demonstrated that the method was suitable for large-scale separation and manufacture of 3-CQA from H. tuberosus leaves.

  15. Economically viable components from Jerusalem artichoke (Helianthus tuberosus L.) in a biorefinery concept.

    PubMed

    Johansson, Eva; Prade, Thomas; Angelidaki, Irini; Svensson, Sven-Erik; Newson, William R; Gunnarsson, Ingólfur Bragi; Hovmalm, Helena Persson

    2015-01-01

    Biorefinery applications are receiving growing interest due to climatic and waste disposal issues and lack of petroleum resources. Jerusalem artichoke (Helianthus tuberosus L.) is suitable for biorefinery applications due to high biomass production and limited cultivation requirements. This paper focuses on the potential of Jerusalem artichoke as a biorefinery crop and the most viable products in such a case. The carbohydrates in the tubers were found to have potential for production of platform chemicals, e.g., succinic acid. However, economic analysis showed that production of platform chemicals as a single product was too expensive to be competitive with petrochemically produced sugars. Therefore, production of several products from the same crop is a must. Additional products are protein based ones from tubers and leaves and biogas from residues, although both are of low value and amount. High bioactive activity was found in the young leaves of the crop, and the sesquiterpene lactones are of specific interest, as other compounds from this group have shown inhibitory effects on several human diseases. Thus, future focus should be on understanding the usefulness of small molecules, to develop methods for their extraction and purification and to further develop sustainable and viable methods for the production of platform chemicals. PMID:25913379

  16. Preliminary enrichment and separation of chlorogenic acid from Helianthus tuberosus L. leaves extract by macroporous resins.

    PubMed

    Sun, Peng-Cheng; Liu, Ying; Yi, Yue-Tao; Li, Hong-Juan; Fan, Ping; Xia, Chuan-Hai

    2015-02-01

    In the present study, a simple and efficient method for the preparative separation of 3-CQA from the extract of Helianthus tuberosus leaves with macroporous resins was studied. ADS-21 showed much higher adsorption capacity and better adsorption/desorption properties for 3-CQA among the tested resins. The adsorption of 3-CQA on ADS-21 resin at 25°C was fitted best to the Langmuir isotherm model and pseudo-second-order kinetic model. Dynamic adsorption/desorption experiments were carried out in a glass column packed with ADS-21 to optimise the separation process of 3-CQA from H. tuberosus leaves extract. After one treatment with ADS-21, the content of 3-CQA in the product was increased 5.42-fold, from 12.0% to 65.2%, with a recovery yield of 89.4%. The results demonstrated that the method was suitable for large-scale separation and manufacture of 3-CQA from H. tuberosus leaves. PMID:25172683

  17. Evolutionary Divergences in Root Exudate Composition among Ecologically-Contrasting Helianthus Species

    PubMed Central

    Bowsher, Alan W.; Ali, Rifhat; Harding, Scott A.; Tsai, Chung-Jui; Donovan, Lisa A.

    2016-01-01

    Plant roots exude numerous metabolites into the soil that influence nutrient availability. Although root exudate composition is hypothesized to be under selection in low fertility soils, few studies have tested this hypothesis in a phylogenetic framework. In this study, we examined root exudates of three pairs of Helianthus species chosen as phylogenetically-independent contrasts with respect to native soil nutrient availability. Under controlled environmental conditions, seedlings were grown to the three-leaf-pair stage, then transferred to either high or low nutrient treatments. After five days of nutrient treatments, we used gas chromatography-mass spectrometry for analysis of root exudates, and detected 37 metabolites across species. When compared in the high nutrient treatment, species native to low nutrient soils exhibited overall higher exudation than their sister species native to high nutrient soils in all three species pairs, providing support for repeated evolutionary shifts in response to native soil fertility. Species native to low nutrient soils and those native to high nutrient soils responded similarly to low nutrient treatments with increased exudation of organic acids (fumaric, citric, malic acids) and glucose, potentially as a mechanism to enhance nutrition acquisition. However, species native to low nutrient soils also responded to low nutrient treatments with a larger decrease in exudation of amino acids than species native to high nutrient soils in all three species pairs. This indicates that species native to low nutrient soils have evolved a unique sensitivity to changes in nutrient availability for some, but not all, root exudates. Overall, these repeated evolutionary divergences between species native to low nutrient soils and those native to high nutrient soils provide evidence for the adaptive value of root exudation, and its plasticity, in contrasting soil environments. PMID:26824236

  18. Evolutionary Divergences in Root Exudate Composition among Ecologically-Contrasting Helianthus Species.

    PubMed

    Bowsher, Alan W; Ali, Rifhat; Harding, Scott A; Tsai, Chung-Jui; Donovan, Lisa A

    2016-01-01

    Plant roots exude numerous metabolites into the soil that influence nutrient availability. Although root exudate composition is hypothesized to be under selection in low fertility soils, few studies have tested this hypothesis in a phylogenetic framework. In this study, we examined root exudates of three pairs of Helianthus species chosen as phylogenetically-independent contrasts with respect to native soil nutrient availability. Under controlled environmental conditions, seedlings were grown to the three-leaf-pair stage, then transferred to either high or low nutrient treatments. After five days of nutrient treatments, we used gas chromatography-mass spectrometry for analysis of root exudates, and detected 37 metabolites across species. When compared in the high nutrient treatment, species native to low nutrient soils exhibited overall higher exudation than their sister species native to high nutrient soils in all three species pairs, providing support for repeated evolutionary shifts in response to native soil fertility. Species native to low nutrient soils and those native to high nutrient soils responded similarly to low nutrient treatments with increased exudation of organic acids (fumaric, citric, malic acids) and glucose, potentially as a mechanism to enhance nutrition acquisition. However, species native to low nutrient soils also responded to low nutrient treatments with a larger decrease in exudation of amino acids than species native to high nutrient soils in all three species pairs. This indicates that species native to low nutrient soils have evolved a unique sensitivity to changes in nutrient availability for some, but not all, root exudates. Overall, these repeated evolutionary divergences between species native to low nutrient soils and those native to high nutrient soils provide evidence for the adaptive value of root exudation, and its plasticity, in contrasting soil environments. PMID:26824236

  19. Evolutionary Divergences in Root Exudate Composition among Ecologically-Contrasting Helianthus Species.

    PubMed

    Bowsher, Alan W; Ali, Rifhat; Harding, Scott A; Tsai, Chung-Jui; Donovan, Lisa A

    2016-01-01

    Plant roots exude numerous metabolites into the soil that influence nutrient availability. Although root exudate composition is hypothesized to be under selection in low fertility soils, few studies have tested this hypothesis in a phylogenetic framework. In this study, we examined root exudates of three pairs of Helianthus species chosen as phylogenetically-independent contrasts with respect to native soil nutrient availability. Under controlled environmental conditions, seedlings were grown to the three-leaf-pair stage, then transferred to either high or low nutrient treatments. After five days of nutrient treatments, we used gas chromatography-mass spectrometry for analysis of root exudates, and detected 37 metabolites across species. When compared in the high nutrient treatment, species native to low nutrient soils exhibited overall higher exudation than their sister species native to high nutrient soils in all three species pairs, providing support for repeated evolutionary shifts in response to native soil fertility. Species native to low nutrient soils and those native to high nutrient soils responded similarly to low nutrient treatments with increased exudation of organic acids (fumaric, citric, malic acids) and glucose, potentially as a mechanism to enhance nutrition acquisition. However, species native to low nutrient soils also responded to low nutrient treatments with a larger decrease in exudation of amino acids than species native to high nutrient soils in all three species pairs. This indicates that species native to low nutrient soils have evolved a unique sensitivity to changes in nutrient availability for some, but not all, root exudates. Overall, these repeated evolutionary divergences between species native to low nutrient soils and those native to high nutrient soils provide evidence for the adaptive value of root exudation, and its plasticity, in contrasting soil environments.

  20. RNA-seq analysis and de novo transcriptome assembly of Jerusalem artichoke (Helianthus tuberosus Linne).

    PubMed

    Jung, Won Yong; Lee, Sang Sook; Kim, Chul Wook; Kim, Hyun-Soon; Min, Sung Ran; Moon, Jae Sun; Kwon, Suk-Yoon; Jeon, Jae-Heung; Cho, Hye Sun

    2014-01-01

    Jerusalem artichoke (Helianthus tuberosus L.) has long been cultivated as a vegetable and as a source of fructans (inulin) for pharmaceutical applications in diabetes and obesity prevention. However, transcriptomic and genomic data for Jerusalem artichoke remain scarce. In this study, Illumina RNA sequencing (RNA-Seq) was performed on samples from Jerusalem artichoke leaves, roots, stems and two different tuber tissues (early and late tuber development). Data were used for de novo assembly and characterization of the transcriptome. In total 206,215,632 paired-end reads were generated. These were assembled into 66,322 loci with 272,548 transcripts. Loci were annotated by querying against the NCBI non-redundant, Phytozome and UniProt databases, and 40,215 loci were homologous to existing database sequences. Gene Ontology terms were assigned to 19,848 loci, 15,434 loci were matched to 25 Clusters of Eukaryotic Orthologous Groups classifications, and 11,844 loci were classified into 142 Kyoto Encyclopedia of Genes and Genomes pathways. The assembled loci also contained 10,778 potential simple sequence repeats. The newly assembled transcriptome was used to identify loci with tissue-specific differential expression patterns. In total, 670 loci exhibited tissue-specific expression, and a subset of these were confirmed using RT-PCR and qRT-PCR. Gene expression related to inulin biosynthesis in tuber tissue was also investigated. Exsiting genetic and genomic data for H. tuberosus are scarce. The sequence resources developed in this study will enable the analysis of thousands of transcripts and will thus accelerate marker-assisted breeding studies and studies of inulin biosynthesis in Jerusalem artichoke.

  1. RNA-Seq Analysis and De Novo Transcriptome Assembly of Jerusalem Artichoke (Helianthus tuberosus Linne)

    PubMed Central

    Kim, Chul Wook; Kim, Hyun-Soon; Min, Sung Ran; Moon, Jae Sun; Kwon, Suk-Yoon; Jeon, Jae-Heung; Cho, Hye Sun

    2014-01-01

    Jerusalem artichoke (Helianthus tuberosus L.) has long been cultivated as a vegetable and as a source of fructans (inulin) for pharmaceutical applications in diabetes and obesity prevention. However, transcriptomic and genomic data for Jerusalem artichoke remain scarce. In this study, Illumina RNA sequencing (RNA-Seq) was performed on samples from Jerusalem artichoke leaves, roots, stems and two different tuber tissues (early and late tuber development). Data were used for de novo assembly and characterization of the transcriptome. In total 206,215,632 paired-end reads were generated. These were assembled into 66,322 loci with 272,548 transcripts. Loci were annotated by querying against the NCBI non-redundant, Phytozome and UniProt databases, and 40,215 loci were homologous to existing database sequences. Gene Ontology terms were assigned to 19,848 loci, 15,434 loci were matched to 25 Clusters of Eukaryotic Orthologous Groups classifications, and 11,844 loci were classified into 142 Kyoto Encyclopedia of Genes and Genomes pathways. The assembled loci also contained 10,778 potential simple sequence repeats. The newly assembled transcriptome was used to identify loci with tissue-specific differential expression patterns. In total, 670 loci exhibited tissue-specific expression, and a subset of these were confirmed using RT-PCR and qRT-PCR. Gene expression related to inulin biosynthesis in tuber tissue was also investigated. Exsiting genetic and genomic data for H. tuberosus are scarce. The sequence resources developed in this study will enable the analysis of thousands of transcripts and will thus accelerate marker-assisted breeding studies and studies of inulin biosynthesis in Jerusalem artichoke. PMID:25375764

  2. RNA-seq analysis and de novo transcriptome assembly of Jerusalem artichoke (Helianthus tuberosus Linne).

    PubMed

    Jung, Won Yong; Lee, Sang Sook; Kim, Chul Wook; Kim, Hyun-Soon; Min, Sung Ran; Moon, Jae Sun; Kwon, Suk-Yoon; Jeon, Jae-Heung; Cho, Hye Sun

    2014-01-01

    Jerusalem artichoke (Helianthus tuberosus L.) has long been cultivated as a vegetable and as a source of fructans (inulin) for pharmaceutical applications in diabetes and obesity prevention. However, transcriptomic and genomic data for Jerusalem artichoke remain scarce. In this study, Illumina RNA sequencing (RNA-Seq) was performed on samples from Jerusalem artichoke leaves, roots, stems and two different tuber tissues (early and late tuber development). Data were used for de novo assembly and characterization of the transcriptome. In total 206,215,632 paired-end reads were generated. These were assembled into 66,322 loci with 272,548 transcripts. Loci were annotated by querying against the NCBI non-redundant, Phytozome and UniProt databases, and 40,215 loci were homologous to existing database sequences. Gene Ontology terms were assigned to 19,848 loci, 15,434 loci were matched to 25 Clusters of Eukaryotic Orthologous Groups classifications, and 11,844 loci were classified into 142 Kyoto Encyclopedia of Genes and Genomes pathways. The assembled loci also contained 10,778 potential simple sequence repeats. The newly assembled transcriptome was used to identify loci with tissue-specific differential expression patterns. In total, 670 loci exhibited tissue-specific expression, and a subset of these were confirmed using RT-PCR and qRT-PCR. Gene expression related to inulin biosynthesis in tuber tissue was also investigated. Exsiting genetic and genomic data for H. tuberosus are scarce. The sequence resources developed in this study will enable the analysis of thousands of transcripts and will thus accelerate marker-assisted breeding studies and studies of inulin biosynthesis in Jerusalem artichoke. PMID:25375764

  3. [Analysis of chlorogenic acids in Helianthus tuberosus Linn leaves using high performance liquid chromatography-mass spectrometry].

    PubMed

    Yuan, Xiaoyan; Gao, Mingzhe; Wang, Kai; Xiao, Hongbin; Tan, Chengyu; Du, Yuguang

    2008-05-01

    To identify chlorogenic acids in Helianthus tuberosus Linn leaves, a method of high performance liquid chromatography-ultraviolet-mass spectrometry (HPLC-UV-MS) was developed. HPLC analysis was performed on an Inertsil ODS-3 column (250 mm x 4.6 mm, 5 microm). The mobile phase consisted of 1% acetic acid (A) and methanol (B). A gradient program was adopted as follows: 0 - 10 min, 20% B to 35% B; 10 - 25 min, 35% B to 50% B; 25 - 35 min, 50% B to 80% B. The flow rate was set at 1.0 mL/min and the column temperature was 35 degrees C. HPLC chromatogram was extracted at 327 nm. The mass spectrometer used was a TSQ triple quadrupole MS equipped with an electrospray ionization (ESI) interface. Initially, the mass spectrometer was programmed to perform full scan ranging from m/z 250 - 1 200. For MS/MS, negative ion monitoring mode was used and the collision energy was set at 10 - 45 eV. By analyzing UV characteristics and MS fragmentation patterns, 7 chlorogenic acids were assigned to be three categories, i. e., three caffeoylquinic acids, one feruloylquinic acid and three dicaffeoylquinic acids. As the results of the method development efforts, an effective and fast method for the qualitative identification of the chlorogenic acids in Helianthus tuberosus Linn leaves was established.

  4. Evolution of the leaf economics spectrum in herbs: Evidence from environmental divergences in leaf physiology across Helianthus (Asteraceae).

    PubMed

    Mason, Chase M; Donovan, Lisa A

    2015-10-01

    The leaf economics spectrum (LES) describes a major axis of plant functional trait variation worldwide, defining suites of leaf traits aligned with resource-acquisitive to resource-conservative ecological strategies. The LES has been interpreted to arise from leaf-level trade-offs among ecophysiological traits common to all plants. However, it has been suggested that the defining leaf-level trade-offs of the LES may not hold within specific functional groups (e.g., herbs) nor within many groups of closely related species, which challenges the usefulness of the LES paradigm across evolutionary scales. Here, we examine the evolution of the LES across 28 species of the diverse herbaceous genus Helianthus (the sunflowers), which occupies a wide range of habitats and climate variation across North America. Using a phylogenetic comparative approach, we find repeated evolution of more resource-acquisitive LES strategies in cooler, drier, and more fertile environments. We also find macroevolutionary correlations among LES traits that recapitulate aspects of the global LES, but with one major difference: leaf mass per area is uncorrelated with leaf lifespan. This indicates that whole-plant processes likely drive variation in leaf lifespan across Helianthus, rather than leaf-level trade-offs. These results suggest that LES patterns do not reflect universal physiological trade-offs at small evolutionary scales.

  5. Analysis of Phenolic Acids of Jerusalem Artichoke (Helianthus tuberosus L.) Responding to Salt-Stress by Liquid Chromatography/Tandem Mass Spectrometry

    PubMed Central

    Chen, Fujia; Long, Xiaohua; Liu, Zhaopu; Shao, Hongbo; Liu, Ling

    2014-01-01

    Plant phenolics can have applications in pharmaceutical and other industries. To identify and quantify the phenolic compounds in Helianthus tuberosus leaves, qualitative analysis was performed by a reversed phase high-performance liquid chromatography coupled with tandem mass spectrometry (HPLC-MS/MS) and quantitative analysis by HPLC. Ten chlorogenic acids (CGAs) were identified (3-o-caffeoylquinic acid, two isomers of caffeoylquinic acid, caffeic acid, p-coumaroyl-quinic acid, feruloylquinic acid, 3,4-dicaffeoyquinic acid, 3,5-dicaffeoylquinic acid, 1,5-dicaffeoylquinic acid, and 4,5-dicaffeoylquinic acid) by comparing their retention times, UV-Vis absorption spectra, and MS/MS spectra with standards. In addition, four other phenolic compounds, including caffeoyl glucopyranose, isorhamnetin glucoside, kaempferol glucuronide, and kaempferol-3-o-glucoside, were tentatively identified in Helianthus tuberosus leaves for the first time. The 3-o-caffeoylquinic acid (7.752 mg/g DW), 4,5-dicaffeoylquinic acid (5.633 mg/g DW), and 3,5-dicaffeoylquinic acid (4.900 mg/g DW) were the major phenolic compounds in leaves of Helianthus tuberosus cultivar NanYu in maturity. The variations in phenolic concentrations and proportions in Helianthus tuberosus leaves were influenced by genotype and plant growth stage. Cultivar NanYu had the highest concentration of phenolic compounds, in particular 3-o-caffeoylquinic acid and 4,5-dicaffeoylquinic acid compared with the other genotypes (wild accession and QingYu). Considering various growth stages, the concentration of total phenolics in cultivar NanYu was higher at flowering stage (5.270 mg/g DW) than at budding and tuber swelling stages. Cultivar NanYu of Helianthus tuberosus is a potential source of natural phenolics that may play an important role in the development of pharmaceuticals. PMID:25302328

  6. Analysis of phenolic acids of Jerusalem artichoke (Helianthus tuberosus L.) responding to salt-stress by liquid chromatography/tandem mass spectrometry.

    PubMed

    Chen, Fujia; Long, Xiaohua; Liu, Zhaopu; Shao, Hongbo; Liu, Ling

    2014-01-01

    Plant phenolics can have applications in pharmaceutical and other industries. To identify and quantify the phenolic compounds in Helianthus tuberosus leaves, qualitative analysis was performed by a reversed phase high-performance liquid chromatography coupled with tandem mass spectrometry (HPLC-MS/MS) and quantitative analysis by HPLC. Ten chlorogenic acids (CGAs) were identified (3-o-caffeoylquinic acid, two isomers of caffeoylquinic acid, caffeic acid, p-coumaroyl-quinic acid, feruloylquinic acid, 3,4-dicaffeoyquinic acid, 3,5-dicaffeoylquinic acid, 1,5-dicaffeoylquinic acid, and 4,5-dicaffeoylquinic acid) by comparing their retention times, UV-Vis absorption spectra, and MS/MS spectra with standards. In addition, four other phenolic compounds, including caffeoyl glucopyranose, isorhamnetin glucoside, kaempferol glucuronide, and kaempferol-3-o-glucoside, were tentatively identified in Helianthus tuberosus leaves for the first time. The 3-o-caffeoylquinic acid (7.752 mg/g DW), 4,5-dicaffeoylquinic acid (5.633 mg/g DW), and 3,5-dicaffeoylquinic acid (4.900 mg/g DW) were the major phenolic compounds in leaves of Helianthus tuberosus cultivar NanYu in maturity. The variations in phenolic concentrations and proportions in Helianthus tuberosus leaves were influenced by genotype and plant growth stage. Cultivar NanYu had the highest concentration of phenolic compounds, in particular 3-o-caffeoylquinic acid and 4,5-dicaffeoylquinic acid compared with the other genotypes (wild accession and QingYu). Considering various growth stages, the concentration of total phenolics in cultivar NanYu was higher at flowering stage (5.270 mg/g DW) than at budding and tuber swelling stages. Cultivar NanYu of Helianthus tuberosus is a potential source of natural phenolics that may play an important role in the development of pharmaceuticals.

  7. Analysis of phenolic acids of Jerusalem artichoke (Helianthus tuberosus L.) responding to salt-stress by liquid chromatography/tandem mass spectrometry.

    PubMed

    Chen, Fujia; Long, Xiaohua; Liu, Zhaopu; Shao, Hongbo; Liu, Ling

    2014-01-01

    Plant phenolics can have applications in pharmaceutical and other industries. To identify and quantify the phenolic compounds in Helianthus tuberosus leaves, qualitative analysis was performed by a reversed phase high-performance liquid chromatography coupled with tandem mass spectrometry (HPLC-MS/MS) and quantitative analysis by HPLC. Ten chlorogenic acids (CGAs) were identified (3-o-caffeoylquinic acid, two isomers of caffeoylquinic acid, caffeic acid, p-coumaroyl-quinic acid, feruloylquinic acid, 3,4-dicaffeoyquinic acid, 3,5-dicaffeoylquinic acid, 1,5-dicaffeoylquinic acid, and 4,5-dicaffeoylquinic acid) by comparing their retention times, UV-Vis absorption spectra, and MS/MS spectra with standards. In addition, four other phenolic compounds, including caffeoyl glucopyranose, isorhamnetin glucoside, kaempferol glucuronide, and kaempferol-3-o-glucoside, were tentatively identified in Helianthus tuberosus leaves for the first time. The 3-o-caffeoylquinic acid (7.752 mg/g DW), 4,5-dicaffeoylquinic acid (5.633 mg/g DW), and 3,5-dicaffeoylquinic acid (4.900 mg/g DW) were the major phenolic compounds in leaves of Helianthus tuberosus cultivar NanYu in maturity. The variations in phenolic concentrations and proportions in Helianthus tuberosus leaves were influenced by genotype and plant growth stage. Cultivar NanYu had the highest concentration of phenolic compounds, in particular 3-o-caffeoylquinic acid and 4,5-dicaffeoylquinic acid compared with the other genotypes (wild accession and QingYu). Considering various growth stages, the concentration of total phenolics in cultivar NanYu was higher at flowering stage (5.270 mg/g DW) than at budding and tuber swelling stages. Cultivar NanYu of Helianthus tuberosus is a potential source of natural phenolics that may play an important role in the development of pharmaceuticals. PMID:25302328

  8. Host plant effects on development and reproduction of the glassy-winged sharpshooter, Homalodisca vitripennis (Homoptera: Cicadellidae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Development, survivorship, longevity, reproduction and life table parameters of the glassy-winged sharpshooter, Homalodisca vitripennis (Germar), were examined in the laboratory using three host plants, sunflower (Helianthus annuus L.), Chrysanthemum morifolium L. and euonymus (Euonymus japonica Thu...

  9. Methods for assessing infestations of sunflower stem weevil (Coleoptera: Curculionidae) in sunflower stems

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The sunflower stem weevil, Cylindrocopturus adspersus LeConte (Coleoptera: Curculionidae), reduces sunflower, Helianthus annuus L. (Asteraceae), yields by spreading pathogens, damaging vascular tissues, and promoting lodging of sunflower plants. To assess weevil populations for host plant resistanc...

  10. Biomass, extracted liquid yields, sugar content or seed yields of biofuel feedstocks as affected by fertilizer

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Harvesting products from plants for conversion into renewable resources is increasing in importance. Determination of nutrition requirements for the applicable crops is necessary, especially in regions where the biofuel feedstock crops have not been grown historically. Sunflower (Helianthus annuus...

  11. Two variants of the major serine protease inhibitor from the sea anemone Stichodactyla helianthus, expressed in Pichia pastoris.

    PubMed

    García-Fernández, Rossana; Ziegelmüller, Patrick; González, Lidice; Mansur, Manuel; Machado, Yoan; Redecke, Lars; Hahn, Ulrich; Betzel, Christian; Chávez, María de Los Ángeles

    2016-07-01

    The major protease inhibitor from the sea anemone Stichodactyla helianthus (ShPI-1) is a non-specific inhibitor that binds trypsin and other trypsin-like enzymes, as well as chymotrypsin, and human neutrophil elastase. We performed site-directed mutagenesis of ShPI-1 to produce two variants (rShPI-1/K13L and rShPI/Y15S) that were expressed in Pichia pastoris, purified, and characterized. After a single purification step, 65 mg and 15 mg of protein per liter of culture supernatant were obtained for rShPI-1/K13L and rShPI/Y15S, respectively. Functional studies demonstrated a 100-fold decreased trypsin inhibitory activity as result of the K13L substitution at the reactive (P1) site. This protein variant has a novel tight-binding inhibitor activity of pancreatic elastase and increased activity toward neutrophil elastase in comparison to rShPI-1A. In contrast, the substitution Y15S at P2' site did not affect the Ki value against trypsin, but did reduce activity 10-fold against chymotrypsin and neutrophil elastase. Our results provide two new ShPI-1 variants with modified inhibitory activities, one of them with increased biomedical potential. This study also offers new insight into the functional impact of the P1 and P2' sites on ShPI-1 specificity. PMID:26993255

  12. Functional analyses of a putative plasma membrane Na+/H+ antiporter gene isolated from salt tolerant Helianthus tuberosus.

    PubMed

    Li, Qing; Tang, Zhong; Hu, Yibing; Yu, Ling; Liu, Zhaopu; Xu, Guohua

    2014-08-01

    Jerusalem artichokes (Helianthus tuberosus L.) can tolerate relatively higher salinity, drought and heat stress. In this paper, we report the cloning of a Salt Overly Sensitive 1 (SOS1) gene encoding a plasma membrane Na(+)/H(+) antiporter from a highly salt-tolerant genotype of H. tuberosus, NY1, named HtSOS1 and characterization of its function in yeast and rice. The amino acid sequence of HtSOS1 showed 83.4% identity with the previously isolated SOS1 gene from the Chrysanthemum crassum. The mRNA level in the leaves of H. tuberosus was significantly up-regulated by presence of high concentrations of NaCl. Localization analysis using rice protoplast expression showed that the protein encoded by HtSOS1 was located in the plasma membrane. HtSOS1 partially suppressed the salt sensitive phenotypes of a salt sensitive yeast strain. In comparison with wild type (Oryza sativa L., ssp. Japonica. cv. Nipponbare), the transgenic rice expressed with HtSOS1 could exclude more Na(+) and accumulate more K(+). Expression of HtSOS1 decreased Na(+) content much larger in the shoot than in the roots, resulting in more water content in the transgenic rice than WT. These data suggested that HtSOS1 may be useful in transgenic approaches to improving the salinity tolerance of glycophyte. PMID:24771143

  13. Functional analyses of a putative plasma membrane Na+/H+ antiporter gene isolated from salt tolerant Helianthus tuberosus.

    PubMed

    Li, Qing; Tang, Zhong; Hu, Yibing; Yu, Ling; Liu, Zhaopu; Xu, Guohua

    2014-08-01

    Jerusalem artichokes (Helianthus tuberosus L.) can tolerate relatively higher salinity, drought and heat stress. In this paper, we report the cloning of a Salt Overly Sensitive 1 (SOS1) gene encoding a plasma membrane Na(+)/H(+) antiporter from a highly salt-tolerant genotype of H. tuberosus, NY1, named HtSOS1 and characterization of its function in yeast and rice. The amino acid sequence of HtSOS1 showed 83.4% identity with the previously isolated SOS1 gene from the Chrysanthemum crassum. The mRNA level in the leaves of H. tuberosus was significantly up-regulated by presence of high concentrations of NaCl. Localization analysis using rice protoplast expression showed that the protein encoded by HtSOS1 was located in the plasma membrane. HtSOS1 partially suppressed the salt sensitive phenotypes of a salt sensitive yeast strain. In comparison with wild type (Oryza sativa L., ssp. Japonica. cv. Nipponbare), the transgenic rice expressed with HtSOS1 could exclude more Na(+) and accumulate more K(+). Expression of HtSOS1 decreased Na(+) content much larger in the shoot than in the roots, resulting in more water content in the transgenic rice than WT. These data suggested that HtSOS1 may be useful in transgenic approaches to improving the salinity tolerance of glycophyte.

  14. Sequence-specific H NMR assignments and secondary structure in the sea anemone polypeptide Stichodactyla helianthus neurotoxin I

    SciTech Connect

    Fogh, R.H.; Mabbutt, B.C.; Kem, W.R.; Norton, R.S. )

    1989-02-21

    Sequence-specific assignments are reported for the 500-MHz H nuclear magnetic resonance (NMR) spectrum of the 48-residue polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus (Sh I). Spin systems were first identified by using two-dimensional relayed or multiple quantum filtered correlation spectroscopy, double quantum spectroscopy, and spin lock experiments. Specific resonance assignments were then obtained from nuclear Overhauser enhancement (NOE) connectivities between protons from residues adjacent in the amino acid sequence. Of a total of 265 potentially observable resonances, 248 (i.e., 94%) were assigned, arising from 39 completely and 9 partially assigned amino acid spin systems. The secondary structure of Sh I was defined on the basis of the pattern of sequential NOE connectivities. NOEs between protons on separate strands of the polypeptide backbone, and backbone amide exchange rates. Sh I contains a four-stranded antiparallel {beta}-sheet encompassing residues 1-5, 16-24, 30-33, and 40-46, with a {beta}-bulge at residues 17 and 18 and a reverse turn, probably a type II {beta}-turn, involving residues 27-30. No evidence of {alpha}-helical structure was found.

  15. Analysis of Essential Oil in Jerusalem Artichoke (Helianthus tuberosus L.) Leaves and Tubers by Gas Chromatography-Mass Spectrometry

    PubMed Central

    Helmi, Zead; Al Azzam, Khaldun Mohammad; Tsymbalista, Yuliya; Ghazleh, Refat Abo; Shaibah, Hassan; Aboul-Enein, Hassan

    2014-01-01

    Purpose: To investigate, for the first time, the chemical composition of essential oil of the tubers and leaves of Jerusalem artichoke (Helianthus tuberosus L.), a species of sunflower native to eastern North America, growing in Ukraine. Methods: A hydrodistillation apparatus was used for the extraction of volatile components and then it was analysed by gas chromatography equipped with a split-splitless injector (split ratio, 1:50) and flame ionization detector (FID). The oil was analyzed under linear temperature programming applied at 4°C/min from 50°C - 340°C. Temperatures of the injector and FID detector were maintained at 280°C and 300°C, respectively. The chemical analysis of the oil was carried out using gas chromatography coupled to mass spectrometry (GC-MS), to determine the chemical composition of the volatile fraction. Results: The essential oils content ranged from 0.00019 to 0.03486 and 0.00011 to 0.00205 (g/100g), in leaves and tubers, respectively. The qualitative and quantitative analysis led to the identification of 17 components in both species samples. The major component found in leaves and tubers was (-)-β-bisabolene with 70.7% and 63.1%, respectively. Conclusion: Essential oil profile of Jerusalem artichoke species showed significant differences between leaves and tubers species. Additionally, the leaves of Jerusalem artichoke are a promising source of natural β-bisabolene. PMID:25671184

  16. Sunflower stem weevil and its larval parasitoids in native sunflowers: Is parasitoid abundance and diversity greater in the US Southwest?

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower stem weevils (Cylindrocopturus adspersus) and their larval parasitoids were collected from stems of four native sunflower species (Helianthus annuus, H. nuttallii, H. pauciflorus, and H. petiolaris) from 147 sites across eight states in 2003 and 2005. Native H. annuus constituted the major...

  17. Evaluating perennial sunflower for wildlife and food uses

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The objective of this research is to use current genetics and plant breeding techniques to introgress genes for perennial habit from Helianthus tuberosus L. (2n=6x=102) into domesticated sunflower (Helianthus annuus L., 2n=2x=34). H. tuberosusis part of the secondary gene pool of sunflower and has b...

  18. Nuclear magnetic resonance study of the solution properties of the polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus

    SciTech Connect

    Norton, R.S.; Cossins, A.I.; Kem, W.R. )

    1989-02-21

    The solution properties of the polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus (Sh I) have been investigated by high-resolution H nuclear magnetic resonance (NMR) spectroscopy at 300 MHz. The pH dependence of the spectra has been examined over the range 1.1-12.2 at 27{degree}C. Individual pK{sub a} values have been obtained for the {alpha}-ammonium group of Ala-1 (8.6) and the side chains of Glu-8 (3.7), Tyr-36 (10.9), and Tyr-37 (10.8). For the remaining seven carboxyl groups in the molecule, four pK{sub a} values can be clearly identified. The five Lys residues titrate in the range 10.5-11, but individual pK{sub a} values could not be obtained because of peak overlap. Conformational changes associated with the protonation of carboxylates occur below pH 4, while in the alkaline pH range major unfolding occurs above pH 10. The molecule also unfolds at elevated temperatures. Exchange of the backbone amide protons has been monitored at various values of pH and temperature in the ranges pH 4-5 and 12-27{degree}C. Comparison of these properties of Sh I in solution with those of the related polypeptides anthopleurin A and Anemonia sulcata toxins I and II indicates that Sh I is less stable thermally and that there are some significant differences in the ionic interactions that maintain the tertiary structure. The solvent accessibility of aromatic residues has been probed with photochemically induced dynamic nuclear polarization NMR at 360 MHz.

  19. Cloning and functional characterization of two abiotic stress-responsive Jerusalem artichoke (Helianthus tuberosus) fructan 1-exohydrolases (1-FEHs).

    PubMed

    Xu, Huanhuan; Liang, Mingxiang; Xu, Li; Li, Hui; Zhang, Xi; Kang, Jian; Zhao, Qingxin; Zhao, Haiyan

    2015-01-01

    Two fructan hydrolases were previously reported to exist in Jerusalem artichoke (Helianthus tuberosus) and one native fructan-β-fructosidase (1-FEH) was purified to homogeneity by SDS-PAGE, but no corresponding cDNA was cloned. Here, we cloned two full-length 1-FEH cDNA sequences from Jerusalem artichoke, named Ht1-FEH I and Ht1-FEH II, which showed high levels of identity with chicory 1-FEH I and 1-FEH II. Functional characterization of the corresponding recombinant proteins in Pichia pastoris X-33 demonstrated that both Ht1-FEHs had high levels of hydrolase activity towards β(2,1)-linked fructans, but low or no activity towards β(2,6)-linked levan and sucrose. Like other plant FEHs, the activities of the recombinant Ht1-FEHs were greatly inhibited by sucrose. Real-time quantitative PCR analysis showed that Ht1-FEH I transcripts accumulated to high levels in the developing leaves and stems of artichoke, whereas the expression levels of Ht1-FEH II increased in tubers during tuber sprouting, which implies that the two Ht1-FEHs play different roles. The levels of both Ht1-FEH I and II transcript were significantly increased in the stems of NaCl-treated plants. NaCl treatment also induced transcription of both Ht1-FEHs in the tubers, while PEG treatments slightly inhibited the expression of Ht1-FEH II in tubers. Analysis of sugar-metabolizing enzyme activities and carbohydrate concentration via HPLC showed that the enzyme activities of 1-FEHs were increased but the fructose content was decreased under NaCl and PEG treatments. Given that FEH hydrolyzes fructan to yield Fru, we discuss possible explanations for the inconsistency between 1-FEH activity and fructan dynamics in artichokes subjected to abiotic stress. PMID:25522837

  20. Fine root tradeoffs between nitrogen concentration and xylem vessel traits preclude unified whole-plant resource strategies in Helianthus.

    PubMed

    Bowsher, Alan W; Mason, Chase M; Goolsby, Eric W; Donovan, Lisa A

    2016-02-01

    Recent work suggests variation in plant growth strategies is governed by a tradeoff in resource acquisition and use, ranging from a rapid resource acquisition strategy to a resource-conservative strategy. While evidence for this tradeoff has been found in leaves, knowledge of root trait strategies, and whether they reflect adaptive differentiation across environments, is limited. In the greenhouse, we investigated variation in fine root morphology (specific root length and tissue density), chemistry (nitrogen concentration and carbon:nitrogen), and anatomy (root cross-sectional traits) in populations of 26 Helianthus species and sister Phoebanthus tenuifolius. We also compared root trait variation in this study with leaf trait variation previously reported in a parallel study of these populations. Root traits varied widely and exhibited little phylogenetic signal, suggesting high evolutionary lability. Specific root length and root tissue density were weakly negatively correlated, but neither was associated with root nitrogen, providing little support for a single axis of root trait covariation. Correlations between traits measured in the greenhouse and native site characteristics were generally weak, suggesting a variety of equally viable root trait combinations exist within and across environments. However, high root nitrogen was associated with lower xylem vessel number and cross-sectional area, suggesting a tradeoff between nutrient investment and water transport capacity. This led to correlations between root and leaf traits that were not always consistent with an acquisition-conservation tradeoff at the whole-plant level. Given that roots must balance acquisition of water and nutrients with functions like anchorage, exudation, and microbial symbioses, the varied evidence for root trait covariation likely reflects the complexity of interacting selection pressures belowground. Similarly, the lack of evidence for a single acquisition-conservation tradeoff at the

  1. Cloning and functional characterization of two abiotic stress-responsive Jerusalem artichoke (Helianthus tuberosus) fructan 1-exohydrolases (1-FEHs).

    PubMed

    Xu, Huanhuan; Liang, Mingxiang; Xu, Li; Li, Hui; Zhang, Xi; Kang, Jian; Zhao, Qingxin; Zhao, Haiyan

    2015-01-01

    Two fructan hydrolases were previously reported to exist in Jerusalem artichoke (Helianthus tuberosus) and one native fructan-β-fructosidase (1-FEH) was purified to homogeneity by SDS-PAGE, but no corresponding cDNA was cloned. Here, we cloned two full-length 1-FEH cDNA sequences from Jerusalem artichoke, named Ht1-FEH I and Ht1-FEH II, which showed high levels of identity with chicory 1-FEH I and 1-FEH II. Functional characterization of the corresponding recombinant proteins in Pichia pastoris X-33 demonstrated that both Ht1-FEHs had high levels of hydrolase activity towards β(2,1)-linked fructans, but low or no activity towards β(2,6)-linked levan and sucrose. Like other plant FEHs, the activities of the recombinant Ht1-FEHs were greatly inhibited by sucrose. Real-time quantitative PCR analysis showed that Ht1-FEH I transcripts accumulated to high levels in the developing leaves and stems of artichoke, whereas the expression levels of Ht1-FEH II increased in tubers during tuber sprouting, which implies that the two Ht1-FEHs play different roles. The levels of both Ht1-FEH I and II transcript were significantly increased in the stems of NaCl-treated plants. NaCl treatment also induced transcription of both Ht1-FEHs in the tubers, while PEG treatments slightly inhibited the expression of Ht1-FEH II in tubers. Analysis of sugar-metabolizing enzyme activities and carbohydrate concentration via HPLC showed that the enzyme activities of 1-FEHs were increased but the fructose content was decreased under NaCl and PEG treatments. Given that FEH hydrolyzes fructan to yield Fru, we discuss possible explanations for the inconsistency between 1-FEH activity and fructan dynamics in artichokes subjected to abiotic stress.

  2. Substitution of a single residue in Stichodactyla helianthus peptide, ShK-Dap22, reveals a novel pharmacological profile.

    PubMed

    Middleton, Richard E; Sanchez, Manuel; Linde, Ana-Rosa; Bugianesi, Randal M; Dai, Ge; Felix, John P; Koprak, Sam L; Staruch, Mary Jo; Bruguera, Marc; Cox, Rachael; Ghosh, Amrita; Hwang, Jeremy; Jones, Simmonette; Kohler, Martin; Slaughter, Robert S; McManus, Owen B; Kaczorowski, Gregory J; Garcia, Maria L

    2003-11-25

    ShK, a peptide isolated from Stichodactyla helianthus venom, blocks the voltage-gated potassium channels, K(v)1.1 and K(v)1.3, with similar high affinity. ShK-Dap(22), a synthetic derivative in which a diaminopropionic acid residue has been substituted at position Lys(22), has been reported to be a selective K(v)1.3 inhibitor and to block this channel with equivalent potency as ShK [Kalman et al. (1998) J. Biol. Chem. 273, 32697-32707]. In this study, a large body of evidence is presented which indicates that the potencies of wild-type ShK peptide for both K(v)1.3 and K(v)1.1 channels have been previously underestimated. Therefore, the affinity of ShK-Dap(22) for both channels appears to be ca. 10(2)-10(4)-fold weaker than ShK. ShK-Dap(22) does display ca. 20-fold selectivity for human K(v)1.3 vs K(v)1.1 when measured by the whole-cell voltage clamp method but not in equilibrium binding assays. ShK-Dap(22) has low affinity for K(v)1.2 channels, but heteromultimeric K(v)1.1-K(v)1.2 channels form a receptor with ca. 200-fold higher affinity for ShK-Dap(22) than K(v)1.1 homomultimers. In fact, K(v)1.1-K(v)1.2 channels bind ShK-Dap(22) with only ca. 10-fold less potency than ShK and reveal a novel pharmacology not predicted from the homomultimers of K(v)1.1 or K(v)1.2. The concentrations of ShK-Dap(22) needed to inhibit human T cell activation were ca. 10(3)-fold higher than those of ShK, in good correlation with the relative affinities of these peptides for inhibiting K(v)1.3 channels. All of these data, taken together, suggest that ShK-Dap(22) will not have the same in vivo immunosuppressant efficacy of other K(v)1.3 blockers, such as margatoxin or ShK. Moreover, ShK-Dap(22) may have undesired side effects due to its interaction with heteromultimeric K(v)1.1-K(v)1.2 channels, such as those present in brain and/or peripheral tissues. PMID:14622016

  3. Sticholysins, two pore-forming toxins produced by the Caribbean Sea anemone Stichodactyla helianthus: their interaction with membranes.

    PubMed

    Alvarez, Carlos; Mancheño, José M; Martínez, Diana; Tejuca, Mayra; Pazos, Fabiola; Lanio, María E

    2009-12-15

    Sticholysins (Sts) I and II (StI/II) are pore-forming toxins (PFTs) produced by the Caribbean Sea anemone Stichodactyla helianthus belonging to the actinoporin family, a unique class of eukaryotic PFTs exclusively found in sea anemones. As for the rest of the members of this family, Sts are cysteine-less proteins, with molecular weights around 20 kDa, high isoelectric points (>9.5), and a preference for sphingomyelin-containing membranes. A three-dimensional structure of StII, solved by X-ray crystallography, showed that it is composed of a hydrophobic beta-sandwich core flanked on the opposite sides by two alpha helices comprising residues 14-23 and 128-135. A variety of experimental results indicate that the first thirty N-terminal residues, which include one of the helices, are directly involved in pore formation. This region contains an amphipathic stretch, well conserved in all actinoporins, which is the only portion of the molecule that can change conformation without perturbing the general protein fold; in fact, binding to model membranes only produces a slight increase in the regular secondary structure content of Sts. Sts are produced in soluble form but they readily bind to different cell and model membrane systems such as lipidic monolayers, micelles, and lipid vesicles. Remarkably, both the binding and pore-formation steps are critically dependent on the physico-chemical nature of the membrane. In fact, a large population of toxin irreversibly binds with high affinity in membranes containing sphingomyelin whereas binding in membranes lacking this sphingolipid is relatively low and reversible. The joint presence of SM and cholesterol largely promotes binding and pore formation. Minor amounts of lipids favoring a non-lamellar organization also augment the efficiency of pore formation. The functional pore formed in cellular and model membranes has a diameter of approximately 2.0 nm and is presumably formed by the N-terminal alpha helices of four monomers

  4. Substitution of a single residue in Stichodactyla helianthus peptide, ShK-Dap22, reveals a novel pharmacological profile.

    PubMed

    Middleton, Richard E; Sanchez, Manuel; Linde, Ana-Rosa; Bugianesi, Randal M; Dai, Ge; Felix, John P; Koprak, Sam L; Staruch, Mary Jo; Bruguera, Marc; Cox, Rachael; Ghosh, Amrita; Hwang, Jeremy; Jones, Simmonette; Kohler, Martin; Slaughter, Robert S; McManus, Owen B; Kaczorowski, Gregory J; Garcia, Maria L

    2003-11-25

    ShK, a peptide isolated from Stichodactyla helianthus venom, blocks the voltage-gated potassium channels, K(v)1.1 and K(v)1.3, with similar high affinity. ShK-Dap(22), a synthetic derivative in which a diaminopropionic acid residue has been substituted at position Lys(22), has been reported to be a selective K(v)1.3 inhibitor and to block this channel with equivalent potency as ShK [Kalman et al. (1998) J. Biol. Chem. 273, 32697-32707]. In this study, a large body of evidence is presented which indicates that the potencies of wild-type ShK peptide for both K(v)1.3 and K(v)1.1 channels have been previously underestimated. Therefore, the affinity of ShK-Dap(22) for both channels appears to be ca. 10(2)-10(4)-fold weaker than ShK. ShK-Dap(22) does display ca. 20-fold selectivity for human K(v)1.3 vs K(v)1.1 when measured by the whole-cell voltage clamp method but not in equilibrium binding assays. ShK-Dap(22) has low affinity for K(v)1.2 channels, but heteromultimeric K(v)1.1-K(v)1.2 channels form a receptor with ca. 200-fold higher affinity for ShK-Dap(22) than K(v)1.1 homomultimers. In fact, K(v)1.1-K(v)1.2 channels bind ShK-Dap(22) with only ca. 10-fold less potency than ShK and reveal a novel pharmacology not predicted from the homomultimers of K(v)1.1 or K(v)1.2. The concentrations of ShK-Dap(22) needed to inhibit human T cell activation were ca. 10(3)-fold higher than those of ShK, in good correlation with the relative affinities of these peptides for inhibiting K(v)1.3 channels. All of these data, taken together, suggest that ShK-Dap(22) will not have the same in vivo immunosuppressant efficacy of other K(v)1.3 blockers, such as margatoxin or ShK. Moreover, ShK-Dap(22) may have undesired side effects due to its interaction with heteromultimeric K(v)1.1-K(v)1.2 channels, such as those present in brain and/or peripheral tissues.

  5. Hybrid zones as a tool for identifying adaptive genetic variation in outbreeding forest trees: lessons from wild annual sunflowers (Helianthus spp.).

    PubMed

    Lexer, Christian; Heinze, Berthold; Alia, Ricardo; Rieseberg, Loren H

    2004-08-01

    The identification and study of adaptively important genes in forest trees represents a formidable challenge because of their long generation spans. In annual or perennial herbs, formal genetic studies can be employed to identify the quantitative trait loci (QTLs) and/or candidate genes that underlie important traits, and the segregating populations can be transplanted into natural populations to measure the strength and direction of selection. However, the application of these methods to forest trees is difficult, because the creation of appropriate genetic material is extremely time-consuming in long-lived, woody plants, and lifetime fitness estimates are difficult or impossible to obtain. Although QTL mapping should in principle be feasible in wild intraspecific populations (as an alternative to artificial crosses), this approach is less likely to be successful in trees because LD (linkage disequilibrium) will decay quickly in large outbreeding plant populations. Within the present paper, we discuss a modified approach based on natural hybrid zones. We describe the use of wild annual sunflowers (Helianthus spp.) as a model for exploring the hybrid zone approach. Transplanted experimental hybrids allowed us to assess the adaptive value of individual chromosomal blocks in nature, and data on natural Helianthus hybrids suggest that similar approaches are possible in natural hybrid zones. Our results allowed us to test the role of hybridization in the origin of ecological divergence in wild sunflowers. In addition, they have practical implications for identifying adaptively important genes or QTLs in trees. This is exemplified by three temperate forest taxa, Populus (poplars, aspens, cottonwoods), Fraxinus (ash), and Quercus (oak). All three are diploid and important genomic tools are under development. Moreover, all three offer extensive hybrid zones whose likely age can be inferred from fossil data. Age data enables estimates of the size and frequency of

  6. Two-dimensional crystallization on lipid monolayers and three-dimensional structure of sticholysin II, a cytolysin from the sea anemone Stichodactyla helianthus.

    PubMed Central

    Martín-Benito, J; Gavilanes, F; de Los Ríos, V; Mancheño, J M; Fernández, J J; Gavilanes, J G

    2000-01-01

    Sticholysin II (Stn II), a potent cytolytic protein isolated from the sea anemone Stichodactyla helianthus, has been crystallized on lipid monolayers. With Fourier-based methods, a three-dimensional (3D) model of Stn II, up to a resolution of 15 A, has been determined. The two-sided plane group is p22(1)2, with dimensions a = 98 A, b = 196 A. The 3D model of Stn II displays a Y-shaped structure, slightly flattened, with a small curvature along its longest dimension (51 A). This protein, with a molecular mass of 19. 2 kDa, is one of the smallest structures reconstructed with this methodology. Two-dimensional (2D) crystals of Stn II on phosphatidylcholine monolayers present a unit cell with two tetrameric motifs, with the monomers in two different orientations: one with its longest dimension lying on the crystal plane and the other with this same axis leaning at an angle of approximately 60 degrees with the crystal plane. PMID:10827995

  7. Cloning and sequence analysis of cDNA coding for a lectin from Helianthus tuberosus callus and its jasmonate-induced expression.

    PubMed

    Nakagawa, R; Yasokawa, D; Okumura, Y; Nagashima, K

    2000-06-01

    Two lectins (designated as HTA I and HTA II) that seemed to be isolectins were found in Helianthus tuberosus callus. cDNA encoding HTA I was isolated from a ZAP Express expression library by immunoselection by using the anti-HTA antiserum. The sequence of this cDNA consisted of 432 bp nucleotides coding for a polypeptide of 143 amino acid residues (Mr, 15,314). When introduced into E. coli, the cDNA directed the synthesis of active HTA I as indicated by the hemagglutination activity. The deduced amino acid sequence showed homology with some lectins and jasmonate-induced proteins. When callus was cultured in the presence of methyl jasmonate (MeJA), the hemagglutination activity increased in a dose-dependent manner. The levels of expression of the HTA protein and of the corresponding mRNA also increased in the treated callus. In view of these results, HTA I is considered to be a jasmonate-induced protein. PMID:10923797

  8. Effect of feeding low-fiber fraction of air-classified sunflower (Helianthus annus L.) meal on laying hen productive performance and egg yolk cholesterol.

    PubMed

    Laudadio, V; Ceci, E; Lastella, N M B; Tufarelli, V

    2014-11-01

    The present study was designed to determine the effect on laying performance and egg quality resulting from total substitution of soybean meal (SBM) with low-fiber sunflower meal (SFM; Helianthus annus L.) meal in diet of hens. ISA Brown layers, 28 wk of age, were randomly allocated to 2 dietary treatments and fed for 10 wk. The hens were kept in a free-range environment and fed 2 wheat middling-based diets consisting of a control diet, which contained SBM (153 g/kg of diet), and a test diet containing low-fiber SFM (160 g/kg of diet) as the main protein source. Each dietary treatment was replicated 4 times. Low-fiber SFM was obtained by a combination of sieving and air classification processes. Feed consumption was recorded daily and egg production was calculated on a hen-day basis; eggs from each group were collected weekly to evaluate egg components and quality. The total substitution of SBM with low-fiber SFM had no adverse effect on growth performance of laying hens. Egg production and none of egg quality traits examined were influenced by dietary treatment, except for yolk color (P < 0.05) and percentage of large-size eggs (P < 0.05) that were improved in hens fed the low-fiber SFM diet. Including low-fiber SFM decreased serum and egg yolk total cholesterol and low-density lipoprotein cholesterol concentrations (P < 0.001), and increased high-density lipoprotein cholesterol level. Our results suggest that the replacement of conventional soybean with low-fiber sunflower meal may be a valid alternative in diets for laying hens to improve egg quality and to develop low-cholesterol eggs.

  9. Impact of sunflower on land productivity in the semiarid steppe of the United States

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus) is widely grown in the steppe region of Ukraine and Russia because of favorable economics. Sunflower is also grown in the steppe of the United States. Sunflower, however, has damaged soil health in the U.S. steppe because of its low after-harvest residue levels, thus ...

  10. Oil productivity and composition of sunflower as a function of hybrid and planting date

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus L.) is potential cash crop for the southeastern United States for production of cooking oil or biodiesel. Two years of experiments were conducted to evaluate the effect of location (five locations in Mississippi), planting date (April 20, May 20, and June 20), and hybrid...

  11. Natural Rubber Quantification in Sunflower Using an Automated Solvent Extractor

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Leaves of sunflower (Helianthus annuus) produce a small amount of low molecular weight natural rubber (NR) and this species has potential as a rubber-producing crop plant. Quantifying NR in plant tissue has traditionally been accomplished using Soxhlet or gravimetric methodologies. Accelerated solve...

  12. Variation for seed phytosterols in sunflower germplasm

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus L.) seeds and oils are rich sources of phytosterols, which are important compounds for human nutrition. There is limited information on variability for seed phytosterols in sunflower germplasm. The objective of the present research was to evaluate kernel phytosterol cont...

  13. Consumptive Water Use and Crop Coefficients of Irrigated Sunflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In semi-arid environments, the use of irrigation is necessary for sunflower production to reach its maximum potential. The aim of this study was to quantify the consumptive water use and crop coefficients of irrigated sunflower (Helianthus annuus L.) without soil water limitations during two growing...

  14. First Report of Pathogenicity of Fusarium sporotrichioides and Fusarium acuminatum on Sunflowers in the United States

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Widespread infection of charcoal rot (Macrophomina phaseolina (Tassi) Goid) was observed in a commercial sunflower field (Helianthus annuus L. cv. 'Pioneer 63M82') in Todd County, MN in September 2009. Stem sections of the basal portion of infected plants were harvested and dissected. In addition to...

  15. Sesquiterpene lactone composition of wild and cultivated sunflowers and biological activity against an insect pest

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sesquiterpene lactones in sunflowers, Helianthus spp., are important to interactions with pathogens, weeds and insects. Across a broad range of H. annuus, differences in composition of sesquiterpene lactones extracted from florets were found between wild and cultivated sunflowers, but also between d...

  16. Thiamethoxam seed treatments hav no impact on pest numbers or yield in cultivated sunflowers

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The use of neonicotinoid seed treatments is a nearly ubiquitous practice in sunflower (Helianthus annuus) pest management. Sunflowers have a speciose pest complex, but also harbor a diverse and abundant community of beneficial, non-target organisms which may be negatively affected by pest management...

  17. Development of insect resistant sunflowers: Updates and challenges

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower Helianthus annuus L. is one of the major oil seed crops grown in the USA. with a highest estimated cultivated acreage of 975,000 acres in North Dakota. Besides diseases and weeds, insects are one of the major causes for yield losses. An average of 9-10% yield losses was attributed to insec...

  18. 2009 Sunflower Insect Pest Problems and Insecticide Update

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflowers (Helianthus annuus L.) are native to North America and a number of insect pests cause economic losses to sunflower production. Head-infesting insects include the red sunflower seed weevil, Smicronyx fulvus LeConte, banded sunflower moth, Cochylis hospes Walsingham, sunflower moth, Homoeos...

  19. Resistance in Cultivated Sunflower Germplasm to the Red Sunflower Seed Weevil (Coleoptera: Curculionidae) in the Northern Great Plains

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A 6-year field study evaluated 52 sunflower, Helianthus annuus L., accessions, 20 breeding lines, and 9 interspecific crosses for resistance to infestation by naturally occurring populations of the red sunflower seed weevil, Smicronyx fulvus LeConte (Coleoptera: Curculionidae). Germplasm with potent...

  20. Measured soil water evaporation as a function of the square root of time and reference ET

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus L.) is a drought-adapted crop with a short growing season that reduces irrigation requirements and makes it ideal for regions with limited irrigation water supplies. Our objectives were a) to evaluate the yield potential of sunflower under deficit irrigation and b) det...

  1. Impact of irrigation on larval density of stem-infesting pests of cultivated sunflower in Kansas

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The guild of stem-infesting insect pests of cultivated sunflower, Helianthus annuus L., within the central Plains is a concern to producers chiefly due to losses caused by plant lodging from the sunflower stem weevil, Cylindrocopturus adspersus (LeConte) (Coleoptera: Curculionidae) and Dectes texanu...

  2. Impact of combining planting date and chemical control to reduce larval densities of stem-infesting pests of sunflower in the Central Plains

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The guild of stem-infesting insect pests of sunflower, Helianthus annuus L., within the central Plains is a concern to producers chiefly due to losses caused by plant lodging from the sunflower stem weevil, Cylindrocopturus adspersus (LeConte) (Coleoptera: Curculionidae) and Dectes texanus texanus L...

  3. Registration of cytoplasmic male-sterile oilseed sunflower genetic stocks CMS GIG2 and CMS GIG2-RV, and fertility restoration lines RF GIG2-MAX 1631 and RF GIG2-MAX 1631-RV

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Two cytoplasmic male-sterile (CMS) oilseed sunflower (Helianthus annuus L.) genetic stocks, CMS GIG2 (Reg. No. xxx, PI xxxx), and CMS GIG2-RV (Reg. No. xxx, PI xxxx), and corresponding fertility restoration lines RF GIG2-MAX 1631 (Reg. No. xxx, PI xxxx) and RF GIG2-MAX 1631-RV (Reg. No. xxx, PI xxx...

  4. Registration of a male fertility restorer oilseed sunflower germplasm HA-R9 resistant to sunflower rust

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The sunflower (Helianthus annuus L.) germplasm HA-R9 (Reg. No.xxx, PI 667595) was developed by the USDA-ARS, Sunflower and Plant Biology Research Unit in collaboration with the Agricultural Experiment Station of North Dakota State University and released in January, 2013. Sunflower rust (caused by P...

  5. Registration of an oilseed sunflower germplasm HA-DM1 resistant to sunflower downy mildew

    Technology Transfer Automated Retrieval System (TEKTRAN)

    HA-DM1 (Reg. No.xxx, PI 674793) sunflower (Helianthus annuus L.) germplasm was developed and released cooperatively by the USDA-ARS, Sunflower and Plant Biology Research Unit and the North Dakota Agricultural Experiment Station in 2015. HA-DM1 is a BC2F4 derived oilseed maintainer line from the cros...

  6. Registration of two confection sunflower germplasm Lines, HA-R10 and HA-R11, Resistant to sunflower rust

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Two confection sunflower (Helianthus annuus L.) germplasm lines, HA-R10 (Reg. No.xxx, PI670043) and HA-R11 (Reg. No.xxx, PI670044) were developed by the USDA-ARS Sunflower and Plant Biology Research Unit in collaboration with the North Dakota Agricultural Experiment Station and released December, 20...

  7. Interspecific amphiploid-derived alloplasmic male sterility with defective anthers, narrow disk florets, and small ray flowers in sunflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cytoplasmic male-sterility (CMS)/fertility-restoration system is important for hybrid sunflower (Helianthus annuus L.) seed production. Two novel alloplasmic CMSs, designated CMS GRO1 and CMS MAX3 with defective anthers, narrow disk florets with no swollen corolla, and short, narrow ray flowers,...

  8. Sunflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus) is a relatively new crop among the world field crops, grown as an oilseed crop worldwide in temperate and subtropical areas in 72 countries. It is one of only a few crops (cranberries, blueberries, and pecans are others) to have originated from the United States. Sunflo...

  9. Registration of two double rust resistant germplasms, HA-R12 and HA-R13 for confection sunflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The confection sunflower (Helianthus annuus L.) germplasms HA-R12 (Reg. No. ______, PI 673104) and HA-R13 (Reg. No. ______, PI 673105) were developed by the USDA-ARS, Sunflower and Plant Biology Research Unit in collaboration with the North Dakota Agricultural Experiment Station, and released in Jul...

  10. Newly emerged populations of Plasmopara halstedii infecting rudbeckia exhibit unique genotypic profiles and are distinct from sunflower-infecting strains

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The oomycete Plasmopara halstedii emerged at the onset of the 21st century as a destructive new pathogen causing downy mildew disease of ornamental Rudbeckia fulgida (rudbeckia) in the U.S.A. The pathogen is also a significant global problem of sunflower (Helianthus annuus), and is widely regarded a...

  11. SNP discovery and QTL mapping of Sclerotinia basal stalk rot resistance in sunflower using genotyping-by-sequencing (GBS)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Basal stalk rot (BSR) caused by the ascomycete fungus Sclerotinia sclerotiorum (Lib.) de Bary is a serious disease of sunflower (Helianthus annuus L.) in the cool and humid production areas of the world. Quantitative trait loci (QTL) for BSR resistance were identified in a sunflower recombinant inbr...

  12. Re-creating ancient hybrid species' complex phenotypes from early-generation synthetic hybrids: three examples using wild sunflowers.

    PubMed

    Rosenthal, David M; Rieseberg, Loren H; Donovan, Lisa A

    2005-07-01

    Can the complex phenotypes that characterize naturally occurring hybrid species be re-created in early-generation artificial hybrids? We address this question with three homoploid hybrid species (Helianthus anomalus, Helianthus deserticola, Helianthus paradoxus) and their ancestral parents (Helianthus annuus, Helianthus petiolaris) that are phenotypically distinct and ecologically differentiated. These species, and two synthetic hybrid populations of the ancestral parents, were characterized for morphological, physiological, and life-history traits in greenhouse studies. Among the synthetic hybrids, discriminant analysis identified a few individuals with the multitrait phenotype of the natural hybrid species: 0.7%-1.1% were H. anomalus-like, 0.5%-13% were H. deserticola-like, and only 0.4% were H. paradoxus-like. These relative frequencies mirror previous findings that genetic correlations are favorable for generating the hybrid species' phenotypes, and they correspond well with phylogeographic evidence that demonstrates multiple natural origins of H. deserticola and H. anomalus but a single origin for H. paradoxus. Even though synthetic hybrids with hybrid species phenotypes are rare, their phenotypic correlation matrices share most of the same principal components (eigenvectors), setting the stage for predictable recovery of hybrid species' phenotypes from different hybrid populations. Our results demonstrate past hybridization could have generated hybrid species-like multitrait phenotypes suitable for persistence in their respective environments in just three generations after initial hybridization.

  13. Genome scans reveal candidate domestication and improvement genes in cultivated sunflower, as well as post-domestication introgression with wild relatives.

    PubMed

    Baute, Gregory J; Kane, Nolan C; Grassa, Christopher J; Lai, Zhao; Rieseberg, Loren H

    2015-04-01

    The development of modern crops typically involves both selection and hybridization, but to date most studies have focused on the former. In the present study, we explore how both processes, and their interactions, have molded the genome of the cultivated sunflower (Helianthus annuus), a globally important oilseed. To identify genes targeted by selection during the domestication and improvement of sunflower, and to detect post-domestication hybridization with wild species, we analyzed transcriptome sequences of 80 genotypes, including wild, landrace, and modern lines of H. annuus, as well as two cross-compatible wild relatives, Helianthus argophyllus and Helianthus petiolaris. Outlier analyses identified 122 and 15 candidate genes associated with domestication and improvement, respectively. As in several previous studies, genes putatively involved in oil biosynthesis were the most extreme outliers. Additionally, several promising associations were observed with previously mapped quantitative trait loci (QTLs), such as branching. Admixture analyses revealed that all the modern cultivar genomes we examined contained one or more introgressions from wild populations, with every chromosome having evidence of introgression in at least one modern line. Cumulatively, introgressions cover c. 10% of the cultivated sunflower genome. Surprisingly, introgressions do not avoid candidate domestication genes, probably because of the reintroduction of branching.

  14. Revisiting a classic case of introgression: hybridization and gene flow in Californian sunflowers.

    PubMed

    Owens, Gregory L; Baute, Gregory J; Rieseberg, Loren H

    2016-06-01

    During invasion, colonizing species can hybridize with native species, potentially swamping out native genomes. However, theory predicts that introgression will often be biased into the invading species. Thus, empirical estimates of gene flow between native and invasive species are important to quantify the actual threat of hybridization with invasive species. One classic example of introgression occurs in California, where Helianthus bolanderi was thought to be a hybrid between the serpentine endemic Helianthus exilis and the congeneric invader Helianthus annuus. We used genotyping by sequencing to look for signals of introgression and population structure. We find that H. bolanderi and H. exilis form one genetic clade, with weak population structure that is associated with geographic location rather than soil composition and likely represent a single species, not two. Additionally, while our results confirmed early molecular analysis and failed to support the hybrid origin of H. bolanderi, we did find evidence for introgression mainly into the invader H. annuus, as predicted by theory. PMID:26840428

  15. Revisiting a classic case of introgression: hybridization and gene flow in Californian sunflowers.

    PubMed

    Owens, Gregory L; Baute, Gregory J; Rieseberg, Loren H

    2016-06-01

    During invasion, colonizing species can hybridize with native species, potentially swamping out native genomes. However, theory predicts that introgression will often be biased into the invading species. Thus, empirical estimates of gene flow between native and invasive species are important to quantify the actual threat of hybridization with invasive species. One classic example of introgression occurs in California, where Helianthus bolanderi was thought to be a hybrid between the serpentine endemic Helianthus exilis and the congeneric invader Helianthus annuus. We used genotyping by sequencing to look for signals of introgression and population structure. We find that H. bolanderi and H. exilis form one genetic clade, with weak population structure that is associated with geographic location rather than soil composition and likely represent a single species, not two. Additionally, while our results confirmed early molecular analysis and failed to support the hybrid origin of H. bolanderi, we did find evidence for introgression mainly into the invader H. annuus, as predicted by theory.

  16. High-resolution non-contact measurement of the electrical activity of plants in situ using optical recording

    PubMed Central

    Zhao, Dong-Jie; Chen, Yang; Wang, Zi-Yang; Xue, Lin; Mao, Tong-Lin; Liu, Yi-Min; Wang, Zhong-Yi; Huang, Lan

    2015-01-01

    The limitations of conventional extracellular recording and intracellular recording make high-resolution multisite recording of plant bioelectrical activity in situ challenging. By combining a cooled charge-coupled device camera with a voltage-sensitive dye, we recorded the action potentials in the stem of Helianthus annuus and variation potentials at multiple sites simultaneously with high spatial resolution. The method of signal processing using coherence analysis was used to determine the synchronization of the selected signals. Our results provide direct visualization of the phloem, which is the distribution region of the electrical activities in the stem and leaf of H. annuus, and verify that the phloem is the main action potential transmission route in the stems of higher plants. Finally, the method of optical recording offers a unique opportunity to map the dynamic bioelectrical activity and provides an insight into the mechanisms of long-distance electrical signal transmission in higher plants. PMID:26333536

  17. Sesquiterpene Lactone Composition of Wild and Cultivated Sunflowers and Biological Activity against an Insect Pest.

    PubMed

    Prasifka, Jarrad R; Spring, Otmar; Conrad, Jürgen; Cook, Leonard W; Palmquist, Debra E; Foley, Michael E

    2015-04-29

    Sesquiterpene lactones in sunflowers, Helianthus spp., are important to interactions with pathogens, weeds, and insects. Across a broad range of Helianthus annuus, differences in composition of sesquiterpene lactones extracted from disc florets were found between wild and cultivated sunflowers and also between distinct groups of inbreds used to produce sunflower hybrids. Discriminant function analysis showed the presence and relative abundance of argophyllone B, niveusin B, and 15-hydroxy-3-dehydrodesoxyfruticin were usually (75%) effective at classifying wild sunflowers, cultivated inbreds, and hybrids. Argophyllone B reduced the larval mass of the sunflower moth, Homeosoma electellum, by >30%, but only at a dose greater than that found in florets. Low doses of mixed extracts from cultivated florets produced a similar (≈40%) reduction in larval mass, suggesting combinations of sesquiterpene lactones act additively. Although the results support a role for sesquiterpene lactones in herbivore defense of cultivated sunflowers, additional information is needed to use these compounds purposefully in breeding.

  18. Ecological selection maintains cytonuclear incompatibilities in hybridizing sunflowers.

    PubMed

    Sambatti, Julianno B M; Ortiz-Barrientos, Daniel; Baack, Eric J; Rieseberg, Loren H

    2008-10-01

    Despite the recent renaissance in studies of ecological speciation, the connection between ecological selection and the evolution of reproductive isolation remains tenuous. We tested whether habitat adaptation of cytoplasmic genomes contributes to the maintenance of reproductive barriers in hybridizing sunflower species, Helianthus annuus and Helianthus petiolaris. We transplanted genotypes of the parental species, reciprocal F1 hybrids and all eight possible backcross combinations of nuclear and cytoplasmic genomes into the contrasting xeric and mesic habitats of the parental species. Analysis of survivorship across two growing seasons revealed that the parental species' cytoplasms were strongly locally adapted and that cytonuclear interactions (CNIs) significantly affected the fitness and architecture of hybrid plants. A significant fraction of the CNIs have transgenerational effects, perhaps due to divergence in imprinting patterns. Our results suggest a common means by which ecological selection may contribute to speciation and have significant implications for the persistence of hybridizing species.

  19. Sunflower stem weevil and its larval parasitoids in native sunflowers: is parasitoid abundance and diversity greater in the U.S. Southwest?

    PubMed

    Ode, Paul J; Charlet, Laurence D; Seiler, Gerald J

    2011-02-01

    Classical biological control programs often target a pest's region of origin as a likely source for new biological control agents. Here, we use this approach to search for biological control agents of the sunflower stem weevil (Cylindrocopturus adspersus LeConte), an economically important pest of commercial sunflower. We conducted surveys of weevil natural enemy diversity and abundance across a transect running from the northern Great Plains to the southwestern U.S. (the presumed area of endemism of annual sunflower species in the genus Helianthus). Accordingly, natural enemy diversity and abundance were expected to be greater in the southwestern U.S. C. adspersus and their larval parasitoids were collected from stems of four native sunflower species (Helianthus annuus, H. nuttallii, H. pauciflorus, and H. petiolaris) from 147 sites across eight states. Native H. annuus constituted the majority of the sunflower populations. Mean weevil densities were significantly higher in sunflower stalks that were larger in diameter. Mean weevil densities within sites did not differ across the range of longitudes and latitudes sampled. After accounting for the effects of stalk diameter and location, weevil densities did not differ among the four sunflower species nor did they differ as a function of elevation. C. adspersus in H. annuus and H. petiolaris were attacked by seven species of parasitoids. No parasitoids were found attacking C. adspersus in H. nuttallii or H. pauciflorus stalks. C. adspersus were twice as likely to be attacked by a parasitoid when feeding on H. petiolaris than H. annuus. Furthermore, the likelihood that C. adspersus would be parasitized decreased with increasing elevation and increasing stem diameters. All parasitoid species have been previously reported attacking C. adspersus larvae in cultivated sunflower. Species richness was less diverse in these collections than from previous studies of cultivated sunflower. Our findings suggest that the species

  20. Effect of environmental factors on cuticular transpiration resistance.

    PubMed

    Moreshet, S

    1970-12-01

    Measurements of the various diffusive resistances to water vapor transport within the leaves of sunflower plants (Helianthus annuus) growing in a controlled environment chamber, were used to calculate values of cuticular resistance under a range of environmental conditions. Cuticular resistance to water loss was found to be inversely related to the relative humidity of the surrounding air, and it is suggested that such a mechanism would form a useful adaptation to arid conditions, enabling plants to maintain a more favorable internal water balance. PMID:16657551

  1. Glutamatergic elements in an excitability and circumnutation mechanism

    PubMed Central

    Król, Elzbieta; Dziubinska, Halina

    2010-01-01

    In plants, an electrical potential and circumnutation disturbances are a part of a response to environmental and internal stimuli. Precise relations between electrical potential changes and circumnutation mechanisms are unclear. We have found recently that glutamate (Glu) injection into Helianthus annuus stem induced a series of action potentials (APs) and a transient decrease in circumnutation activity. A theoretical explanation for this finding is discussed here taking into considerations data about the ion mechanism of AP and circumnutation as well as about the metabolic and signaling pathways of glutamate and their possible interactions. PMID:20729637

  2. The role of cotyledons in phototropism of de-etiolated seedlings.

    PubMed

    Shuttleworth, J E; Black, M

    1977-01-01

    Simulated "phototropic" curvatures caused by differential masking of the cotyledons of de-etiolated seedlings exposed to white light are unconnected with true phototropism. In Cucumis sativus L. and Helianthus annuus L. such curvatures result from a red-light-induced inhibition coming from the exposed cotyledon. True phototropic bending in these species under long-term exposure to fairly high irradiances (as in nature) is a response to blue light. It occurs even when cotyledons are completely covered. These results show that the cotyledons do not perceive the phototropic stimulus and need not be illuminated for phototropism to occur.

  3. Glutamatergic elements in an excitability and circumnutation mechanism.

    PubMed

    Stolarz, Maria; Król, Elzbieta; Dziubinska, Halina

    2010-09-01

    In plants, an electrical potential and circumnutation disturbances are a part of a response to environmental and internal stimuli. Precise relations between electrical potential changes and circumnutation mechanisms are unclear. We have found recently that glutamate (Glu) injection into Helianthus annuus stem induced a series of action potentials (APs) and a transient decrease in circumnutation activity. A theoretical explanation for this finding is discussed here taking into considerations data about the ion mechanism of AP and circumnutation as well as about the metabolic and signaling pathways of glutamate and their possible interactions.

  4. Mapping of lead, magnesium and copper accumulation in plant tissues by laser-induced breakdown spectroscopy and laser-ablation inductively coupled plasma mass spectrometry

    NASA Astrophysics Data System (ADS)

    Kaiser, J.; Galiová, M.; Novotný, K.; Červenka, R.; Reale, L.; Novotný, J.; Liška, M.; Samek, O.; Kanický, V.; Hrdlička, A.; Stejskal, K.; Adam, V.; Kizek, R.

    2009-01-01

    Laser-Induced Breakdown Spectroscopy (LIBS) and Laser Ablation Inductively Coupled Plasma Mass Spectrometry (LA-ICP-MS) were utilized for mapping the accumulation of Pb, Mg and Cu with a resolution up to 200 μm in a up to cm × cm area of sunflower ( Helianthus annuus L.) leaves. The results obtained by LIBS and LA-ICP-MS are compared with the outcomes from Atomic Absorption Spectrometry (AAS) and Thin-Layer Chromatography (TLC). It is shown that laser-ablation based analytical methods can substitute or supplement these techniques mainly in the cases when a fast multi-elemental mapping of a large sample area is needed.

  5. Sunflower-based Feedstocks in Nonfood Applications: Perspectives from Olefin Metathesis

    PubMed Central

    Marvey, Bassie B.

    2008-01-01

    Sunflower (Helianthus annuus L.) oil remains under-utilised albeit one of the major seed oils produced world-wide. Moreover, the high oleic sunflower varieties make the oil attractive for applications requiring high temperature processes and those targeting the C=C double bond functionality. Herein an overview of the recent developments in olefin metathesis of sunflower-based feedstocks is presented. The improved performance of olefin metathesis catalysts leading to high turnover numbers, high selectivity and catalyst recyclability, opens new opportunities for tailoring sunflower-based feedstocks into products required for possible new niche market applications. Promising results in biofuel, biopolymers, fragrances and fine chemicals applications have been reported. PMID:19325810

  6. Storage temperature affects the quality of cut flowers from the Asteraceae.

    PubMed

    Celikel, Fisun G; Reid, Michael S

    2002-02-01

    The respiration of cut flowers of gerbera (Gerbera jamesonii H. Bolus ex Hook.f. 'Vesuvio') and sunflower (Helianthus annuus L.) increased exponentially with increasing storage temperature. Poststorage vase life and negatively gravitropic bending of the neck of the flowers were both strongly affected by simulated transport at higher temperatures. Vase life and stem bending after dry storage showed highly significant linear relationships (negative and positive, respectively) with the rate of respiration during storage. The data indicate the importance of maintaining temperatures close to the freezing point during commercial handling and transport of these important commercial cut-flower crops for maximum vase life.

  7. Comparison of Water Potentials Measured by In Situ Psychrometry and Pressure Chamber in Morphologically Different Species 1

    PubMed Central

    Turner, Neil C.; Spurway, R. A.; Schulze, E.-D.

    1984-01-01

    Leaf water potentials measured by in situ psychrometry were compared with leaf water potentials measured by the pressure chamber technique at various values of water potential in Helianthus annuus, Helianthus nuttallii, Vigna unguiculata, Nerium oleander, Pistacia vera, and Corylus avellana. In V. unguiculata, the leaf water potentials measured by the in situ psychrometer oscillated at the same periodicity as, and proportional to, the leaf conductance. In all species, potentials measured by in situ psychrometers operating in the psychrometric mode were linearly correlated with potentials measured with the pressure chamber. However, the in situ psychrometers underestimated the leaf water potential in the two Helianthus species at low water potentials and overestimated the water potential in P. vera, N. oleander, and C. avellana. The underestimation in the two Helianthus species at low water potentials resulted from differences in water potential across the leaf. The overestimation in P. vera, N. oleander, and C. avellana was considered to arise from low epidermal conductances in these species even after abrasion of the cuticle. Pressure-volume studies with Lycopersicon esculentum showed that less water was expressed from distal than proximal leaflets when the whole leaf was slowly pressurized. The implication of this for water relations characteristics obtained by pressure-volume techniques is discussed. We conclude that in situ psychrometers are suitable for following dynamic changes in leaf water potential, but should be used with caution on leaves with low epidermal conductances. PMID:16663415

  8. Stomatal aperture, photosythesis and water fluxes in mesophyll cells as affected by the abscission of leaves. Simultaneous measurements of gas exchange, light scattering and chlorphyll fluorescence.

    PubMed

    Heber, U; Neimanis, S; Lange, O L

    1986-04-01

    Carbon dioxide exchange, transpiration, chlorophyll fluorescence and light scattering of leaves of Lycopersicom esculentum, Helianthus annuus and Arbutus unedo were measured simultaneously before and after abscission of leaves. Scattering of a weak green measuring beam was used to monitor water fluxes across the thylakoid membranes of the mesophyll. When leaves were cut under water, stomata initially closed partially and then occasionally exhibited distinct regulatory oscillations. As stomata closed, light scattering decreased indicating water influx into the mesophyll. Stomatal oscillations were accompanied, with small but noticeable phase shifts, by oscillations of water fluxes at the thylakoid level. These fluxes could be distinguished from the water fluxes accompanying light-dependent ion pumping across the thylakoids by the concomitant chlorophyll fluorescence signals. The latter record energy-dependent ion fluxes in addition to redox changes of the electron-transport chain. As stomata closed partially after cutting a leaf under water, photosynthesis decreased. In Arbutus unedo and Helianthus annuus leaves, transient stomatal closure was insufficient to account for transient inhibition of photosynthesis which appeared to be brought about by transfer of an inhibitory solute through the petiole into the mesophyll. This solute also stimulated respiration in the dark. When leaves were cut in air, stomata opened transiently (Iwanoff effect) before wilting enforced closure. Photosynthesis followed the stomatal responses, increasing during opening and decreasing during closure.

  9. Ointment of Brassica oleracea var. capitata Matures the Extracellular Matrix in Skin Wounds of Wistar Rats

    PubMed Central

    Sarandy, Mariáurea Matias; Novaes, Rômulo Dias; da Matta, Sérgio Luiz Pinto; Mezencio, Jose Mario da Silveira; da Silva, Marcelo Barreto; Zanuncio, José Cola; Gonçalves, Reggiani Vilela

    2015-01-01

    Wound healing is a complex process that aims to restore damaged tissue. Phytotherapeutics, such as cabbage, Brassica oleracea var. capitata (Brassicaceae), and sunflower, Helianthus annuus L. (Asteraceae) oil, are used as wound healers. Five circular wounds, each 12 mm in diameter, were made in the dorsolateral region of each rat. The animals were divided into four groups: balsam (B. oleracea); ointment (B. oleracea); sunflower oil (Helianthus annuus); control (saline solution 0.9%). These products were applied daily for 20 days and every four days the tissues of different wounds were removed. The wound contraction area, total collagen, types I and III collagen, glycosaminoglycans, and tissue cellularity were analyzed. In the groups that received ointment and balsam there was reduction in the wound area on days 4, 8, 12, and 20. Throughout the trial period, the balsam and ointment groups showed a higher amount of total collagen, type I collagen, and glycosaminoglycan compared to the others groups. The rats in the groups treated with B. oleracea var. capitata showed a higher number of cells on days 8, 16, and 20. B. oleracea was effective in stimulating the maturation of collagen and increasing the cellularity, as also in improving the mechanical resistance of the newly formed tissue. PMID:26170889

  10. Transposable Element Proliferation and Genome Expansion Are Rare in Contemporary Sunflower Hybrid Populations Despite Widespread Transcriptional Activity of LTR Retrotransposons

    PubMed Central

    Kawakami, Takeshi; Dhakal, Preeti; Katterhenry, Angela N.; Heatherington, Chelsea A.; Ungerer, Mark C.

    2011-01-01

    Hybridization is a natural phenomenon that has been linked in several organismal groups to transposable element derepression and copy number amplification. A noteworthy example involves three diploid annual sunflower species from North America that have arisen via ancient hybridization between the same two parental taxa, Helianthus annuus and H. petiolaris. The genomes of the hybrid species have undergone large-scale increases in genome size attributable to long terminal repeat (LTR) retrotransposon proliferation. The parental species that gave rise to the hybrid taxa are widely distributed, often sympatric, and contemporary hybridization between them is common. Natural H. annuus × H. petiolaris hybrid populations likely served as source populations from which the hybrid species arose and, as such, represent excellent natural experiments for examining the potential role of hybridization in transposable element derepression and proliferation in this group. In the current report, we examine multiple H. annuus × H. petiolaris hybrid populations for evidence of genome expansion, LTR retrotransposon copy number increases, and LTR retrotransposon transcriptional activity. We demonstrate that genome expansion and LTR retrotransposon proliferation are rare in contemporary hybrid populations, despite independent proliferation events that took place in the genomes of the ancient hybrid species. Interestingly, LTR retrotransposon lineages that proliferated in the hybrid species genomes remain transcriptionally active in hybrid and nonhybrid genotypes across the entire sampling area. The finding of transcriptional activity but not copy number increases in hybrid genotypes suggests that proliferation and genome expansion in contemporary hybrid populations may be mitigated by posttranscriptional mechanisms of repression. PMID:21282712

  11. Long Terminal Repeat Retrotransposon Content in Eight Diploid Sunflower Species Inferred from Next-Generation Sequence Data.

    PubMed

    Tetreault, Hannah M; Ungerer, Mark C

    2016-01-01

    The most abundant transposable elements (TEs) in plant genomes are Class I long terminal repeat (LTR) retrotransposons represented by superfamilies gypsy and copia Amplification of these superfamilies directly impacts genome structure and contributes to differential patterns of genome size evolution among plant lineages. Utilizing short-read Illumina data and sequence information from a panel of Helianthus annuus (sunflower) full-length gypsy and copia elements, we explore the contribution of these sequences to genome size variation among eight diploid Helianthus species and an outgroup taxon, Phoebanthus tenuifolius We also explore transcriptional dynamics of these elements in both leaf and bud tissue via RT-PCR. We demonstrate that most LTR retrotransposon sublineages (i.e., families) display patterns of similar genomic abundance across species. A small number of LTR retrotransposon sublineages exhibit lineage-specific amplification, particularly in the genomes of species with larger estimated nuclear DNA content. RT-PCR assays reveal that some LTR retrotransposon sublineages are transcriptionally active across all species and tissue types, whereas others display species-specific and tissue-specific expression. The species with the largest estimated genome size, H. agrestis, has experienced amplification of LTR retrotransposon sublineages, some of which have proliferated independently in other lineages in the Helianthus phylogeny. PMID:27233667

  12. Long Terminal Repeat Retrotransposon Content in Eight Diploid Sunflower Species Inferred from Next-Generation Sequence Data

    PubMed Central

    Tetreault, Hannah M.; Ungerer, Mark C.

    2016-01-01

    The most abundant transposable elements (TEs) in plant genomes are Class I long terminal repeat (LTR) retrotransposons represented by superfamilies gypsy and copia. Amplification of these superfamilies directly impacts genome structure and contributes to differential patterns of genome size evolution among plant lineages. Utilizing short-read Illumina data and sequence information from a panel of Helianthus annuus (sunflower) full-length gypsy and copia elements, we explore the contribution of these sequences to genome size variation among eight diploid Helianthus species and an outgroup taxon, Phoebanthus tenuifolius. We also explore transcriptional dynamics of these elements in both leaf and bud tissue via RT-PCR. We demonstrate that most LTR retrotransposon sublineages (i.e., families) display patterns of similar genomic abundance across species. A small number of LTR retrotransposon sublineages exhibit lineage-specific amplification, particularly in the genomes of species with larger estimated nuclear DNA content. RT-PCR assays reveal that some LTR retrotransposon sublineages are transcriptionally active across all species and tissue types, whereas others display species-specific and tissue-specific expression. The species with the largest estimated genome size, H. agrestis, has experienced amplification of LTR retrotransposon sublineages, some of which have proliferated independently in other lineages in the Helianthus phylogeny. PMID:27233667

  13. Phytoremediation of soil co-contaminated with heavy metals and TNT using four plant species.

    PubMed

    Lee, Insook; Baek, Kyunghwa; Kim, Hyunhee; Kim, Sunghyun; Kim, Jaisoo; Kwon, Youngseok; Chang, Yoontoung; Bae, Bumhan

    2007-11-01

    We investigated the germination, growth rates and uptake of contaminants of four plant species, barnyard grass (Echinochloa crusgalli), sunflower (Helianthus annuus), Indian mallow (Abutilon avicennae) and Indian jointvetch (Aeschynomene indica), grown in soil contaminated with cadmium (Cd), lead (Pb) and 2,4,6-trinitrotoluene (TNT). These contaminants are typically found at shooting ranges. Experiments were carried out over 180 days using both single plant cultures and cultures containing an equal mix of the 4 plant species. Germination rates differed among the species in single culture (92% for H. annuus, 84% for E. crusgalli, 48% for A. avicennae and 38% Ae. indica). In the 4-plant mix culture, < 20% of seeds germinated for all 4 species. E. crusgalli and H. annuus grew slightly faster in the four-plant mix culture than in single culture, whereas A. avicennae and Ae. indica grew much slower in the 4-plant mix culture. In both single and 4-plant mix cultures, Cd concentrations in the roots of A. avicennae and E. crusgalliwere high, and Pb concentrations were high in A. avicennae and H. annuus. Cd and Pb concentrations in shoots were low to negligible in both treatment cultures for all species, except E. crusgalli in the 4-plant mix culture. The concentrations of TNT and its metabolites, 2-amino-4,6-dinitrotoluene (2ADNT) and 4-amino-2,6-dinitrotoluene (4ADNT) were high in H. annuus, Ae. indica and A. avicennae. Total Cd removal from soil differed among species, with E. crusgalliremoving the most (50.1%) followed by H. annuus(41.3%), Ae. indica(41.1%) and A. avicennae(33.3%). The four-plant mix removed more Cd (25.8%) than a no-plant control (12.9%). Pb removal was negligible for all plant species. All plant species rapidly removed TNT and its metabolites, regardless of whether the culture was single or mixed. From in these results, we conclude that a phytoremediation for the removal of heavy metals and TNT from contaminated soils should use a single plant species

  14. Full-length sequence analysis of a distinct isolate of Bidens mottle virus infecting sunflower in Taiwan.

    PubMed

    Liao, J Y; Hu, Chung-Chi; Chen, C C; Chang, C H; Deng, T C

    2009-01-01

    The full-length genome of a potyvirus, previously known as sunflower chlorotic spot virus isolate SF-1 (SCSV-SF-1) which causes novel symptoms on sunflowers (Helianthus annuus), was sequenced and analyzed. The genome of SCSV-SF-1 is 9,741 nucleotides long, encoding a polyprotein of 3,071 amino acids containing the consensus motifs of potyviruses. Sequence comparison revealed that the 3'-terminus of SCSV-SF-1 shared over 96% similarities with isolates of Bidens mottle virus (BiMoV). However, SCSV-SF-1 has a very narrow host range, excluding the diagnostic host species for BiMoV, Bidens pilosa and Zinnia elegans. Therefore, SCSV-SF-1 is a distinct isolate of BiMoV. This is the first report of the full-length nucleotide sequence of BiMoV infecting sunflower in Taiwan.

  15. Characterization of the enzyme responsible for nopaline and ornaline synthesis in sunflower crown gall tissues.

    PubMed

    Sutton, D W; Kemp, J D; Hack, E

    1978-09-01

    Extracts prepared from sunflower (Helianthus annuus L.) crown gall tissues induced by Agrobacterium tumefaciens strains C58 and T37 (nopaline utilizers) catalyze the synthesis of nopaline and ornaline. These compounds are not synthesized in extracts of crown gall tissues induced by strains B6, 15955 (octopine utilizers), and AT1 (utilizes neither octopine nor nopaline) or in extracts of habituated sunflower callus. Both synthetic activities require NADPH, alpha-ketoglutarate, and either arginine or ornithine; histidine and lysine will not substitute. Incorporation of arginine or ornithine into product is inhibited by the other substrate but not by histidine or lysine. On the basis of inhibition and K(m) data, both activities appear to be catalyzed by one enzyme and the same enzyme is apparently present in crown gall tissues induced by strains C58 and T37.

  16. Na+ accumulation in root symplast of sunflower plants exposed to moderate salinity is transpiration-dependent.

    PubMed

    Quintero, José Manuel; Fournier, José María; Benlloch, Manuel; Rodríguez-Navarro, Alonso

    2008-08-25

    Twenty-day-old sunflower plants (Helianthus annuus L. cv Sun-Gro 380) grown hydroponically under controlled conditions were used to study the effect of transpiration on Na(+) compartmentalization in roots. The plants were exposed to low Na(+) concentrations (25 mM NaCl) and different environmental humidity conditions over a short time period (8.5 h). Under these conditions, Na(+) was accumulated primarily in the root, but only the Na(+) accumulated in the root symplast was dependent on transpiration, while the Na(+) accumulated in both the shoot and the root apoplast exhibited a low transpiration dependence. Moreover, Na(+) content in the root apoplast was reached quickly (0.25 h) and increased little with time. These results suggest that, in sunflower plants under moderate salinity conditions, Na(+) uptake in the root symplast is mediated by a transport system whose activity is enhanced by transpiration. PMID:18166246

  17. Antioxidant and antimicrobial properties of monofloral bee pollen.

    PubMed

    Fatrcová-Šramková, Katarína; Nôžková, Janka; Kačániová, Miroslava; Máriássyová, Magda; Rovná, Katarína; Stričík, Michal

    2013-01-01

    The main aim of this study was to determine antioxidant properties and antibacterial activity of monofloral bee pollen samples to pathogenic bacteria. These samples were collected in different localities in Slovakia. The antioxidant properties of examined plant species were different and decreasing in the following order: Brassica napus subsp. napus L > Papaver somniferum L. > Helianthus annuus L. The antimicrobial effect of the bee product samples were tested by using the agar well diffusion method. The methanol (99.9% and 70%) and the ethanol (96% and 70%) were used for extraction. In this study, five different strains of bacteria were tested: Listeria monocytogenes CCM 4699; Pseudomonas aeruginosa CCM 1960; Staphylococcus aureus CCM 3953; Salmonella enterica CCM 4420; and Escherichia coli CCM 3988. The most sensitive bacteria of the poppy pollen ethanolic extract was Staphylococcus aureus was (70%) The most sensitive bacteria of rape bee pollen methanolic extract (70%) and sunflower ethanolic extract (70%) was Salmonella enterica. PMID:23305281

  18. Optical parameters of leaves of seven weed species

    NASA Technical Reports Server (NTRS)

    Gausman, H. W.; Menges, R. M.; Richardson, A. J.; Walter, H.; Rodriguez, R. R.; Tamez, S. (Principal Investigator)

    1982-01-01

    Absorption coefficient (k), infinite reflectance (R inf.) and scattering coefficient (s) were tabulated for five wavelengths and analyzed for statistical differences for seven weed species. The wavelengths were: 0.55, 0.65, 0.85, 1.65, and 2.20 microns. The R inf. of common lambsquarters (Chenopodium album L.), johnsongrass (Sorghum halepense L. Pers.), and annual sowthistle (Sonchus oleraceus L.) leaves at the 0.85 micron wavelength were significantly (p = 0.05) higher than for sunflower (Helianthus annuus L.), ragweed parthenium (parthenium hysterophorus L.), or London rocket (Sisymbrium irio L.). Annual sowthistle had the largest k value, and Palmer amaranth (Amaranthus palmeri S. Wats.) had the smallest k value at the 0.65 micron chlorophyll absorption wavelength. In general, johnsongrass, ragweed parthenium, and London rocket had the largest s values among the five wavelengths, whereas annual sowthistle and Palmer amaranth were usually lowest.

  19. Immunomodulatory activity of plant residues on ovine neutrophils.

    PubMed

    Farinacci, Maura; Colitti, Monica; Sgorlon, Sandy; Stefanon, Bruno

    2008-11-15

    Neutrophils play an essential role in host defense and inflammation. Plants have long been used to improve the immune function, but for most of them specific investigations on animal health are lacking. In the present study, water and hydroethanolic extracts from 11 plant wastes have been screened on immune responses of ovine neutrophils. Eight sheep clinically healthy, not lactating, non-pregnant were selected and used for the experiment. Freshly isolated neutrophils were incubated with the extracts of the residues at increasing doses, and then they were tested for adhesion and superoxide production induced with PMA. The residues of Larix decidua, Thymus vulgaris, Salix alba, Sinupret, Helianthus annuus, Mangifera indica modulated the neutrophil immune functions, moreover, Larix decidua, Thymus vulgaris and Salix alba presented the highest anti-inflammatory activity.

  20. Sequence of Key Events in Shoot Gravitropism 1

    PubMed Central

    Migliaccio, Fernando; Rayle, David L.

    1984-01-01

    It has recently been shown that asymmetric acid efflux is closely correlated with the gravitropic curvature of plant shoots and roots. The research reported here addresses whether auxin (IAA) redistribution in shoots is the cause or result of asymmetric acid efflux. When abraded sunflower (Helianthus annuus cv Mammoth) hypocotyls are submerged in 20 millimolar neutral buffer, gravicurvature is greatly retarded relative to 0.2 millimolar controls. Nevertheless, in both buffer systems there is a similar redistribution of [3H]IAA toward the lower surface of gravistimulated sunflower hypocotyls. These results suggest that graviperception initiates IAA redistribution, which in turn results in auxin-induced asymmetric H+ efflux across the shoot. This interpretation is reinforced by data showing the effects of removal of the epidermal layers (peeling), osmotic shock, and morphactin treatment on gravicurvature and [3H]IAA redistribution. Peeling and osmotic shock inhibit gravicurvature but not redistribution. Morphactin inhibits both processes but does not inhibit hypocotyl straight growth. PMID:16663606

  1. Circumnutation Tracker: novel software for investigation of circumnutation

    PubMed Central

    2014-01-01

    Background An endogenous, helical plant organ movement named circumnutation is ubiquitous in the plant kingdom. Plant shoots, stems, tendrils, leaves, and roots commonly circumnutate but their appearance is still poorly described. To support such investigations, novel software Circumnutation Tracker (CT) for spatial-temporal analysis of circumnutation has been developed. Results CT works on time-lapse video and collected circumnutation parameters: period, length, rate, shape, angle, and clockwise- and counterclockwise directions. The CT combines a filtering algorithm with a graph-based method to describe the parameters of circumnutation. The parameters of circumnutation of Helianthus annuus hypocotyls and the relationship between cotyledon arrangement and circumnutation geometry are presented here to demonstrate the CT options. Conclusions We have established that CT facilitates and accelerates analysis of circumnutation. In combination with the physiological, molecular, and genetic methods, this software may be a powerful tool also for investigations of gravitropism, biological clock, and membrane transport, i.e. processes involved in the mechanism of circumnutation.

  2. Correlations between proton-efflux patterns and growth patterns during geotropism and phototropism in maize and sunflower.

    PubMed

    Mulkey, T J; Kuzmanoff, K M; Evans, M L

    1981-07-01

    By placing seedlings of sunflower (Helianthus annuus L.) or maize (Zea mays L.) on agar plates containing a pH indicator dye it is possible to observe surface pH patterns along the growing seedling by observing color changes of the indicator dye. Using this method we find that in geotropically stimulated sunflower hypocotyls or maize coleoptiles there is enhanced proton efflux on the lower surface of the organ prior to the initiation of curvature. As curvature develops the pattern of differential acid efflux becomes more intense. A similar phenomenon is observed when these organs are exposed to unilateral illumination, i.e. enhanced acid efflux occurs on the dark side of the organ prior to the initiation of phototropic curvature and the pattern of differential acid efflux intensifies as phototropic curvature develops. These observations indicate that differential acid efflux occurs in response to tropistic stimuli and that the acid efflux pattern may mediate the development of tropistic curvatures.

  3. Copper and cobalt mobility in soil and accumulation in a metallophyte as influenced by experimental manipulation of soil chemical factors.

    PubMed

    Lange, Bastien; Pourret, Olivier; Meerts, Pierre; Jitaru, Petru; Cancès, Benjamin; Grison, Claude; Faucon, Michel-Pierre

    2016-03-01

    The influence of Fe oxides, Mn oxides and organic matter (OM) on the Cu and Co mobility in soil and accumulation in the metallophyte Anisopappus chinensis (Ac), as compared with Helianthus annuus (Ha), was experimentally investigated. Growth and accumulation response when increasing the exchangeable Cu and Co concentrations in soil were also investigated. Plants were cultivated on soil where concentrations of Cu, Co, Fe oxides, Mn oxides and OM content were varied according to 36 treatments. The OM supply decreased the Cu mobility and increased the Co mobility, resulting in decreasing the foliar Cu of Ac and increasing the foliar Co of Ha. The Fe oxides supply could increase the Cu accumulation for Ac, but was not verified for Ha. Compared with Ha, Ac increasingly accumulated Cu and Co without negative effect on plant growth while increasing Cu and Co mobility to phytotoxic concentrations. The results revealed promising perspectives for the use of Ac in Cu-contaminated environment phytoremediation applications. PMID:26706934

  4. Investigation of heavy-metal accumulation in selected plant samples using laser induced breakdown spectroscopy and laser ablation inductively coupled plasma mass spectrometry

    NASA Astrophysics Data System (ADS)

    Galiová, M.; Kaiser, J.; Novotný, K.; Novotný, J.; Vaculovič, T.; Liška, M.; Malina, R.; Stejskal, K.; Adam, V.; Kizek, R.

    2008-12-01

    Single-pulse Laser-Induced Breakdown Spectroscopy (LIBS) and Laser-Ablation Inductively Coupled Plasma Mass-Spectrometry (LA-ICP-MS) were applied for mapping the silver and copper distribution in Helianthus Annuus L. samples treated with contaminant in controlled conditions. For Ag and Cu detection the 328.07 nm Ag(I) and 324.75 nm Cu(I) lines were used, respectively. The LIBS experimental conditions (mainly the laser energy and the observation window) were optimized in order to avoid self-absorption effect in the measured spectra. In the LA-ICP-MS analysis the Ag 107 and Cu 63 isotopes were detected. The capability of these two analytical techniques for high-resolution mapping of selected trace chemical elements was demonstrated.

  5. Wall extensibility and gravitropic curvature of sunflower hypocotyls: correlation between timing of curvature and changes in extensibility

    NASA Technical Reports Server (NTRS)

    Bagshaw, S. L.; Cleland, R. E.

    1990-01-01

    Gravitropic curvature results from unequal growth rates on the upper and lower sides of horizontal stems. These unequal growth rates could be due to differences in wall extensibility between the two sides. To test this, the time course of curvature of horizontal sunflower (Helianthus annuus L.) hypocotyls was determined and compared with the time courses of changes in Instron-measured wall extensibility (PEx) of the upper and lower epidermal layers. As gravicurvature developed, so did the difference in PEx between the upper and lower epidermis. The enhanced growth rate on the lower side during the period of maximum increase in curvature was matched by PEx values greater than those of the vertical control, while the inhibited growth rate on the upper side was accompanied by PEx values below that of the control. The close correlation between changes in growth rates and alterations in PEx demonstrates that changes in wall extensibility play a major role in controlling gravicurvature.

  6. Isolation of three diterpenoid acids from sunflowers, as oviposition stimulants for the banded sunflower moth, Cochylis hospes.

    PubMed

    Morris, Bruce D; Charlet, Laurence D; Foster, Stephen P

    2009-01-01

    The banded sunflower moth (BSFM), Cochylis hospes Walshingham (Lepidoptera: Cochylidae) is a specialist insect, the larvae of which feed on sunflowers, Helianthus spp., and a few other species of Compositae. It is one of the most important pests of sunflower in the USA. Previous work on H. annuus, the cultivated sunflower, revealed two diterpenoids that function as oviposition stimulants for female BSFM, and that other, more polar compounds also stimulated oviposition. Using a bioassay-guided approach, we isolated three additional diterpenoids, grandifloric acid (1), 15beta-hydroxy-ent-trachyloban-19-oic acid (2), and 17-hydroxy-16alpha-ent-kauran-19-oic acid (3), from polar fractions of pre-bloom sunflower head extracts. In laboratory bioassays, purified natural samples of each of these compounds stimulated oviposition by female BSFM. Structure-activity relationships of the five diterpenoids known to stimulate oviposition by female BSFM are discussed.

  7. Effects of sulfur, zinc, iron, copper, manganese, and boron applications on sunflower yield and plant nutrient concentration

    SciTech Connect

    Hilton, B.R.; Zubriski, J.C.

    1985-01-01

    Sulfur, zinc, iron, copper, manganese, and boron application did not affect the seed yield or oil percentage of sunflower (Helianthus annuus L.) on both dryland and irrigated soils in North Dakota in 1981. Field averages indicated significant Zn, Mn, and B uptake by sunflower at the 12-leaf stage as a result of fertilization with these elements. Increased Zn uptake was also observed in the uppermost mature leaf at anthesis from zinc fertilization. Although sunflower yield from boron fertilization was not significantly different from the check, a trend was observed in which boron fertilization seemed to decrease sunflower yield. Sunflower yields from the boron treatment were the lowest out of seven treatments in three out of four fields. Also, sunflower yield from the boron treatment was significantly lower than both iron and sulfur treatments when all fields were combined.

  8. Tracking photosynthetic efficiency with narrow-band spectroradiometry

    NASA Technical Reports Server (NTRS)

    Gamon, John A.; Field, Christopher B.

    1992-01-01

    Narrow-waveband spectroradiometry presents the possibility of detecting subtle signals closely related to the current physiological state of vegetation. One such signal related to the epoxidation state of the xanthophyll cycle pigments, violaxanthin, antheraxanthin, and zeaxanthin is discussed. Recent advances in plant ecophysiology demonstrated a close relationship between these pigments and the regulatory state of photosystem 2 in photosynthesis. Our recent field studies of sunflower (Helianthus annuus) and oak (Quercus agrifolia) demonstrated that a 'xanthophyll signal' can be isolated from the diurnal reflectance spectra of intact canopies. Furthermore, the xanthophyll signal can be used to derive a 'physiological reflectance index' (PRI) that closely correlates with the actual photosynthetic efficiency (defined as the photosynthetic rate divided by the incident PAR) in closed canopies. If these signals were detectable in Airborne Visible/Infrared Imaging Spectrometers (AVIRIS) images, they could lead to improved remote estimates of photosynthetic fluxes.

  9. Nutations of sunflower seedlings on tilted clinostats

    NASA Technical Reports Server (NTRS)

    Brown, A. H.; Chapman, D. K.

    1977-01-01

    The kinetics of hypocotyl nutations in Helianthus annuus L. were measured on plants which were rotated on clinostats with axes of rotation inclined at various angles, alpha, away from the vertical. The g-force component acting in the direction of the plant axis was taken as g cos alpha. The average period and average amplitude of nutation were constant for all such axially directed g-forces between 1.0 and 0.2 g (vertical to about 80 inclination). On the horizontal clinostat (90 inclination) nutation was neither initiated nor sustained. The g-force just sufficient fully to activate nutational oscillations should be sought for g-force parameter values ranging from 0 to 0.2.

  10. Short-period circumnutations found in sunflower hypocotyls in satellite orbit. A reappraisal of data from Spacelab-1

    NASA Technical Reports Server (NTRS)

    Bardal, Tom Kr; Johnsson, Anders; Chapman, David K.; Sager, J. C. (Principal Investigator)

    2003-01-01

    We have further analysed data from an experiment performed in satellite orbit, in Spacelab-1. In micro-gravity the hypocotyls of Helianthus annuus, cv. "Teddy Bear", showed short period circumnutations (periods around 30 minutes) as well as the already reported long period nutations (with an average period of about 115 minutes). We applied various types of signal analysis (Fourier and wavelet analysis) to the data series. The long period circumnutations have a larger amplitude than the short term circumnutations. Both short and long period circumnutations exist in one and the same hypocotyl. (This is in contrast to our ground control experiments, where were found only the long-period nutations.) The period of the nutations changed throughout the experiment. These results are extending the conclusions drawn after the Spacelab experiment (Brown et al. 1990). In particular they emphasize the existence of both short- and long-period circumnutations in micro-gravity.

  11. Eastern North America as an independent center of plant domestication.

    PubMed

    Smith, Bruce D

    2006-08-15

    The status of eastern North America as an independent center of plant domestication has recently been called into question by a number of genetic and archaeological studies, which suggest that the region may not have witnessed the independent domestication of local crop plants, but rather may have been on the receiving end of domesticated crop plants introduced from Mexico. Here, I provide a synthesis of the currently available archaeological and genetic evidence from both eastern North America and Mexico regarding the spatial and temporal context of initial domestication of the four plant species identified as potential eastern North American domesticates: marshelder (Iva annua), chenopod (Chenopodium berlandieri), squash (Cucurbita pepo), and sunflower (Helianthus annuus). Genetic and archaeological evidence provides strong support for the independent domestication of all four of these plant species in the eastern United States and reconfirms the region as one of the world's independent centers of domestication.

  12. Evaluation of terrestrial plants extracts for uranium sorption and characterization of potent phytoconstituents.

    PubMed

    Sharma, Sunita; Singh, Bikram; Thulasidas, S K; Kulkarni, Madhuri J; Natarajan, V; Manchanda, Vijay K

    2016-01-01

    Sorption capacity of four plants (Funaria hygrometrica, Musa acuminata, Brassica juncea and Helianthus annuus) extracts/fractions for uranium, a radionuclide was investigated by EDXRF and tracer studies. The maximum sorption capacity, i.e., 100% (complete sorption) was observed in case of Musa acuminata extract and fractions. Carbohydrate, proteins, phenolics and flavonoids contents in the active fraction (having maximum sorption capacity) were also determined. Further purification of the most active fraction provided three pure molecules, mannitol, sorbitol and oxo-linked potassium oxalate. The characterization of isolated molecules was achieved by using FTIR, NMR, GC-MS, MS-MS, and by single crystal-XRD analysis. Of three molecules, oxo-linked potassium oxalate was observed to have 100% sorption activity. Possible binding mechanism of active molecule with the uranyl cation has been purposed.

  13. Effect of crop residue harvest on long-term crop yield, soil erosion, and carbon balance: tradeoffs for a sustainable bioenergy feedstock

    SciTech Connect

    Gregg, Jay S.; Izaurralde, Roberto C.

    2010-08-26

    Agricultural residues are a potential feedstock for bioenergy production, if residue harvest can be done sustainably. The relationship between crop residue harvest, soil erosion, crop yield and carbon balance was modeled with the Erosion Productivity Impact Calculator/ Environment Policy Integrated Climate (EPIC) using a factorial design. Four crop rotations (winter wheat [Triticum aestivum (L.)] – sunflower [Helianthus annuus]; spring wheat [Triticum aestivum (L.)] – canola [Brassica napus]; corn [Zea mays L.] – soybean [Glycine max (L.) Merr.]; and cotton [Gossypium hirsutum] – peanut [Arachis hypogaea]) were simulated at four US locations each, under different topographies (0-10% slope), and management practices [crop residue removal rates (0-75%), conservation practices (no till, contour cropping, strip cropping, terracing)].

  14. Uptake of VOC by sunflower

    NASA Astrophysics Data System (ADS)

    Folkers, A.; Miebach, M.; Kleist, E.; Wildt, J.

    2003-04-01

    To study potential VOC uptake by plants we exposed sunflower (Helianthus annuus) to different VOC in continuously stirred tank reactors. For many VOC like methanol, ethanol, acetone, methylvinylketone, isoprene or limonene no uptake was detectable within the accuracy of our analytic set up. Other VOC like hexanal, octanal, (E)-3-hexenol and nopinone were taken up by sunflower. The uptake was related to stomatal aperture. Obviously, these VOC enter the plants through stomata. In case of hexanal, octanal, and (E)-3-hexenol the uptake was only limited by stomatal aperture implying that these VOC are rapidly metabolised. For nopinone the uptake seems to be limited by a slow metabolization. Estimations of deposition velocities showed that dry deposition of these compounds cannot be neglected as sink if diffusion through stomata is the limiting step for dry deposition. In such cases the lifetime with respect to dry deposiotion is comparable to the lifetime with respect to oxidation by hydroxyl radicals.

  15. Tyrosine nitration provokes inhibition of sunflower carbonic anhydrase (β-CA) activity under high temperature stress.

    PubMed

    Chaki, Mounira; Carreras, Alfonso; López-Jaramillo, Javier; Begara-Morales, Juan C; Sánchez-Calvo, Beatriz; Valderrama, Raquel; Corpas, Francisco J; Barroso, Juan B

    2013-02-28

    Protein tyrosine nitration is a post-translational modification (PTM) mediated by reactive nitrogen species (RNS) and it is a new area of research in higher plants. Previously, it was demonstrated that the exposition of sunflower (Helianthus annuus L.) seedlings to high temperature (HT) caused both oxidative and nitrosative stress. The nitroproteome analysis under this stress condition showed the induction of 13 tyrosine-nitrated proteins being the carbonic anhydrase (CA) one of these proteins. The analysis of CA activity under high temperature showed that this stress inhibited the CA activity by a 43%. To evaluate the effect of nitration on the CA activity in sunflower it was used 3-morpholinosydnonimine (SIN-1) (peroxynitrite donor) as the nitrating agent. Thus the CA activity was inhibited by 41%. In silico analysis of the pea CA protein sequence suggests that Tyr(205) is the most likely potential target for nitration.

  16. Comparative Cytogenetic Study on the Toxicity of Magnetite and Zinc Ferrite Nanoparticles in Sunflower Root Cells

    NASA Astrophysics Data System (ADS)

    Foca-nici, Ecaterina; Capraru, Gabriela; Creanga, Dorina

    2010-12-01

    In this experimental study the authors present their results regarding the cellular division rate and the percentage of chromosomal aberrations in the root meristematic cells of Helianthus annuus cultivated in the presence of different volume fractions of magnetic nanoparticle suspensions, ranging between 20 and 100 microl/l. The aqueous magnetic colloids were prepared from chemically co-precipitated ferrites coated in sodium oleate. Tissue samples from the root meristeme of 2-3 day old germinated seeds were taken to prepare microscope slides following Squash method combined with Fuelgen techniques. Microscope investigation (cytogenetic tests) has resulted in the evaluation of mitotic index and chromosomal aberration index that appeared diminished and respectively increased following the addition of magnetic nanoparticles in the culture medium of the young seedlings. Zinc ferrite toxic influence appeared to be higher than that of magnetite, according to both cytogenetic parameters.

  17. Plant development in the absence of epiphytic microorganisms

    NASA Astrophysics Data System (ADS)

    Kutschera, U.; Koopmann, V.; Grotha, R.

    2002-05-01

    Microorganisms (bacteria, fungi) are common residents of the roots, stems and leaves of higher plants. In order to explore the dependency of plant development on the presence of epiphytic microorganisms, the achenes (seeds) of sunflower (Helianthus annuus L.) were sterilized and germinated under aseptic conditions. The sterility of the seedlings was determined with the agar impression method. In seedlings from non-sterile seeds (control) that were likewise raised in a germ-free environment, all plant organs investigated (stem, cotyledons and primary leaves) were contaminated with bacteria. Hypocotyl elongation was not affected by epiphytic microorganisms. However, the growth rates of the cotyledons and primary leaves were higher in sterile seedlings compared with the control. The implications of this differential inhibition of organ development by epiphytic bacteria that are transmitted via the outer surface of the seed coat are discussed. We conclude that epiphytes in the above-ground phytosphere are not necessary for the development of the sunflower seedling.

  18. Diurnal variations in leaf fluorescence induction kinetics: variable fluorescence in crassulacean Acid metabolism plants.

    PubMed

    Everson, G; Chen, S S; Black, C C

    1983-06-01

    The variable fluorescence of leaves from Kalanchoë daigremontiana and pineapple, Ananas comosus, both CAM plants, was found to change over a 24-hour cycle and to exhibit high temperature-dependent maxima during the night period. The time course of the induced fluorescence was correlated with malic acid accumulation but not with other aspects of CAM such as with the nature of the decarboxylation pathway or with stomatal movements. The variable fluorescences of sunflower (Helianthus annuus L.) and corn (Zea mays L.) leaves were compared with the CAM plants diurnally; both plants also exhibit high fluorescence maxima during the night period. We conclude that the assembly of the photosystems in the light is a primary process in photosynthesis induction and may be influenced by other cellular metabolic processes, specifically in the case of CAM leaves by malic acid accumulation. PMID:16663024

  19. Characterization of metal-resistant plant-growth promoting Bacillus weihenstephanensis isolated from serpentine soil in Portugal.

    PubMed

    Rajkumar, Mani; Ma, Ying; Freitas, Helena

    2008-12-01

    A metal-resistant bacterial strain SM3 isolated from a serpentine soil in the north-east of Portugal was characterized as Bacillus weihenstephanensis based on the morphological and biochemical characteristics and on the comparative analysis of the partial 16S ribosomal DNA sequence. Bacillus weihenstephanensis SM3 showed a high degree of resistance to nickel (1500 mg l(-1)), copper (500 mg l(-1)) and zinc (700 mg l(-1)) and also to antibiotics (ampicillin, penicillin, kanamycin and streptomycin). Strain SM3 has also exhibited the capability of solubilizing phosphate and producing indole-3-acetic acid (IAA) both in the absence and in the presence of metals (Ni, Cu and Zn). A pot experiment was conducted to elucidate the effects of strain SM3 on plant growth and uptake of Ni, Cu or Zn by Helianthus annuus. Inoculation with strain SM3 increased the shoot and root biomass of H. annuus grown in both non-contaminated and contaminated soil. Furthermore, strain SM3 increased the accumulation of Cu and Zn in the root and shoot systems. A batch experiment was also conducted to assess the metal mobilization potential of strain SM3 in soil. Inoculation with this strain increased the concentrations of water soluble Ni, Cu and Zn in soil. Metal solubilization by this bacterial strain may be an important process to promote the uptake of heavy metals by plants. This study elucidates the multifarious role of strain SM3 in plant growth promotion and its metal mobilizing potential. PMID:18785659

  20. Using a plant hormone and a thioligand to improve phytoremediation of Hg-contaminated soil from a petrochemical plant.

    PubMed

    Cassina, L; Tassi, E; Pedron, F; Petruzzelli, G; Ambrosini, P; Barbafieri, M

    2012-09-15

    Mercury-contaminated soils from a petrochemical plant in southern Italy were investigated to assess the phytoextraction efficiency of crop plants treated with the phytohormone, cytokinine (CK foliar treatment), and with the thioligand, ammonium thiosulfate (TS, soil application). Plant biomass, evapotranspiration, Hg uptake and distribution in plant tissues following treatment were compared. Results indicate the effectiveness of CK in increasing plant biomass and the evapotranspiration rate while TS treatment promoted soil Hg solubility and availability. The simultaneous addition of CK and TS treatments increased Hg uptake and translocation in both tested plants with up to 248 and 232% in Brassica juncea (Indian mustard) and Helianthus annuus (sunflower) respectively. B. juncea was more effective in Hg uptake, whereas H. annuus gave better response regarding plant biomass production. The effectiveness of the treatments was confirmed by the calculation of Hg phytoextraction and evaluation of labile-Hg residue in the soil after plant growth. In one growing cycle the plants subject to simultaneous CK and TS treatment significantly reduced labile-Hg pools that were characterized by the soil sequential extraction, but did not significantly affect the pseudototal metal content in the soil. Results support the use of plant growth regulators in the assisted phytoextraction process for Hg-contaminated soils.

  1. Effect of a mutagenized acyl-ACP thioesterase FATA allele from sunflower with improved activity in tobacco leaves and Arabidopsis seeds.

    PubMed

    Moreno-Pérez, Antonio Javier; Venegas-Calerón, Mónica; Vaistij, Fabián E; Salas, Joaquin J; Larson, Tony R; Garcés, Rafael; Graham, Ian A; Martínez-Force, Enrique

    2014-03-01

    The substrate specificity of the acyl-acyl carrier protein (ACP) thioesterases significantly determines the type of fatty acids that are exported from plastids. Thus, designing acyl-ACP thioesterases with different substrate specificities or kinetic properties would be of interest for plant lipid biotechnology to produce oils enriched in specialty fatty acids. In the present work, the FatA thioesterase from Helianthus annuus was used to test the impact of changes in the amino acids present in the binding pocket on substrate specificity and catalytic efficiency. Amongst all the mutated enzymes studied, Q215W was especially interesting as it had higher specificity towards saturated acyl-ACP substrates and higher catalytic efficiency compared to wild-type H. annuus FatA. Null, wild type and high-efficiency alleles were transiently expressed in tobacco leaves to check their effect on lipid biosynthesis. Expression of active FatA thioesterases altered the composition of leaf triacylglycerols but did not alter total lipid content. However, the expression of the wild type and the high-efficiency alleles in Arabidopsis thaliana transgenic seeds resulted in a strong reduction in oil content and an increase in total saturated fatty acid content. The role and influence of acyl-ACP thioesterases in plant metabolism and their possible applications in lipid biotechnology are discussed.

  2. Transpiration and CO/sub 2/ fixation of selected desert shrubs as related to soil-water potential

    SciTech Connect

    Clark, S.B.; Letey, J. Jr.; Lunt, O.R.; Wallace, A.; Kleinkopf, G.E.; Romney, E.M.

    1980-01-01

    In desert plants, transpiration rates decreased before photosynthetic rates when plants were entering a period of water stress. This may have adaptive consequences. A difference of -5 bars in the soil-moisture potential had considerable importance in reducing the rate of transpiration. In Helianthus annuus L. (sunflower) the photosynthetic rate decreased before the transpiration rate in contrast to Great Basin-Mojave Desert plants, and the changes occurred with a -1 bar difference in soil-moisture potential. Morphological changes in three desert plant species (Artemisia tridentata Nutt., Ambrosia dumosa (Gray) Payne, Larrea tridentata (Ses. Moc. ex DC) Cov.) as the soil-moisture potential decreased are given. With a mesic species, H. annuus, 20% reduction in photosynthesis and transpiration was reached at higher soil-moisture potentials than with the desert plants. Loss of net photosynthesis occurred in A. dumosa (a summer deciduous shrub) as PSI soil reached -48 bars in the field, whereas L. tridentata (an evergreen shrub) at the same time was able to maintain a water potential difference between soil and plant of -10 to -15 bars and continue net CO/sub 2/ gain well into the summer months.

  3. Characterization of metal-resistant plant-growth promoting Bacillus weihenstephanensis isolated from serpentine soil in Portugal.

    PubMed

    Rajkumar, Mani; Ma, Ying; Freitas, Helena

    2008-12-01

    A metal-resistant bacterial strain SM3 isolated from a serpentine soil in the north-east of Portugal was characterized as Bacillus weihenstephanensis based on the morphological and biochemical characteristics and on the comparative analysis of the partial 16S ribosomal DNA sequence. Bacillus weihenstephanensis SM3 showed a high degree of resistance to nickel (1500 mg l(-1)), copper (500 mg l(-1)) and zinc (700 mg l(-1)) and also to antibiotics (ampicillin, penicillin, kanamycin and streptomycin). Strain SM3 has also exhibited the capability of solubilizing phosphate and producing indole-3-acetic acid (IAA) both in the absence and in the presence of metals (Ni, Cu and Zn). A pot experiment was conducted to elucidate the effects of strain SM3 on plant growth and uptake of Ni, Cu or Zn by Helianthus annuus. Inoculation with strain SM3 increased the shoot and root biomass of H. annuus grown in both non-contaminated and contaminated soil. Furthermore, strain SM3 increased the accumulation of Cu and Zn in the root and shoot systems. A batch experiment was also conducted to assess the metal mobilization potential of strain SM3 in soil. Inoculation with this strain increased the concentrations of water soluble Ni, Cu and Zn in soil. Metal solubilization by this bacterial strain may be an important process to promote the uptake of heavy metals by plants. This study elucidates the multifarious role of strain SM3 in plant growth promotion and its metal mobilizing potential.

  4. Seed germination-influencing bioactive secondary metabolites secreted by the endophyte Cladosporium cladosporioides LWL5.

    PubMed

    Waqas, Muhammad; Khan, Abdul Latif; Ali, Liaqat; Kang, Sang-Mo; Kim, Yoon-Ha; Lee, In-Jung

    2013-12-13

    The present study was aimed to isolate bioactive metabolites produced by a fungal endophyte from Helianthus annuus, Capsicum annuum, and Cucumis sativus and to assess their role in seed germination. Culture filtrate of the endophyte HA-3B from H. annuus was significantly inhibitory towards the germination and growth of lettuce seeds. HA-3B was identified as Cladosporium cladosporioides LWL5 through molecular techniques. Different concentrations (100, 500 and 1000 ppm) of the ethyl acetate extract obtained from the culture inhibited the lettuce seed germination. The extract was subjected to column chromatography and a bioassay-guided isolation method, which yielded compounds 1, 2 and an oily fraction. The oily fraction, subjected to fractionation and spectroscopic techniques, resulted in the identification of 31 different constituents. Compounds 1 and 2 were identified and characterized through MS and NMR spectroscopic techniques as benzoic acid. The bioassay results showed that this compound significantly inhibited the growth and germination of lettuce seeds. In conclusion, assessing the role of endophytes harboring essential crop plants can help us to develop potentially eco-friendly herbicides.

  5. Effects of humic acid on phytodegradation of petroleum hydrocarbons in soil simultaneously contaminated with heavy metals.

    PubMed

    Park, Soyoung; Kim, Ki Seob; Kim, Jeong-Tae; Kang, Daeseok; Sung, Kijune

    2011-01-01

    The use of humic acid (HA) to enhance the efficiency of phytodegradation of petroleum hydrocarbons in soil contaminated with diesel fuel was evaluated in this study. A sample of soil was artificially contaminated with commercially available diesel fuel to an initial total petroleum hydrocarbons (TPH) concentration of 2300 mg/kg and four heavy metals with concentrations of 400 mg/kg for Pb, 200 mg/kg for Cu, 12 mg/kg for Cd, and 160 mg/kg for Ni. Three plant species, Brassica campestris, Festuca arundinacea, and Helianthus annuus, were selected for the phytodegradation experiment. Percentage degradation of TPH in the soil in a control pot supplemented with HA increased to 45% from 30% without HA. The addition of HA resulted in an increases in the removal of TPH from the soil in pots planted with B. campestris, E arundinacea, and H. annuus, enhancing percentage degradation to 86%, 64%, and 85% from 45%, 54%, and 66%, respectively. The effect of HA was also observed in the degradation of n-alkanes within 30 days. The rates of removal of n-alkanes in soil planted with B. campestris and H. annuus were high for n-alkanes in the range of C11-C28. A dynamic increase in dehydrogenase activity was observed during the last 15 days of a 30-day experimental period in all the pots amended with HA. The enhanced biodegradation performance for TPHs observed might be due to an increase in microbial activities and bioavailable TPH in soils caused by combined effects of plants and HA. The results suggested that HA could act as an enhancing agent for phytodegradation of petroleum hydrocarbons in soil contaminated with diesel fuel and heavy metals. PMID:22432335

  6. Genome-scale transcriptional analyses of first-generation interspecific sunflower hybrids reveals broad regulatory compatibility

    PubMed Central

    2013-01-01

    Background Interspecific hybridization creates individuals harboring diverged genomes. The interaction of these genomes can generate successful evolutionary novelty or disadvantageous genomic conflict. Annual sunflowers Helianthus annuus and H. petiolaris have a rich history of hybridization in natural populations. Although first-generation hybrids generally have low fertility, hybrid swarms that include later generation and fully fertile backcross plants have been identified, as well as at least three independently-originated stable hybrid taxa. We examine patterns of transcript accumulation in the earliest stages of hybridization of these species via analyses of transcriptome sequences from laboratory-derived F1 offspring of an inbred H. annuus cultivar and a wild H. petiolaris accession. Results While nearly 14% of the reference transcriptome showed significant accumulation differences between parental accessions, total F1 transcript levels showed little evidence of dominance, as midparent transcript levels were highly predictive of transcript accumulation in F1 plants. Allelic bias in F1 transcript accumulation was detected in 20% of transcripts containing sufficient polymorphism to distinguish parental alleles; however the magnitude of these biases were generally smaller than differences among parental accessions. Conclusions While analyses of allelic bias suggest that cis regulatory differences between H. annuus and H. petiolaris are common, their effect on transcript levels may be more subtle than trans-acting regulatory differences. Overall, these analyses found little evidence of regulatory incompatibility or dominance interactions between parental genomes within F1 hybrid individuals, although it is unclear whether this is a legacy or an enabler of introgression between species. PMID:23701699

  7. Genomics of homoploid hybrid speciation: diversity and transcriptional activity of long terminal repeat retrotransposons in hybrid sunflowers.

    PubMed

    Renaut, Sebastien; Rowe, Heather C; Ungerer, Mark C; Rieseberg, Loren H

    2014-08-01

    Hybridization is thought to play an important role in plant evolution by introducing novel genetic combinations and promoting genome restructuring. However, surprisingly little is known about the impact of hybridization on transposable element (TE) proliferation and the genomic response to TE activity. In this paper, we first review the mechanisms by which homoploid hybrid species may arise in nature. We then present hybrid sunflowers as a case study to examine transcriptional activity of long terminal repeat retrotransposons in the annual sunflowers Helianthus annuus, Helianthus petiolaris and their homoploid hybrid derivatives (H. paradoxus, H. anomalus and H. deserticola) using high-throughput transcriptome sequencing technologies (RNAseq). Sampling homoploid hybrid sunflower taxa revealed abundant variation in TE transcript accumulation. In addition, genetic diversity for several candidate genes hypothesized to regulate TE activity was characterized. Specifically, we highlight one candidate chromatin remodelling factor gene with a direct role in repressing TE activity in a hybrid species. This paper shows that TE amplification in hybrid lineages is more idiosyncratic than previously believed and provides a first step towards identifying the mechanisms responsible for regulating and repressing TE expansions.

  8. Preparation of Inulin Powder from Jerusalem Artichoke (Helianthus tuberosus L.) Tuber.

    PubMed

    Srinameb, Bang-orn; Nuchadomrong, Suporn; Jogloy, Sanun; Patanothai, Aran; Srijaranai, Supalax

    2015-06-01

    The complete procedure for the production of inulin powder from Jerusalem artichoke tubers (JAT) was investigated. The procedure consists of isolation of inulin from JAT, elimination of color from the inulin extract and solidification. Washed tubers were first sliced, dried in a 60 °C oven for 10 h and then milled and sieved into a powder. Inulin was isolated from the JAT powder by hot water extraction using an accelerated solvent extractor (ASE). The effects of temperature and time for the extraction were investigated. The highest extraction efficiency was obtained at the extraction temperature of 80 °C for 20 min. The color of the extract was eliminated using ion exchange process with diethylaminoethyl cellulose as the sorbent. The inulin powder was subsequently obtained by freeze drying. Inulin content and inulin profiles were monitored to evaluate the efficiencies of the complete procedure. The inulin content was indirectly determined by spectrophotometry from free and total fructose measurements using potassium iodide. The inulin profile was monitored using high performance anion exchange chromatography equipped with integrated pulse amperometric detection (HPAEC-PAD). The proposed method provided the inulin production yield of 92.5%. The present procedure is fast, simple and effective for production of inulin powder from JAT. In addition, infrared spectra and some physico-chemical properties of the obtained inulin powder were determined and compared with the standard inulin.

  9. Influence of planting date and temperature on inulin content in Jerusalem Artichoke (Helianthus tuberosus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Lower temperatures during the dry season in tropical regions might affect inulin content and inulin yield of Jerusalem artichoke. The objective of this study was to determine the effect of planting dates during low temperature on inulin yield and content of Jerusalem artichoke. Two pot experiments...

  10. Ethanol production from Jerusalem artichoke tubers (Helianthus tuberosus). Using Kluyveromyces marxcianus and Saccharomyces rosei

    SciTech Connect

    Margaritis, A.; Bajpai, P.

    1982-04-01

    This article examines the potential of Jerusalem artichoke as a source for ethanol and single-cell protein SCP. In addition, experimental results are presented on batch fermentation kinetics employing two strains of Kluyveromyces marxianus and one strain of Saccharomyces rosei grown on the extract derived from the tubers of Jerusalem artichoke. Of the three cultures examined, Kluyveromyces marxianus UCD (FST) 55-82 was found to be the best producer of ethanol grown in a simple medium at 35 degrees C. The ethanol production was found to be growth-associated having a mu max = 0.41/h and the ethanol and biomass yields were determined to be Y p/s = 0.45 (88% of the theoretical) and Y x/s = 0.04 with 92% of the original sugars utilized. On the basis of carbohydrate yields of Jerusalem artichoke reported in the literature and these batch kinetic studies with Kluyveromyces marxianus, the calculated ethanol yields were found to range from 1400 kg ethanol/acre/yr to a maximum of 2700 kg ethanol/acre/yr. The SCP yields for Kluyveromyces marxianus were calculated to range between 130 to 250 kg dry wt cell/acre/yr. The potential for developing an integrated process to produce ethanol and SCP is also discussed. (Refs. 27).

  11. Unconventional amino acid sequence of the sun anemone (Stoichactis helianthus) polypeptide neurotoxin

    SciTech Connect

    Kem, W.; Dunn, B.; Parten, B.; Pennington, M.; Price, D.

    1986-05-01

    A 5000 dalton polypeptide neurotoxin (Sh-NI) purified by G50 Sephadex, P-cellulose, and SP-Sephadex chromatography was homogeneous by isoelectric focusing. Sh-NI was highly toxic to crayfish (LD/sub 50/ 0.6 ..mu..g/kg) but without effect upon mice at 15,000 ..mu..g/kg (i.p. injection). The reduced, /sup 3/H-carboxymethylated toxin and its fragments were subjected to automatic Edman degradation and the resulting PTH-amino acids were identified by HPLC, back hydrolysis, and scintillation counting. Peptides resulting from proteolytic (clostripain, staphylococcal protease) and chemical (tryptophan) cleavage were sequenced. The sequence is: AACKCDDEGPDIRTAPLTGTVDLGSCNAGWEKCASYYTIIADCCRKKK. This sequence differs considerably from the homologous Anemonia and Anthopleura toxins; many of the identical residues (6 half-cystines, G9, P10, R13, G19, G29, W30) are probably critical for folding rather than receptor recognition. However, the Sh-NI sequence closely resembles Radioanthus macrodactylus neurotoxin III and r. paumotensis II. The authors propose that Sh-NI and related Radioanthus toxins act upon a different site on the sodium channel.

  12. Ethanol production from Jerusalem artichoke tubers (Helianthus tuberosus) using Kluyveromyces marxianus and Saccharomyces rosei

    SciTech Connect

    Margaritis, A.; Bajpai, P.

    1982-04-01

    This article examines the potential of Jerusalem artichoke as a source for ethanol and single-cell protein SCP. In addition, experimental results are presented on batch fermentation kinetics employing two strains of Kluyveromyces marxianus and one strain of Saccharomyces rosei grown in the extract derived from the tubers of Jeusalem artichoke. Of the three cultures examined, Kluyveromyces marxianus UCD (EST) 55-82 was found to be the best producer of ethanol grown in a simple medium at 35/sup 0/C. The ethanol production was found to be growth-associated haveing a ..mu../sub max/ = 0.41 h/sup -1/ and the ethanol and biomass yields were determined to be Y/sub p///sub = 0.45 (88% of the theoretical) and Y/sub x///sub s/ = 0.04 with 92% of the original sugars utilized. On the basis of carbohydrate yields of Jerusalem artichoke reported in the literature and these batch kinetic studies with K. marxianus, the calculated ethanol yields were found to range from 1400 kg ethanol acre/sup -1/ yr /sup -1/ to a maximum of 2700 kg ethanol acre/sup -1/ yr/sup -1/. The SCP yields for K. marxianus were calculated to range between 130 to 250 kg dry wt cell acre/sup -1/ yr/sup -1/. The potential for developing an integrated process to produce ethanol and SCP is also discussed.

  13. Genetic diversity of water use efficiency in Jerusalem artichoke (Helianthus tuberosus L.) germplasm

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Genetic diversity in crop germplasm is an important resource for crop improvement, but information on genetic diversity is rare for Jerusalem artichoke, especially for traits related to water use efficiency. The objectives of this study were to investigate genetic variations for water use and water...

  14. Relationship between chlorophyll density and SPAD chlorophyll meter reading for Jerusalem artichoke (Helianthus tuberosus L.)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Chlorophyll is an indicator of crop health and productivity. Measuring chlorophyll is usually done directly and requires significant time and resources. Indirect measurement of chlorophyll density using a handheld portable chlorophyll meter can reduce time. However, this information is very limit...

  15. Plant growth promotion by inoculation with selected bacterial strains versus mineral soil supplements.

    PubMed

    Wernitznig, S; Adlassnig, W; Sprocati, A R; Turnau, K; Neagoe, A; Alisi, C; Sassmann, S; Nicoara, A; Pinto, V; Cremisini, C; Lichtscheidl, I

    2014-01-01

    In the process of remediation of mine sites, the establishment of a vegetation cover is one of the most important tasks. This study tests two different approaches to manipulate soil properties in order to facilitate plant growth. Mine waste from Ingurtosu, Sardinia, Italy rich in silt, clay, and heavy metals like Cd, Cu, and Zn was used in a series of greenhouse experiments. Bacteria with putative beneficial properties for plant growth were isolated from this substrate, propagated and consortia of ten strains were used to inoculate the substrate. Alternatively, sand and volcanic clay were added. On these treated and untreated soils, seeds of Helianthus annuus, of the native Euphorbia pithyusa, and of the grasses Agrostis capillaris, Deschampsia flexuosa and Festuca rubra were germinated, and the growth of the seedlings was monitored. The added bacteria established well under all experimental conditions and reduced the extractability of most metals. In association with H. annuus, E. pithyusa and D. flexuosa bacteria improved microbial activity and functional diversity of the original soil. Their effect on plant growth, however, was ambiguous and usually negative. The addition of sand and volcanic clay, on the other hand, had a positive effect on all plant species except E. pithyusa. Especially the grasses experienced a significant benefit. The effects of a double treatment with both bacteria and sand and volcanic clay were rather negative. It is concluded that the addition of mechanical support has great potential to boost revegetation of mining sites though it is comparatively expensive. The possibilities offered by the inoculation of bacteria, on the other hand, appear rather limited.

  16. Influence of copper on root exudate patterns in some metallophytes and agricultural plants.

    PubMed

    Meier, S; Alvear, M; Borie, F; Aguilera, P; Ginocchio, R; Cornejo, P

    2012-01-01

    A hydroponic experiment was carried out to determine the root exudation patterns in two Cu-metallophytes (Oenothera picensis and Imperata condensata) and two agricultural plants (Lupinus albus and Helianthus annuus). Plants were grown in nutrient solution at increasing Cu doses (0, 0.125, 0.25, 0.5, 1 and 2mgCuL(-1)), and plant growth, root elongation, Cu accumulation and root exudates were measured. All plants showed a decrease of over 60% in root elongation at the highest Cu supply level, being O. picensis the most sensitive specie and showing the highest shoot and root Cu concentrations (116 and 2657μgCug(-1), respectively), which were six fold higher than the other species. Differences in root exudation patterns of low molecular weight organic acids were found, with extremely high amounts of succinic acid exuded by O. picensis (1049μmolg(-1)h(-1)), and citric acid by I. condensata (164μmolg(-1)h(-1)). In metallophytes, the organic acid exudation was increased even with no root elongation, meanwhile agricultural plants exuded citric acid at constant levels. Exudation of phenolic compounds was highly species-dependent, with catechin mainly exuded by I. condensata, (2.62μmolg(-1)h(-1)) cinnamic acid by O. picensis (5.08μmolg(-1)h(-1)) and coumaric acid exclusively exuded by H. annuus (13.6μmolg(-1)h(-1)) at high Cu levels. These results indicated that differences in root exudation patterns among metallophytes and agricultural plants could affect their Cu tolerance. Particularly, the higher exudation rate showed by I. condensata can be an effective exclusion mechanism to tolerate high Cu concentrations, supporting its use in Cu phytostabilization programs. PMID:21937112

  17. SSRs and INDELs mined from the sunflower EST database: abundance, polymorphisms, and cross-taxa utility.

    PubMed

    Heesacker, Adam; Kishore, Venkata K; Gao, Wenxiang; Tang, Shunxue; Kolkman, Judith M; Gingle, Alan; Matvienko, Marta; Kozik, Alexander; Michelmore, Richard M; Lai, Zhao; Rieseberg, Loren H; Knapp, Steven J

    2008-11-01

    Simple sequence repeats (SSRs) are abundant and frequently highly polymorphic in transcribed sequences and widely targeted for marker development in eukaryotes. Sunflower (Helianthus annuus) transcript assemblies were built and mined to identify SSRs and insertions-deletions (INDELs) for marker development, comparative mapping, and other genomics applications in sunflower. We describe the spectrum and frequency of SSRs identified in the sunflower EST database, a catalog of 16,643 EST-SSRs, a collection of 484 EST-SSR and 43 EST-INDEL markers developed from common sunflower ESTs, polymorphisms of the markers among the parents of several intraspecific and interspecific mapping populations, and the transferability of the markers to closely and distantly related species in the Compositae. Of 17,904 unigenes in the transcript assembly, 1,956 (10.9%) harbored one or more SSRs with repeat counts of n > or = 5. EST-SSR markers were 1.6-fold more polymorphic among exotic than elite genotypes and 0.7-fold less polymorphic than non-genic SSR markers. Of 466 EST-SSR or INDEL markers screened for cross-species amplification and polymorphisms, 413 (88.6%) amplified alleles from one or more wild species (H. argophyllus, H. tuberosus, H. anomalus, H. paradoxus, and H. deserticola), whereas 69 (14.8%) amplified alleles from safflower (Carthamus tinctorius) and 67 (14.4%) amplified alleles from lettuce (Lactuca sativa); hence, only a fraction were transferable to distantly related genera in the Compositae, whereas most were transferable to wild relatives of H. annuus. Several thousand additional SSRs were identified in the EST database and supply a wealth of templates for EST-SSR marker development in sunflower.

  18. Influence of copper on root exudate patterns in some metallophytes and agricultural plants.

    PubMed

    Meier, S; Alvear, M; Borie, F; Aguilera, P; Ginocchio, R; Cornejo, P

    2012-01-01

    A hydroponic experiment was carried out to determine the root exudation patterns in two Cu-metallophytes (Oenothera picensis and Imperata condensata) and two agricultural plants (Lupinus albus and Helianthus annuus). Plants were grown in nutrient solution at increasing Cu doses (0, 0.125, 0.25, 0.5, 1 and 2mgCuL(-1)), and plant growth, root elongation, Cu accumulation and root exudates were measured. All plants showed a decrease of over 60% in root elongation at the highest Cu supply level, being O. picensis the most sensitive specie and showing the highest shoot and root Cu concentrations (116 and 2657μgCug(-1), respectively), which were six fold higher than the other species. Differences in root exudation patterns of low molecular weight organic acids were found, with extremely high amounts of succinic acid exuded by O. picensis (1049μmolg(-1)h(-1)), and citric acid by I. condensata (164μmolg(-1)h(-1)). In metallophytes, the organic acid exudation was increased even with no root elongation, meanwhile agricultural plants exuded citric acid at constant levels. Exudation of phenolic compounds was highly species-dependent, with catechin mainly exuded by I. condensata, (2.62μmolg(-1)h(-1)) cinnamic acid by O. picensis (5.08μmolg(-1)h(-1)) and coumaric acid exclusively exuded by H. annuus (13.6μmolg(-1)h(-1)) at high Cu levels. These results indicated that differences in root exudation patterns among metallophytes and agricultural plants could affect their Cu tolerance. Particularly, the higher exudation rate showed by I. condensata can be an effective exclusion mechanism to tolerate high Cu concentrations, supporting its use in Cu phytostabilization programs.

  19. Cell division and turgor-driven stem elongation in juvenile plants: a synthesis.

    PubMed

    Kutschera, Ulrich; Niklas, Karl J

    2013-06-01

    The growth of hypocotyls and epicotyls has been attributed to the turgor-driven enlargement of cells, a process that is under the control of phytohormones such as auxin. However, the experiments presented here and elsewhere using developing sunflower (Helianthus annuus L.) seedlings raised either in darkness (skotomorphogenesis) or in white light (WL) (photomorphogenesis) indicate that auxin-mediated segment elongation ceases after 1 day, whereas hypocotyl growth continues in the intact system. Based on these results and data from the literature, we propose that hypocotyl growth consists of three inter-related processes: (1) cell division in the apical meristematic regions; (2) turgor-driven cell elongation along the stem; and (3) cell maturation in the basal region of the organ. We document that the closed apical hook (or the corresponding region after opening in WL) is the location where cell division occurs, and suggest that the epidermis and the outer cortex plays an important role in a "pacemaker system" for cell division. Results from the literature support the hypothesis that pectin metabolism in the expansion-limiting epidermal cell wall(s) is involved in wall-loosening and -stiffening. During hypocotyl growth in darkness and WL, turgor pressure is largely maintained, i.e., in H. annuus no hydrostatic pressure-regulated growth occurs. These data do not support the "loss of stability theory" of cell expansion. Finally, we document that turgor maintenance during organ elongation is caused by sucrose catabolism via vacuolar acid invertases, resulting in the generation of hexoses (osmoregulation). Based on these data, we present an integrative model of axial elongation in developing seedlings of dicotyledonous plants and discuss open questions.

  20. C3 versus C4 cavitation resistance and embolism repair under different levels of soil moisture availability

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Comparison of maize and sunflower (Helianthus) under deficit irrigation indicates that maize has more conservative water use with lower maximum hydraulic conductance than Helianthus. We observe that maize under deficit irrigation dramatically reduces transpiration while Helianthus maintains high wat...

  1. Phytoextraction and phytostabilisation of metal-contaminated soil in temperate maritime climate of coastal British Columbia, Canada

    NASA Astrophysics Data System (ADS)

    Padmavathiamma, P. K.; Li, L. Y.

    2009-04-01

    This research addressed the phytoremediation of roadside soils subjected to multi-component metal solutions. A typical right of way for roads in Canada is around 30 m, and at least 33% of that land in the right of way is unpaved and can support animal life. Thus, land associated with 12,000 km of roads in the province of British Columbia and millions of kilometres around the world represent a substantial quantity of wildlife habitat where metal contamination needs to be remediated. Phytostabilisation, requires least maintenance among different phytoremediation techniques, and it could be a feasible and practical method of remediating in roadside soils along highways and for improving highway runoff drainage. The suitability of five plant species was studied for phytoextraction and phytostabilisation in a region with temperate maritime climate of coastal British Columbia, Canada. Pot experiments were conducted using Lolium perenne L (perennial rye grass), Festuca rubra L (creeping red fescue), Helianthus annuus L (sunflower), Poa pratensis L (Kentucky bluegrass) and Brassica napus L (rape) in soils treated with three different metal (Cu, Pb, Mn and Zn) concentrations. The bio-metric characters of plants in soils with multiple-metal contaminations, their metal accumulation characteristics, translocation properties and metal removal were assessed at different stages of plant growth, 90 and 120 DAS (days after sowing). Lolium was found to be suitable for the phytostabilisation of Cu and Pb, Festuca for Mn and Poa for Zn. Metal removal was higher at 120 than at 90 days after sowing, and metals concentrated more in the underground tissues with less translocation to the above-ground parts. Bioconcentration factors indicate that Festuca had the highest accumulation for Cu, Helianthus for Pb and Zn and Poa for Mn.

  2. 76 FR 46837 - Endangered and Threatened Species Permit Applications

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-08-03

    ...). Hedeoma todsenii (Todsen's pennyroyal). Helianthus paradoxus (Pecos sunflower). Ipomopsis sancti-spiritus... reintroduction seeds from Helianthus paradoxus (Pecos sunflower) from plants in New Mexico. Authority: 16...

  3. Sunflower: a potential fructan-bearing crop?

    PubMed

    Martínez-Noël, Giselle M A; Dosio, Guillermo A A; Puebla, Andrea F; Insani, Ester M; Tognetti, Jorge A

    2015-01-01

    Grain filling in sunflower (Helianthus annuus L.) mainly depends on actual photosynthesis, being the contribution of stored reserves in stems (sucrose, hexoses, and starch) rather low. Drought periods during grain filling often reduce yield. Increasing the capacity of stem to store reserves could help to increase grain filling and yield stability in dry years. Fructans improve water uptake in soils at low water potential, and allow the storage of large amount of assimilates per unit tissue volume that can be readily remobilized to grains. Sunflower is a close relative to Jerusalem artichoke (H. tuberosus L.), which accumulates large amounts of fructan (inulin) in tubers and true stems. The reason why sunflower does not accumulate fructans is obscure. Through a bioinformatics analysis of a sunflower transcriptome database, we found sequences that are homologous to dicotyledon and monocotyledon fructan synthesis genes. A HPLC analysis of stem sugar composition revealed the presence of low amounts of 1-kestose, while a drastic enhancement of endogenous sucrose levels by capitulum removal did not promote 1-kestose accumulation. This suggests that the regulation of fructan synthesis in this species may differ from the currently best known model, mainly derived from research on Poaceae, where sucrose acts as both a signaling molecule and substrate, in the induction of fructan synthesis. Thus, sunflower might potentially constitute a fructan-bearing species, which could result in an improvement of its performance as a grain crop. However, a large effort is needed to elucidate how this up to now unsuspected potential could be effectively expressed.

  4. Comprehensive Protein-Based Artificial MicroRNA Screens for Effective Gene Silencing in Plants[W

    PubMed Central

    Li, Jian-Feng; Chung, Hoo Sun; Niu, Yajie; Bush, Jenifer; McCormack, Matthew; Sheen, Jen

    2013-01-01

    Artificial microRNA (amiRNA) approaches offer a powerful strategy for targeted gene manipulation in any plant species. However, the current unpredictability of amiRNA efficacy has limited broad application of this promising technology. To address this, we developed epitope-tagged protein-based amiRNA (ETPamir) screens, in which target mRNAs encoding epitope-tagged proteins were constitutively or inducibly coexpressed in protoplasts with amiRNA candidates targeting single or multiple genes. This design allowed parallel quantification of target proteins and mRNAs to define amiRNA efficacy and mechanism of action, circumventing unpredictable amiRNA expression/processing and antibody unavailability. Systematic evaluation of 63 amiRNAs in 79 ETPamir screens for 16 target genes revealed a simple, effective solution for selecting optimal amiRNAs from hundreds of computational predictions, reaching ∼100% gene silencing in plant cells and null phenotypes in transgenic plants. Optimal amiRNAs predominantly mediated highly specific translational repression at 5′ coding regions with limited mRNA decay or cleavage. Our screens were easily applied to diverse plant species, including Arabidopsis thaliana, tobacco (Nicotiana benthamiana), tomato (Solanum lycopersicum), sunflower (Helianthus annuus), Catharanthus roseus, maize (Zea mays) and rice (Oryza sativa), and effectively validated predicted natural miRNA targets. These screens could improve plant research and crop engineering by making amiRNA a more predictable and manageable genetic and functional genomic technology. PMID:23645631

  5. Peroxisomal Plant 3-Ketoacyl-CoA Thiolase Structure and Activity Are Regulated by a Sensitive Redox Switch*

    PubMed Central

    Pye, Valerie E.; Christensen, Caspar E.; Dyer, James H.; Arent, Susan; Henriksen, Anette

    2010-01-01

    The breakdown of fatty acids, performed by the β-oxidation cycle, is crucial for plant germination and sustainability. β-Oxidation involves four enzymatic reactions. The final step, in which a two-carbon unit is cleaved from the fatty acid, is performed by a 3-ketoacyl-CoA thiolase (KAT). The shortened fatty acid may then pass through the cycle again (until reaching acetoacetyl-CoA) or be directed to a different cellular function. Crystal structures of KAT from Arabidopsis thaliana and Helianthus annuus have been solved to 1.5 and 1.8 Å resolution, respectively. Their dimeric structures are very similar and exhibit a typical thiolase-like fold; dimer formation and active site conformation appear in an open, active, reduced state. Using an interdisciplinary approach, we confirmed the potential of plant KATs to be regulated by the redox environment in the peroxisome within a physiological range. In addition, co-immunoprecipitation studies suggest an interaction between KAT and the multifunctional protein that is responsible for the preceding two steps in β-oxidation, which would allow a route for substrate channeling. We suggest a model for this complex based on the bacterial system. PMID:20463027

  6. Assembly and loss of the polar flagellum in plant-associated methylobacteria

    NASA Astrophysics Data System (ADS)

    Doerges, L.; Kutschera, U.

    2014-04-01

    On the leaf surfaces of numerous plant species, inclusive of sunflower ( Helianthus annuus L.), pink-pigmented, methanol-consuming, phytohormone-secreting prokaryotes of the genus Methylobacterium have been detected. However, neither the roles, nor the exact mode of colonization of these epiphytic microbes have been explored in detail. Using germ-free sunflower seeds, we document that, during the first days of seedling development, methylobacteria exert no promotive effect on organ growth. Since the microbes are evenly distributed over the outer surface of the above-ground phytosphere, we analyzed the behavior of populations taken from two bacterial strains that were cultivated as solid, biofilm-like clones on agar plates in different aqueous environments ( Methylobacterium mesophilicum and M. marchantiae, respectively). After transfer into liquid medium, the rod-shaped, immobile methylobacteria assembled a flagellum and developed into planktonic microbes that were motile. During the linear phase of microbial growth in liquid cultures, the percentage of swimming, flagellated bacteria reached a maximum, and thereafter declined. In stationary populations, living, immotile bacteria, and isolated flagella were observed. Hence, methylobacteria that live in a biofilm, transferred into aqueous environments, assemble a flagellum that is lost when cell density has reached a maximum. This swimming motility, which appeared during ontogenetic development within growing microbial populations, may be a means to colonize the moist outer surfaces of leaves.

  7. Cloning and sequence analysis of the safflower betaine aldehyde dehydrogenase gene.

    PubMed

    Wang, Y B; Guan, L L; Xu, Y W; Shen, H; Wu, W

    2014-01-01

    In response to salinity or drought stress, many plants accumulate glycine betaine, which is a regulator of osmosis. In plants, the last step in betaine synthesis is catalyzed by betaine aldehyde dehydrogenase (BADH), a nuclear-encoded chloroplastic enzyme. Based on the conserved oligo amino acid residues of the published BADH genes from other higher plant species, a cDNA sequence, designated CtBADH, was isolated from safflower (Carthamus tinctorius L.) using a polymerase chain reaction approach. The clones were 1.7 kb on average, and contained an open reading frame predicting a polypeptide of 503 amino acids with 84.5% identity to that of Helianthus annuus. The deduced amino acid sequence showed a decapeptide, Val-Thr-Leu-Geu-Leu-Gly-Gly-Lys-Ser-Pro and Cys, which is essential for proper functioning of BADH. Phylogenetic analysis indicated that CtBADH grouped with other dicotyledonous plant BADH genes, and subgrouped in the composite family. Prediction of secondary structure and subcellular localization suggested that the protein encoded by CtBADH contains 33 coils, 15 alpha helixes, and 21 beta strands, and most likely targets the chloroplast or mitochondria.

  8. Food waste composting: its use as a peat replacement.

    PubMed

    Farrell, M; Jones, D L

    2010-01-01

    We successfully co-composted catering waste with green waste and shredded paper to yield two high-nitrogen composts for use in horticulture. Sunflowers (Helianthus annuus L.) were grown in various mixtures of the compost and a commercially available peat-based compost to assess the efficacy of catering waste-based composts for peat replacement. Height, head diameter, seed mass and above-ground biomass were measured, with all mixtures giving a significant increase in yield or size over the commercially available peat-free control compost. We conclude that differences in physical structure governed sunflower growth over substrate chemistry, and none of the compost mixtures were nutrient deficient. We recommend that catering waste co-compost can be substituted to at least 75% within Sphagnum-based traditional growing media, providing a viable replacement for a large proportion of peat used as a growth medium in the horticulture industry. Our catering waste compost yielded similar seed head, seed mass and above-ground biomass values to 100% peat-based compost in all food waste compost blends tested in this study.

  9. Purification and Characterization of the Crown Gall-specific Enzyme, Octopine Synthase.

    PubMed

    Hack, E; Kemp, J D

    1980-05-01

    A single enzyme catalyzes the synthesis of all four N(2)-(1-carboxyethyl)-amino acid derivatives found in a crown gall tumor tissue induced by Agrobacterium tumefaciens (E. F. Sm. and Town.) Conn strain B6 on sunflower (Helianthus annuus L.). This enzyme, octopine synthase, has been purified by ammonium sulfate fractionation and chromatography on diethylaminoethylcellulose, blue agarose, and hydroxylapatite. The purified enzyme has all the N(2)-(1-carboxyethyl)-amino acid synthesizing activities found in crude preparations, and the relative activities with six amino acids remain nearly constant during purification. Although the maximum velocities (V) and Michaelis constants (K(m)) differ, the ratio V/K(m) is the same for all amino acid substrates. Thus an equimolar mixture of amino acids will give rise to an equimolar mixture of products. The kinetic properties of the enzyme are consistent with a partially ordered mechanism with arginine (NADPH, then arginine or pyruvate). Octopine synthase is a monomeric enzyme with a molecular weight of 39,000 by gel filtration and 38,000 by sodium dodecyl sulfate-polyacrylamide gel electrophoresis.

  10. Purification and characterization of the crown gall specific enzyme nopaline synthase.

    PubMed

    Kemp, J D; Sutton, D W; Hack, E

    1979-08-21

    Nopaline synthase of sunflower (Helianthus annuus L.) crown gall tissue induced by Agrobacterium tumefaciens strain C58 or T37 (nopaline utilizers) was purified to homogeneity as judged by analytical disc gel electrophoresis. The native enzyme elutes from a column of Ultrogen AcA 34 as a single peak with an estimated molecular weight of 158,000. The dissociated enzyme migrates on NaDodSO4-polyacrylamide gels as a single band with a molecular weight of 40,000. Thus, the native enzyme appears to be composed of four equal-weight subunits. Nopaline synthesizing activity is found exclusively in crown gall tissues induced by strains of A. tumefaciens that utilize nopaline (e.g., C58 and T37). We found the same tissue specificity for the purified protein that we believe represents nopaline synthase. The results of kinetic studies of the purified enzyme are consistent with a ter-bi rapid-equilibrium random-order mechanism. Nopaline synthase is probably responsible for the in vivo synthesis of both N2-(1,3-dicarboxypropyl)arginine (nopaline) and N2-(1,3-dicarboxypropyl)ornithine (ornaline) in crown gall tissues since substrate specificities and Km values do not change during purification.

  11. The effect of atmospheric humidity on photosynthesis, transpiration and water use efficiency of leaves of several plant species.

    PubMed

    Rawson, H M; Begg, J E; Woodward, R G

    1977-01-01

    The effect of humidity on the gas exchange of leaves of the dicotyledons soybean (Glycine max (L.) Merrill), sunflower (Helianthus annuus L.), jojoba (Simmondsia chinensis (L.) Schneider), and saltbush (Atriplex halimus L.) and the monocotyledons wheat (Triticum aestivum L.), barley (Hordeum vulgare L.) sorghum (Sorghum bicolor (L.) Moench) and barnyard grass (Echinochloa crus-galli (L.) Beauv.) was examined under conditions of adequate soil moisture in a controlled environment. Photosynthesis and stomatal and internal diffusion resistances of whole, attached, single leaves were not affected by changes in humidity as the vapour pressure deficit between the leaf and atmosphere ranged from 8 to 27 mb. Transpiration increased linearly with increasing vapour pressure deficit. Whole plants of barley exhibited a different response. As humidity was increased, photosynthesis increased, transpiration expressed per unit of vapour pressure difference increased, and diffusion resistances became smaller. Reasons for the different behaviour of single leaves and whole plants are suggested. An index for water use efficiency, expressed per millibar of vapour pressure deficit, was calculated for single leaves of each species used in the experiments. This showed that water use efficiency was highest in the C4 xerophytes and lowest in the C3 mesophytes. The effect of environment on water use efficiency is examined using data from the literature. PMID:24419571

  12. Co-localization of putative calcium channels (phenylalkylamine-binding sites) on oil bodies in protoplasts from dark-grown sunflower seedling cotyledons.

    PubMed

    Vandana, Shweta; Bhatla, Satish C

    2009-07-01

    Oil bodies are spherical entities containing a triacylglycerol (TAG) matrix encased by a phospholipid monolayer, which is stabilized by oil body-specific proteins, principally oleosins. Biochemical investigations in the recent past have also demonstrated the expression of calcium-binding proteins, called caleosins, as a component of oil body membranes during seed germination. Using DM-Bodipy-phenylalkylamine (PAA; a fluorescent derivative of phenylalkylamine)-a fluorescent probe known to bind L-type calcium channel proteins, present investigations provide the first report on the localization and preferential accumulation of putative calcium channel proteins on/around oil bodies during peak lipolytic phase in protoplasts derived from dark-grown sunflower (Helianthus annuus L. cv Morden) seedling cotyledons. Specificity of DM-Bodipy-PAA labeling was confirmed by using bepridil, a non-fluorescent competitor of PAA while non-specific dye accumulation has been ruled out by using Bodipy-FL as control. Co-localization of fluorescence from DM-Bodipy-PAA binding sites (ex: 504 nm; em: 511 nm) and nile red fluorescing oil bodies (ex: 552 nm; em: 636 nm) has been undertaken by epifluorescence and confocal laser scanning microscopy (CLSM). It revealed the affinity of PAA-sensitive ion channels for the oil body surface. Findings from the current investigations highlight the significance of calcium and calcium channel proteins during oil body mobilization in sunflower.

  13. Copper phytoextraction in tandem with oilseed production using commercial cultivars and mutant lines of sunflower.

    PubMed

    Kolbas, A; Mench, M; Herzig, R; Nehnevajova, E; Bes, C M

    2011-01-01

    Use of sunflower (Helianthus annuus L.) for Cu phytoextraction and oilseed production on Cu-contaminated topsoils was investigated in afield trial at a former wood preservation site. Six commercial cultivars and two mutant lines were cultivated in plots with and without the addition of compost (5% w/w) and dolomitic limestone (0.2% w/w). Total soil Cu ranged from 163 to 1170 mg kg(-1). In soil solutions, Cu concentration varied between 0.16-0.93 mg L(-1). The amendment increased soil pH, reduced Cu exposure and promoted sunflower growth. Stem length, shoot and capitulum biomasses, seed yield, and shoot and leaf Cu concentrations were measured. At low total soil Cu, shoot Cu mineralomass was higher in commercial cultivars, Le., Salut, Energic, and Countri, whereas competition and shading affected morphological traits of mutants. Based on shoot yield (7 Mg DW ha(-1)) and Cu concentration, the highest removal was 59 g Cu ha(-1). At high total soil Cu, shoot Cu mineralomass peaked for mutants (e.g., 52 g Cu ha(-1) for Mutant 1 line) and cultivars Energic and Countri. Energic seed yield (3.9 Mg air-DW ha(-1)) would be sufficient to produce oil Phenotype traits and shoot Cu removal depended on sunflower types and Cu exposure.

  14. Proteomic analysis of oil body membrane proteins accompanying the onset of desiccation phase during sunflower seed development.

    PubMed

    Thakur, Anita; Bhatla, Satish C

    2015-01-01

    A noteworthy metabolic signature accompanying oil body (OB) biogenesis during oilseed development is associated with the modulation of the oil body membranes proteins. Present work focuses on 2-dimensional polyacrylamide gel electrophoresis (2-D PAGE)-based analysis of the temporal changes in the OB membrane proteins analyzed by LC-MS/MS accompanying the onset of desiccation (20-30 d after anthesis; DAA) in the developing seeds of sunflower (Helianthus annuus L.). Protein spots unique to 20-30 DAA stages were picked up from 2-D gels for identification and the identified proteins were categorized into 7 functional classes. These include proteins involved in energy metabolism, reactive oxygen scavenging, proteolysis and protein turnover, signaling, oleosin and oil body biogenesis-associated proteins, desiccation and cytoskeleton. At 30 DAA stage, exclusive expressions of enzymes belonging to energy metabolism, desiccation and cytoskeleton were evident which indicated an increase in the metabolic and enzymatic activity in the cells at this stage of seed development (seed filling). Increased expression of cruciferina-like protein and dehydrin at 30 DAA stage marks the onset of desiccation. The data has been analyzed and discussed to highlight desiccation stage-associated metabolic events during oilseed development.

  15. Isolation of Gibberellin Precursors from Heavily Pigmented Tissues 1

    PubMed Central

    Metzger, James D.; Hazebroek, Jan P.

    1989-01-01

    The kauranoid precursors of gibberellins are difficult to isolate from heavily pigmented plant tissues. In this paper, we describe relatively simple and efficient procedures for the purification of these compounds from tissues containing chlorophyll and other high molecular weight pigments. Extracts of shoots from Thlaspi arvense L. were subjected first to size exclusion chromatography using ethyl acetate as the eluting solvent. This procedure resulted in the separation of kauranoids as a class of compounds from chlorophyll. Typically, a 90% reduction in mass of the kauranoid enriched-fraction was observed. This fraction was subjected to reverse phase high performance liquid chromatography and individual fractions analyzed by combined gas chromatography-mass spectrometry. Five kauranoids were identified in shoot extracts of T. arvense: ent-kaur-16-ene, ent-kaur-16-en-19-ol, ent-kaur-16-en-19-oic acid, trachylobanoic acid, and 7β, 13-dihydroxykaurenolide. The metabolic relationships of these compounds to the gibberellins previously identified in this species (JD Metzger, MC Mardaus [1986] Plant Physiol 80: 396-402) are discussed. In addition, the utility of size exclusion chromatography in preparative situations is demonstrated by the purification of ent-kaurenoic acid in milligram quantities from the florets of Helianthus annuus L. PMID:16667206

  16. Precision phenotyping of imidazolinone-induced chlorosis in sunflower

    PubMed Central

    Ochogavía, Ana Claudia; Gil, Mercedes; Picardi, Liliana; Nestares, Graciela

    2014-01-01

    Chlorosis level is a useful parameter to assess imidazolinone resistance in sunflower (Helianthus annuus L.). The aim of this study was to quantify chlorosis through two different methods in sunflower plantlets treated with imazapyr. The genotypes used in this study were two inbred lines reported to be different in their resistance to imidazolinones. Chlorosis was evaluated by spectrophotometrical quantification of photosynthetic leaf pigments and by a bioinformatics-based color analysis. A protocol for pigment extraction was presented which improved pigment stability. Chlorophyll amount decreased significantly when both genotypes were treated with 10 μM of imazapyr. Leaf color was characterized using Tomato Analyzer® color test software. A significant positive correlation between color reduction and chlorophyll concentration was found. It suggests that leaf color measurement could be an accurate method to estimate chlorosis and infer chlorophyll levels in sunflower plants. These results highlight a strong relationship between imidazolinone-induced chlorosis and variations in leaf color and in chlorophyll concentration. Both methods are quantitative, rapid, simple, and reproducible. Thus, they could be useful tools for phenotyping and screening large number of plants when breeding for imidazolinone resistance in this species. PMID:25914598

  17. Phototropism involves a lateral gradient of growth inhibitors, not of auxin. A review.

    PubMed

    Bruinsma, J; Hasegawa, K

    1989-01-01

    During phototropic curvature, indolyl-3-acetic acid (IAA) remains evenly distributed in the hypocotyl of sunflower (Helianthus annuus L.) and in the oat (Avena sativa L.) coleoptile. At the irradiated side, growth inhibiting substances accumulate. In sunflower, basipetal movement of a growth factor is not involved, since the top of the seedling can be covered or removed without affecting the photo-tropic response; this response, moreover, is independent of the rate of elongation growth. The chemical nature of the growth-inhibiting substances is only partly known. In the hypocotyl they occur in the neutral fraction: in sunflower cis-xanthoxin is one of them, in radish (Raphanus sativus L.) cis- and trans-raphanusanins, and possibly raphanusamide, are involved. The inhibitor(s) in the oat coleoptile are acidic. During curvature, their amount remains rather constant but the distribution changes with an accumulation at the irradiated side. It is concluded that phototropic curvature is brought about by an accumulation, at the irradiated side, of growth-inhibiting substances that unilaterally reduce cell elongation even though the IAA distribution is uniform.

  18. Effects of Increased Gravity Force on Nutations of Sunflower Hypocotyls 1

    PubMed Central

    Brown, Allan H.; Chapman, David K.

    1977-01-01

    A centrifuge was used to provide sustained acceleration in order to study the hypocotyl nutation of 6-day-old Helianthus annuus L. over a range of g-forces, up to 20 times normal g. At the upper end of this g-range, nutation was impeded and at times was erratic evidently because the weight of the cotyledons exceeded the supportive abilities of the hypocotyls. Over the range 1 to 9 g, the period of nutation was independent of the resultant force vector. Over the same g-range, the amplitude of nutation was nearly independent of the chronic g-force. If nutation in sunflower seedlings is an oscillation caused by a succession of geotropic responses which continue to overshoot the equilibrium position (plumb line), we might expect its amplitude to be more sensitive to changes in magnitude of the sustained g-force. In order to preserve the geotropic model of nutation-viz. that it is a sustained oscillation driven by geotropic reactions, it is necessary to assume that geotropic response must increase with increasing g most rapidly in the region of the g-parameter below the terrestrial value of 1 g. PMID:16659909

  19. Turning heads: the biology of solar tracking in sunflower.

    PubMed

    Vandenbrink, Joshua P; Brown, Evan A; Harmer, Stacey L; Blackman, Benjamin K

    2014-07-01

    Solar tracking in the common sunflower, Helianthus annuus, is a dramatic example of a diurnal rhythm in plants. During the day, the shoot apex continuously reorients, following the sun's relative position so that the developing heads track from east to west. At night, the reverse happens, and the heads return and face east in anticipation of dawn. This daily cycle dampens and eventually stops at anthesis, after which the sunflower head maintains an easterly orientation. Although shoot apical heliotropism has long been the subject of physiological studies in sunflower, the underlying developmental, cellular, and molecular mechanisms that drive the directional growth and curvature of the stem in response to extrinsic and perhaps intrinsic cues are not known. Furthermore, the ecological functions of solar tracking and the easterly orientation of mature heads have been the subject of significant but unresolved speculation. In this review, we discuss the current state of knowledge about this complex, dynamic trait. Candidate mechanisms that may contribute to daytime and nighttime movement are highlighted, including light signaling, hormonal action, and circadian regulation of growth pathways. The merits of the diverse hypotheses advanced to explain the adaptive significance of heliotropism in sunflower are also considered.

  20. Blue Light Activates a Specific Protein Kinase in Higher Plants 1

    PubMed Central

    Reymond, Philippe; Short, Timothy W.; Briggs, Winslow R.

    1992-01-01

    Blue light mediates the phosphorylation of a membrane protein in seedlings from several plant species. When crude microsomal membrane proteins from dark-grown pea (Pisum sativum L.), sunflower (Helianthus annuus L.), zucchini (Cucurbita pepo L.), Arabidopsis (Arabidopsis thaliana L.), or tomato (Lycopersicon esculentum L.) stem segments, or from maize (Zea mays L.), barley (Hordeum vulgare L.), oat (Avena sativa L.), wheat (Triticum aestivum L.), or sorghum (Sorghum bicolor L.) coleoptiles are illuminated and incubated in vitro with [γ-32P]ATP, a protein of apparent molecular mass from 114 to 130 kD is rapidly phosphorylated. Hence, this system is probably ubiquitous in higher plants. Solubilized maize membranes exposed to blue light and added to unirradiated solubilized maize membranes show a higher level of phosphorylation of the light-affected protein than irradiated membrane proteins alone, suggesting that an unirradiated substrate is phosphorylated by a light-activated kinase. This finding is further demonstrated with membrane proteins from two different species, where the phosphorylated proteins are of different sizes and, hence, unambiguously distinguishable on gel electrophoresis. When solubilized membrane proteins from one species are irradiated and added to unirradiated membrane proteins from another species, the unirradiated protein becomes phosphorylated. These experiments indicate that the irradiated fraction can store the light signal for subsequent phosphorylation in the dark. They also support the hypothesis that light activates a specific kinase and that the systems share a close functional homology among different higher plants. Images Figure 1 Figure 2 Figure 5 PMID:16653043

  1. Evidence for a Relationship between H+ Excretion and Auxin in Shoot Gravitropism 1

    PubMed Central

    Wright, Luann Z.; Rayle, David L.

    1983-01-01

    The role of auxin and protons in the gravitropic response of the sunflower (Helianthus annuus L. cv Sungold) hypocotyl has been investigated. No physiological asymmetry in acid-growth capacity could be detected between the upper and lower surfaces of gravistimulated hypocotyls. These data imply that neutral buffers inhibit shoot gravitropism by preventing the establishment of a lateral proton gradient along gravitropically stimulated hypocotyls. Indirect evidence that auxin is involved in the establishment and/or maintenance of such a gradient derives from the quantitative assessment of the effects of exogenous auxin, anti-auxins, and vanadate on gravicurvature. At low concentrations, exogenous auxin accelerated curvature; at high concentrations, curvature was prevented. Vanadate, an inhibitor of auxin-enhanced H+ secretion, α-(p-chlorophenoxy)isobutyric acid (PCIB), an anti-auxin, and 2,3,5-triiodobenzoic acid (TIBA), an auxin-transport inhibitor, prevented observable asymmetric proton excretion using a brom cresol purple agar technique and also inhibited gravicurvature. Vanadate, PCIB, and TIBA inhibition of gravicurvature could be reversed with acid treatment to the lower surface of a gravistimulated hypocotyl. Auxin treatment to the lower surface of a gravistimulated hypocotyl did not reverse vanadate-induced inhibition, but it did partially reverse PCIB- and TIBA-induced inhibition. These results indicate a close relationship between the acid-growth theory and the differential growth responses of the sunflower hypocotyl during gravitropism. Images Fig. 2 PMID:16662991

  2. Iron deficiency differently affects peroxidase isoforms in sunflower.

    PubMed

    Ranieri, A; Castagna, A; Baldan, B; Soldatini, G F

    2001-01-01

    The response of both specific (ascorbate peroxidase, APX) and unspecific (POD) peroxidases and H(2)O(2) content of sunflower plants (Helianthus annuus L. cv. Hor) grown hydroponically with (C) or without (-Fe) iron in the nutrient solution were analysed to verify whether iron deficiency led to cell oxidative status. In -Fe leaves a significant increase of H(2)O(2) content was detected, a result confirmed by electron microscopy analysis. As regards extracellular peroxidases, while APX activity significantly decreased, no change was observed in either soluble guaiacol or syringaldazine-dependent POD activity following iron starvation. Moreover, guaiacol-dependent POD activity was found to decrease in both ionically and covalently-cell-wall bound fractions, while syringaldazine-POD activity decreased only in the covalently-bound fraction. At the intracellular level both guaiacol-POD and APX activities underwent a significant decrease. The overall reduction of peroxidase activity was confirmed by the electrophoretic separation of POD isoforms and, at the extracellular level, by cytochemical localization of peroxidases by diaminobenzidine staining. The electrophoretic separation, besides quantitative differences, also revealed quantitative changes, particularly evident for ionically and covalently-bound fractions. Therefore, in sunflower plants, iron deficiency seems to affect the different peroxidase isoenzymes to different extents and to induce a secondary oxidative stress, as indicated by the increased levels of H(2)O(2). However, owing to the almost completely lack of catalytic iron capable of triggering the Fenton reaction, iron-deficient sunflower plants are probably still sufficiently protected against oxidative stress.

  3. Proteomic analysis of oil body membrane proteins accompanying the onset of desiccation phase during sunflower seed development.

    PubMed

    Thakur, Anita; Bhatla, Satish C

    2015-01-01

    A noteworthy metabolic signature accompanying oil body (OB) biogenesis during oilseed development is associated with the modulation of the oil body membranes proteins. Present work focuses on 2-dimensional polyacrylamide gel electrophoresis (2-D PAGE)-based analysis of the temporal changes in the OB membrane proteins analyzed by LC-MS/MS accompanying the onset of desiccation (20-30 d after anthesis; DAA) in the developing seeds of sunflower (Helianthus annuus L.). Protein spots unique to 20-30 DAA stages were picked up from 2-D gels for identification and the identified proteins were categorized into 7 functional classes. These include proteins involved in energy metabolism, reactive oxygen scavenging, proteolysis and protein turnover, signaling, oleosin and oil body biogenesis-associated proteins, desiccation and cytoskeleton. At 30 DAA stage, exclusive expressions of enzymes belonging to energy metabolism, desiccation and cytoskeleton were evident which indicated an increase in the metabolic and enzymatic activity in the cells at this stage of seed development (seed filling). Increased expression of cruciferina-like protein and dehydrin at 30 DAA stage marks the onset of desiccation. The data has been analyzed and discussed to highlight desiccation stage-associated metabolic events during oilseed development. PMID:26786011

  4. Newly Emerged Populations of Plasmopara halstedii Infecting Rudbeckia Exhibit Unique Genotypic Profiles and Are Distinct from Sunflower-Infecting Strains.

    PubMed

    Rivera, Yazmín; Salgado-Salazar, Catalina; Gulya, Thomas J; Crouch, Jo Anne

    2016-07-01

    The oomycete Plasmopara halstedii emerged at the onset of the 21st century as a destructive new pathogen causing downy mildew disease of ornamental Rudbeckia fulgida (rudbeckia) in the United States. The pathogen is also a significant global problem of sunflower (Helianthus annuus) and is widely regarded as the cause of downy mildew affecting 35 Asteraceae genera. To determine whether rudbeckia and sunflower downy mildew are caused by the same genotypes, population genetic and phylogenetic analyses were performed. A draft genome assembly of a P. halstedii isolate from sunflower was generated and used to design 15 polymorphic simple sequence repeat (SSR) markers. SSRs and two sequenced phylogenetic markers measured differentiation between 232 P. halstedii samples collected from 1883 to 2014. Samples clustered into two main groups, corresponding to host origin. Sunflower-derived samples separated into eight admixed subclusters, and rudbeckia-derived samples further separated into three subclusters. Pre-epidemic rudbeckia samples clustered separately from modern strains. Despite the observed genetic distinction based on host origin, P. halstedii from rudbeckia could infect sunflower, and exhibited the virulence phenotype of race 734. These data indicate that the newly emergent pathogen populations infecting commercial rudbeckia are a different species from sunflower-infecting strains, notwithstanding cross-infectivity, and genetically distinct from pre-epidemic populations infecting native rudbeckia hosts. PMID:27003506

  5. Co-regulation of water and K(+) transport in sunflower plants during water stress recovery.

    PubMed

    Benlloch, Manuel; Benlloch-González, María

    2016-06-01

    16-day-old sunflower (Helianthus annuus L.) plants were subjected to deficit irrigation for 12 days. Following this period, plants were rehydrated for 2 days to study plant responses to post-stress recovery. The moderate water stress treatment applied reduced growth in all plant organs and the accumulation of K(+) in the shoot. After the rehydration period, the stem recovered its growth and reached a similar length to the control, an effect which was not observed in either root or leaves. Moreover, plant rehydration after water stress favored the accumulation of K(+) in the apical zone of the stem and expanding leaves. In the roots of plants under water stress, watering to field capacity, once the plants were de- topped, rapidly favored K(+) and water transport in the excised roots. This quick and short-lived response was not observed in roots of plants recovered from water stress for 2 days. These results suggest that the recovery of plant growth after water stress is related to coordinated water and K(+) transport from the root to the apical zone of the ​​stem and expanding leaves. This stimulation of K(+) transport in the root and its accumulation in the cells of the growing zones of the ​​stem must be one of the first responses induced in the plant during water stress recovery. PMID:27016874

  6. Assessing the effects of heavy metals in ACC deaminase and IAA production on plant growth-promoting bacteria.

    PubMed

    Carlos, Mendoza-Hernández José; Stefani, Perea-Vélez Yazmin; Janette, Arriola-Morales; Melani, Martínez-Simón Sara; Gabriela, Pérez-Osorio

    2016-01-01

    This study poses a methodology in order to simultaneously quantify ACC deaminase and IAA levels in the same culture medium. Ten bacterial strains isolated from plant rhizosphere naturally settled in mining residues were chosen. These bacterial strains were characterized as PGPB, and all of them showed at least three characteristics (indole-3 acetic acid and siderophore production, ACC deaminase enzyme activity, and inorganic phosphate solubilization). Taxonomic identification showed that the strains belong to Enterobacter, Serratia, Klebsiella, and Escherichia genera. Similarly, both the ACC deaminase enzyme activity and the IAA synthesis in the presence of Cu, As, Pb, Ni, Cd, and Mn were measured. The results showed that both the ACC deaminase enzyme activity and the IAA synthesis were higher with the Pb, As, and Cu treatments than with the Escherichia N16, Enterobacter K131, Enterobacter N9, and Serratia K120 control treatments. On the other hand, Ni, Cd, and Mn negatively affected both the ACC deaminase enzyme activity and the IAA production on every bacterium except on the Klebsiella Mc173 strain. Serratia K120 bacterium got a positive correlation between ACC deaminase and IAA in the presence of every heavy metal, and it also promoted Helianthus annuus plant growth, showing a potential use in phytoremediation systems.

  7. Glyphosate inhibition of ferric reductase activity in iron deficient sunflower roots.

    PubMed

    Ozturk, Levent; Yazici, Atilla; Eker, Selim; Gokmen, Ozgur; Römheld, Volker; Cakmak, Ismail

    2008-01-01

    Iron (Fe) deficiency is increasingly being observed in cropping systems with frequent glyphosate applications. A likely reason for this is that glyphosate interferes with root uptake of Fe by inhibiting ferric reductase in roots required for Fe acquisition by dicot and nongrass species. This study investigated the role of drift rates of glyphosate (0.32, 0.95 or 1.89 mm glyphosate corresponding to 1, 3 and 6% of the recommended herbicidal dose, respectively) on ferric reductase activity of sunflower (Helianthus annuus) roots grown under Fe deficiency conditions. Application of 1.89 mm glyphosate resulted in almost 50% inhibition of ferric reductase within 6 h and complete inhibition 24 h after the treatment. Even at lower rates of glyphosate (e.g. 0.32 mm and 0.95 mm), ferric reductase was inhibited. Soluble sugar concentration and the NAD(P)H oxidizing capacity of apical roots were not decreased by the glyphosate applications. To our knowledge, this is the first study reporting the effects of glyphosate on ferric reductase activity. The nature of the inhibitory effect of glyphosate on ferric reductase could not be identified. Impaired ferric reductase could be a major reason for the increasingly observed Fe deficiency in cropping systems associated with widespread glyphosate usage.

  8. Molecular mapping of a sunflower rust resistance gene from HAR6.

    PubMed

    Bulos, Mariano; Ramos, María L; Altieri, Emiliano; Sala, Carlos A

    2013-03-01

    Sunflower rust, caused by Puccinia helianthi Schw., can result in significant yield losses in cultivated sunflower (Helianthus annuus L. var. macrocarpus Ckll.). HAR6 is a germplasm population resistant to most predominant rust races. The objectives of this study were to map the resistance factor present in HAR6 (R HAR6 ), and to provide and validate molecular tools for the identification of this gene for marker assisted selection purposes. Virulence reaction of seedlings for the F2 population and F2:3 families suggested that a single dominant gene confers rust resistance in HAR6-1, a selected rust resistance line from the original population. Genetic mapping with eight markers covered 97.4 cM of genetic distance on linkage group 13 of the sunflower consensus map. A co-dominant marker ZVG61 is the closest marker distal to R HAR6 at a genetic distance of 0.7 cM, while ORS581, a dominant marker linked in the coupling phase, is proximal to R HAR6 at a genetic distance of 1.5 cM. Validation of these markers was assessed by converting a susceptible line into a rust resistant isoline by means of marker assisted backcrossing. The application of these results to assist the breeding process and to design new strategies for rust control in sunflower is discussed.

  9. Proteomic analysis of oil body membrane proteins accompanying the onset of desiccation phase during sunflower seed development

    PubMed Central

    Thakur, Anita; Bhatla, Satish C

    2015-01-01

    A noteworthy metabolic signature accompanying oil body (OB) biogenesis during oilseed development is associated with the modulation of the oil body membranes proteins. Present work focuses on 2-dimensional polyacrylamide gel electrophoresis (2-D PAGE)-based analysis of the temporal changes in the OB membrane proteins analyzed by LC-MS/MS accompanying the onset of desiccation (20–30 d after anthesis; DAA) in the developing seeds of sunflower (Helianthus annuus L.). Protein spots unique to 20–30 DAA stages were picked up from 2-D gels for identification and the identified proteins were categorized into 7 functional classes. These include proteins involved in energy metabolism, reactive oxygen scavenging, proteolysis and protein turnover, signaling, oleosin and oil body biogenesis-associated proteins, desiccation and cytoskeleton. At 30 DAA stage, exclusive expressions of enzymes belonging to energy metabolism, desiccation and cytoskeleton were evident which indicated an increase in the metabolic and enzymatic activity in the cells at this stage of seed development (seed filling). Increased expression of cruciferina-like protein and dehydrin at 30 DAA stage marks the onset of desiccation. The data has been analyzed and discussed to highlight desiccation stage-associated metabolic events during oilseed development. PMID:26786011

  10. DNA alteration and programmed cell death during ageing of sunflower seed

    PubMed Central

    El-Maarouf-Bouteau, Hayat; Mazuy, Claire; Corbineau, Françoise; Bailly, Christophe

    2011-01-01

    Sunflower (Helianthus annuus L.) seed viability is affected by moisture content (MC) during ageing and is related to accumulation of hydrogen peroxide and changes in energy metabolism. The aim of the present work was to investigate the effect of ageing on DNA alteration events by RAPD (random amplification of polymorphic DNA) analysis and to determine whether loss of seed viability might correspond to a controlled programmed cell death (PCD). Ageing of sunflower seeds was carried out at 35 °C for 7 d at different MCs. The higher the MC, the lower was the seed viability. RAPD analysis showed that DNA alterations occurred during ageing especially in seeds containing a high MC. In addition, PCD, as revealed by DNA fragmentation and TUNEL (terminal deoxynucleotide transferase-mediated dUTP nick-end labelling) assay, was detected in aged seeds at MCs which resulted in ∼50% seed viability. At the cellular level, TUNEL assay and propidium iodide staining showed that cell death concerns all the cells of the embryonic axis. The quantification of the adenylate pool highlights mitochondrial dysfunction in aged seeds containing a high MC. The involvement of oxidative burst, mitochondria dysfunction, and PCD in seed loss of viability is proposed. PMID:21765164

  11. A Novel Protocol for Detection of Nitric Oxide in Plants.

    PubMed

    Jain, Prachi; David, Anisha; Bhatla, Satish C

    2016-01-01

    Detection of nitric oxide (NO) in plant cells is mostly undertaken using diaminofluorescein (DAF) dyes. Serious drawbacks and limitations have been identified in methods using DAF as a probe for NO detection. The present work reporting an alternative fluorescent probe for NO detection is thus proposed for varied applications in plant systems for physiological investigations. This method involves a simple, two-step synthesis, characterization, and application of MNIP-Cu {Copper derivative of [4-methoxy-2-(1H-napthol[2,3-d]imidazol-2-yl)phenol]} for specific and rapid binding with NO, leading to its detection in plant cells by epifluorescence microscopy and confocal laser scanning microscopy (CLSM). Using sunflower (Helianthus annuus L.) whole seedlings, hypocotyl segments, stigmas from capitulum, protoplasts, and isolated oil bodies, present investigations demonstrate the versatile nature of MNIP-Cu in applications for NO localization studies. MNIP-Cu can detect NO in vivo without any time lag (ex. 330-385 nm; em. 420-500 nm). It exhibits fluorescence both under anoxic and oxygen-rich conditions. This probe is specific to NO, which enhances its fluorescence due to MNIP-Cu complexing with NO and treatment with PTIO leads to quenching of fluorescence. It is relatively nontoxic when used at a concentration of up to 50 μM. PMID:27094412

  12. Heliolactone, a non-sesquiterpene lactone germination stimulant for root parasitic weeds from sunflower.

    PubMed

    Ueno, Kotomi; Furumoto, Toshio; Umeda, Shuhei; Mizutani, Masaharu; Takikawa, Hirosato; Batchvarova, Rossitza; Sugimoto, Yukihiro

    2014-12-01

    Root exudates of sunflower (Helianthus annuus L.) line 2607A induced germination of seeds of root parasitic weeds Striga hermonthica, Orobanche cumana, Orobanche minor, Orobanche crenata, and Phelipanche aegyptiaca. Bioassay-guided purification led to the isolation of a germination stimulant designated as heliolactone. FT-MS analysis indicated a molecular formula of C20H24O6. Detailed NMR spectroscopic studies established a methylfuranone group, a common structural component of strigolactones connected to a methyl ester of a C14 carboxylic acid via an enol ether bridge. The cyclohexenone ring is identical to that of 3-oxo-α-ionol and the other part of the molecule corresponds to an oxidized carlactone at C-19. It is a carlactone-type molecule and functions as a germination stimulant for seeds of root parasitic weeds. Heliolactone induced seed germination of the above mentioned root parasitic weeds, while dehydrocostus lactone and costunolide, sesquiterpene lactones isolated from sunflower root exudates, were effective only on O. cumana and O. minor. Heliolactone production in aquacultures increased when sunflower seedlings were grown hydroponically in tap water and decreased on supplementation of the culture with either phosphorus or nitrogen. Costunolide, on the other hand, was detected at a higher concentration in well-nourished medium as opposed to nutrient-deficient media, thus suggesting a contrasting contribution of heliolactone and the sesquiterpene lactone to the germination of O. cumana under different soil fertility levels. PMID:25446236

  13. Physicochemical properties of honey from Marche, Central Italy: classification of unifloral and multifloral honeys by multivariate analysis.

    PubMed

    Truzzi, Cristina; Illuminati, Silvia; Annibaldia, Anna; Finale, Carolina; Rossetti, Monica; Scarponi, Giuseppe

    2014-11-01

    The purpose of this study was the physicochemical characterization and classification of Italian honey from Marche Region with a chemometric approach. A total of 135 honeys of different botanical origins [acacia (Robinia pseudoacacia L.), chestnut (Castanea sativa), coriander (Coriandrum sativum L.), lime (Tilia spp.), sunflower (Helianthus annuus L.), Metcalfa honeydew and multifloral honey] were considered. The average results of electrical conductivity (0.14-1.45 mS cm(-1)), pH (3.89-5.42), free acidity (10.9-39.0 meq(NaOH) kg(-1)), lactones (2.4-4.5 meq(NaOH) kg(-1)), total acidity (14.5-40.9 meq(NaOH) kg(-1)), proline (229-665 mg kg(-1)) and 5-(hydroxy-methyl)-2-furaldehyde (0.6-3.9 mg kg(-1)) content show wide variability among the analysed honey types, with statistically significant differences between the different honey types. Pattern recognition methods such as principal component analysis and discriminant analysis were performed in order to find a relationship between variables and types of honey and to classify honey on the basis of its physicochemical properties. The variables of electrical conductivity, acidity (free, lactones), pH and proline content exhibited higher discriminant power and provided enough information for the classification and distinction of unifloral honey types, but not for the classification of multifloral honey (100% and 85% of samples correctly classified, respectively).

  14. Cell lineage patterns in the shoot meristem of the sunflower embryo in the dry seed

    SciTech Connect

    Jegla, D.E.; Sussex, I.M.

    1989-01-01

    We mapped the fate of cells in the shoot meristem of the dry-seed embryo of sunflower, Helianthus annuus L. cv. Peredovic, using irradiation-induced somatic sectors. We analyzed 249 chlorophyll-deficient or glabrous (hairless) sectors generated in 236 plants. Most sectors observed in the inflorescence extended into vegetative nodes. Thus cell lineages that ultimately gave rise to reproductive structures also contributed to vegetative structures. No single sector extended the entire length of the shoot. Thus the shoot is not derived from one or a few apical initials. Rather, the position, vertical extent, and width of the sectors at different levels of the shoot suggest that the shoot is derived from three to four circumferential populations of cells in each of three cell layers of the embryo meristem. Sectors had no common boundaries even in plants with two or three independent sectors, but varied in extent and overlapped along the length of the shoot. Thus individual cells in a single circumferential population behaved independently to contribute lineages of different vertical extents to the growing shoot. The predicted number of circumferential populations of cells as well as the apparent cell number in each population was consistent with the actual number of cells in the embryo meristem observed in histological sections.

  15. The Response of Durum Wheat to the Preceding Crop in a Mediterranean Environment

    PubMed Central

    Ercoli, Laura; Masoni, Alessandro; Pampana, Silvia; Mariotti, Marco; Arduini, Iduna

    2014-01-01

    Crop sequence is an important management practice that may affect durum wheat (Triticum durum Desf.) production. Field research was conducted in 2007-2008 and 2008-2009 seasons in a rain-fed cold Mediterranean environment to examine the impact of the preceding crops alfalfa (Medicago sativa L.), maize (Zea mays L.), sunflower (Helianthus annuus L.), and bread wheat (Triticum aestivum L.) on yield and N uptake of four durum wheat varieties. The response of grain yield of durum wheat to the preceding crop was high in 2007-2008 and was absent in the 2008-2009 season, because of the heavy rainfall that negatively impacted establishment, vegetative growth, and grain yield of durum wheat due to waterlogging. In the first season, durum wheat grain yield was highest following alfalfa, and was 33% lower following wheat. The yield increase of durum wheat following alfalfa was mainly due to an increased number of spikes per unit area and number of kernels per spike, while the yield decrease following wheat was mainly due to a reduction of spike number per unit area. Variety growth habit and performance did not affect the response to preceding crop and varieties ranked in the order Levante > Saragolla = Svevo > Normanno. PMID:25401153

  16. Dieldrin uptake and translocation in plants growing in hydroponic medium.

    PubMed

    Murano, Hirotatsu; Otani, Takashi; Seike, Nobuyasu; Sakai, Mizuki

    2010-01-01

    It has been known that the Cucurbitaceae family takes up a large amount of persistent organic pollutants from soils and that the translocation of those compounds in cucurbits is higher than those in non-cucurbits. To understand the persistent organic pollutant uptake mechanisms of plant species, we compared the dieldrin absorption and transportation potentials of several plants in hydroponic medium. Sorghum (Sorghum vulgare Moench), sunflower (Helianthus annuus L.), soybean (Glycine max), komatsuna (Brassica rapa var. peruviridis), white-flowered gourd (Lagenaria siceraria var. hispida), cucumber (Cucumis sativus L.), and zucchini (Cucurbita pepo L.) were grown in a dieldrin-added hydroponic medium for 10 d, and then the amount of dieldrin in their shoots and roots was measured. All of the roots contained dieldrin, whereas only the cucurbits (white-flowered gourd, cucumber, and zucchini) contained considerable amounts of dieldrin in their shoots. The dieldrin uptake to the roots depended on the concentration of the n-hexane soluble components in the roots, regardless of whether the dieldrin in the roots was translocated to shoots or not. The dieldrin uptake from the solution to the roots was thought to be due to a passive response, such as adsorption on the roots. The translocation of dieldrin from the roots to the shoots was probably through the xylems. The amounts of dieldrin in the shoots per transpiration rates were higher for cucurbits than for non-cucurbits. It seems likely that cucurbits have uptake mechanisms for hydrophobic organic chemicals.

  17. Leaf anatomical and photosynthetic acclimation to cool temperature and high light in two winter versus two summer annuals.

    PubMed

    Cohu, Christopher M; Muller, Onno; Adams, William W; Demmig-Adams, Barbara

    2014-09-01

    Acclimation of foliar features to cool temperature and high light was characterized in winter (Spinacia oleracea L. cv. Giant Nobel; Arabidopsis thaliana (L.) Heynhold Col-0 and ecotypes from Sweden and Italy) versus summer (Helianthus annuus L. cv. Soraya; Cucurbita pepo L. cv. Italian Zucchini Romanesco) annuals. Significant relationships existed among leaf dry mass per area, photosynthesis, leaf thickness and palisade mesophyll thickness. While the acclimatory response of the summer annuals to cool temperature and/or high light levels was limited, the winter annuals increased the number of palisade cell layers, ranging from two layers under moderate light and warm temperature to between four and five layers under cool temperature and high light. A significant relationship was also found between palisade tissue thickness and either cross-sectional area or number of phloem cells (each normalized by vein density) in minor veins among all four species and growth regimes. The two winter annuals, but not the summer annuals, thus exhibited acclimatory adjustments of minor vein phloem to cool temperature and/or high light, with more numerous and larger phloem cells and a higher maximal photosynthesis rate. The upregulation of photosynthesis in winter annuals in response to low growth temperature may thus depend on not only (1) a greater volume of photosynthesizing palisade tissue but also (2) leaf veins containing additional phloem cells and presumably capable of exporting a greater volume of sugars from the leaves to the rest of the plant.

  18. Leaf Magnesium Alters Photosynthetic Response to Low Water Potentials in Sunflower 1

    PubMed Central

    Rao, I. Madhusudana; Sharp, Robert E.; Boyer, John S.

    1987-01-01

    We grew sunflower (Helianthus annuus L.) plants in nutrient solutions having nutritionally adequate but low or high Mg2+ concentrations and determined whether photosynthesis was effected as leaf water potentials (ψw) decreased. Leaf Mg contents were 3- to 4-fold higher in the plants grown in high Mg2+ concentrations (10 millimolar) than in those grown in low concentrations (0.25 millimolar). These contents were sufficient to support maximum growth, plant dry weight, and photosynthesis, and the plants appeared normal. As low ψw developed, photosynthesis was inhibited but moreso in high Mg leaves than in low Mg leaves. The effect was particularly apparent under conditions of light- and CO2-saturation, indicating that the chloroplast capacity to fix CO2 was altered. The differential inhibition observed in leaves of differing Mg contents was not observed in leaves having differing K contents, suggesting that the effect may have been specific for Mg. Because Mg2+ inhibits photophosphorylation and coupling factor activities at concentrations likely to occur as leaves dehydrate, Mg may play a role in the inhibition of chloroplast reactions at low ψw, especially in leaves such as sunflower that markedly decrease in water content as ψw decreases. Images Fig. 2 Fig. 6 PMID:16665587

  19. The mechanisms involved in seed dormancy alleviation by hydrogen cyanide unravel the role of reactive oxygen species as key factors of cellular signaling during germination.

    PubMed

    Oracz, Krystyna; El-Maarouf-Bouteau, Hayat; Kranner, Ilse; Bogatek, Renata; Corbineau, Françoise; Bailly, Christophe

    2009-05-01

    The physiological dormancy of sunflower (Helianthus annuus) embryos can be overcome during dry storage (after-ripening) or by applying exogenous ethylene or hydrogen cyanide (HCN) during imbibition. The aim of this work was to provide a comprehensive model, based on oxidative signaling by reactive oxygen species (ROS), for explaining the cellular mode of action of HCN in dormancy alleviation. Beneficial HCN effect on germination of dormant embryos is associated with a marked increase in hydrogen peroxide and superoxide anion generation in the embryonic axes. It is mimicked by the ROS-generating compounds methylviologen and menadione but suppressed by ROS scavengers. This increase results from an inhibition of catalase and superoxide dismutase activities and also involves activation of NADPH oxidase. However, it is not related to lipid reserve degradation or gluconeogenesis and not associated with marked changes in the cellular redox status controlled by the glutathione/glutathione disulfide couple. The expression of genes related to ROS production (NADPHox, POX, AO1, and AO2) and signaling (MAPK6, Ser/ThrPK, CaM, and PTP) is differentially affected by dormancy alleviation either during after-ripening or by HCN treatment, and the effect of cyanide on gene expression is likely to be mediated by ROS. It is also demonstrated that HCN and ROS both activate similarly ERF1, a component of the ethylene signaling pathway. We propose that ROS play a key role in the control of sunflower seed germination and are second messengers of cyanide in seed dormancy release.

  20. Visualizing the impact of living roots on rhizosphere soil structure using X-ray microtomography

    NASA Astrophysics Data System (ADS)

    Menon, M.; Berli, M.; Ghezzehei, T. A.; Nico, P.; Young, M. H.; Tyler, S. W.

    2009-04-01

    The rhizosphere is an interface between bulk soil and plant root and plays a critical role in root water and nutrient uptake. In this study, we used X-ray Computerized Microtomography (microCT) to visualize soil structure around living roots non-destructively and with high spatial resolution. Four different plant species (Helianthus annuus, Lupinus hartwegii, Vigna radiata and Phaseolus lunatus), grown in four different porous materials (glass beads, medium and coarse sand, loam aggregates), were scanned with 10 μm spatial resolution, using the microtomography beamline 8.3.2 at the Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA. Sample cross section images clearly show contacts between roots and soil particles, connecting water films, air-water interfaces as well as some cellular features of the plants taproots. We found with a simulation experiment, inflating a cylindrical micro-balloon in a pack of air-dry loam aggregates, that soil fracturing rather than compaction might occur around a taproot growing in dry soil. Form these preliminary experiments, we concluded that microCT has potential as a tool for a more process-based understanding of the role of rhizosphere soil structure on soil fertility, plant growth and the water balance at the earth-atmosphere interface.

  1. Visualizing Rhizosphere Soil Structure Around Living Roots

    NASA Astrophysics Data System (ADS)

    Menon, M.; Berli, M.; Ghezzehei, T. A.; Nico, P.; Young, M. H.; Tyler, S. W.

    2008-12-01

    The rhizosphere, a thin layer of soil (0 to 2 mm) surrounding a living root, is an important interface between bulk soil and plant root and plays a critical role in root water and nutrient uptake. In this study, we used X-ray Computerized Microtomography (microCT) to visualize soil structure around living roots non-destructively and with high spatial resolution. Four different plant species (Helianthus annuus, Lupinus hartwegii, Vigna radiata and Phaseolus lunatus), grown in four different porous materials (glass beads, medium and coarse sand, loam aggregates), were scanned with 10 ìm spatial resolution, using the microtomography beamline 8.3.2 at the Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA. Sample cross section images clearly show contacts between roots and soil particles, connecting water films, air-water interfaces as well as some cellular features of the plants taproots. We found with a simulation experiment, inflating a cylindrical micro-balloon in a pack of air-dry loam aggregates, that soil fracturing rather than compaction might occur around a taproot growing in dry soil. Form these preliminary experiments, we concluded that microCT has potential as a tool for a more process-based understanding of the role of rhizosphere soil structure on soil fertility, plant growth and the water balance at the earth-atmosphere interface.

  2. Soil-food chain-pesticide wildlife relationships in aldrin-treated fields

    USGS Publications Warehouse

    Korschgen, L.J.

    1970-01-01

    Soil-food-chain-pesticide wildlife relationships were investigated to learn the concentration of pesticide residues present in soils, macro-invertebrates, vertebrates, and seeds as a result of annual applications of aldrin at recommended rates for pest control. Two central Missouri cornfields treated witb aldrin at 1 lb/acre, for 16 and 15 of the past 17 years, were selected for study during 1965-67. Primary samples collected for residue analyses included soils, earthworms (Lumbricidae), crickets (GryIlidae), and two kinds of ground beetles (Carabidae) obtained during early April, June, August, and October. Vertebrates and plant seeds collected during 1967 included white-footed mice (Peromyscus maniculatus), toads (Bufo americanus), snakes (Thamnophis sirtalis and Pituophis sayi), corn (Zea Mays), foxtail (Setaria Faberii), and annual sunflower (Helianthus annuus). Pesticide residues consisted primarily of dieldrin, the degradation product of aldrin. Combined aldrin and dieldrin residues, as two field all-season averages, wet weight basis, were: soils, 0.31 ppm; earthworms, 1.49 ppm; crickets, 0.23 ppm; Harpalus ground beetles, 1.10 ppm; Poecilus ground beetles, 9.67 ppm; white-footed mice, 0.98 ppm; toads, 3.53 ppm; garter snakes, 12.35 ppm; and corn, foxtail, and sunflower seeds less than 0.02 ppm each. Unusually high average residues (37.48 ppm) in Poecilus beetles during June, 1967, were attributed to abnormally high soil moisture and predacious feeding habits of these insects.

  3. Synthesis of the low molecular weight heat shock proteins in plants

    SciTech Connect

    Mansfield, M.A.; Key, J.L. )

    1987-08-01

    Heat shock of living tissue induces the synthesis of a unique group of proteins, the heat shock proteins. In plants, the major group of heat shock proteins has a molecular mass of 15 to 25 kilodaltons. Accumulation to these proteins to stainable levels has been reported in only a few species. To examine accumulation of the low molecular weight heat shock proteins in a broader range of species, two-dimensional electrophoresis was used to resolve total protein from the following species: soybean (Glycine max L. Merr., var Wayne), pea (Pisum sativum L., var Early Alaska), sunflower (Helianthus annuus L.), wheat (Triticum asetivum L.), rice (Oryza sativa L., cv IR-36), maize (Zea mays L.), pearl millet (Pennisetum americanum L. Leeke, line 23DB), and Panicum miliaceum L. When identified by both silver staining and incorporation of radiolabel, a diverse array of low molecular weight heat shock proteins was synthesized in each of these species. These proteins accumulated to significant levels after three hours of heat shock but exhibited considerable heterogeneity in isoelectric point, molecular weight, stainability, and radiolabel incorporation. Although most appeared to be synthesized only during heat shock, some were detectable at low levels in control tissue. Compared to the monocots, a higher proportion of low molecular weight heat shock proteins was detectable in control tissues from dicots.

  4. Residual nutational activity of the sunflower hypocotyl in simulated weightlessness

    NASA Technical Reports Server (NTRS)

    Chapman, D. K.; Brown, A. H.

    1979-01-01

    The gravity dependence of circumnutational activity in the sunflower hypocotyl is investigated under conditions of simulated weightlessness. Seedling cultures of the sunflower Helianthus annuus were placed four days after planting in clinostats rotating at a rate of 1.0 rpm in the horizontal or somersaulting configurations, and plant movements around their growth axes were recorded in infrared light by a time-lapse closed-circuit video system. The amplitudes and mean cycle durations of the plant nutations in the horizontal and tumbling clinostats are observed to be 20% and 72%, and 32% and 74%, respectively, of the values observed in stationary plants; extrapolations to a state of zero g by the imposition of small centripetal forces on horizontally clinostated plants also indicate some nutational motion in the absence of gravity. It is concluded that the results are incompatible with the model of Israelsson and Johnsson (1967) of geotropic response with overshoot for sunflower circumnutation; however, results of the Spacelab 1 mission experiment are needed to unambiguously define the role of gravitation.

  5. Reconciling extremely strong barriers with high levels of gene exchange in annual sunflowers.

    PubMed

    Sambatti, Julianno B M; Strasburg, Jared L; Ortiz-Barrientos, Daniel; Baack, Eric J; Rieseberg, Loren H

    2012-05-01

    In several cases, estimates of gene flow between species appear to be higher than we might predict given the strength of interspecific barriers separating these species pairs. However, as far as we are aware, detailed measurements of reproductive isolation have not previously been compared with a coalescent-based assessment of gene flow. Here, we contrast these two measures in two species of sunflower, Helianthus annuus and H. petiolaris. We quantified the total reproductive barrier strength between these species by compounding the contributions of the following prezygotic and postzygotic barriers: ecogeographic isolation, reproductive asynchrony, niche differentiation, pollen competition, hybrid seed formation, hybrid seed germination, hybrid fertility, and extrinsic postzygotic isolation. From this estimate, we calculated the probability that a reproductively successful hybrid is produced: estimates of P(hyb) range from 10(-4) to 10(-6) depending on the direction of the cross and the degree of independence among reproductive barriers. We then compared this probability with population genetic estimates of the per generation migration rate (m). We showed that the relatively high levels of gene flow estimated between these sunflower species (N(e) m= 0.34-0.76) are mainly due to their large effective population sizes (N(e) > 10(6)). The interspecific migration rate (m) is very small (<10(-7)) and an order of magnitude lower than that expected based on our reproductive barrier strength estimates. Thus, even high levels of reproductive isolation (>0.999) may produce genomic mosaics.

  6. Whole plant senescence of sunflower following seedhead removal

    SciTech Connect

    Ho, InSun; Below, F.E. )

    1989-09-01

    This study was undertaken to further clarify the relationship between seed development and monocarpic senescence of sunflower (Helianthus annuus L.). Field-grown plants with and without seedheads were evaluated for rate and duration of accumulation of dry weight, reduced N, and P by whole shoots, and for partitioning of these constituents within the individual plant parts. Concurrent with seedhead removal, ({sup 15}N)nitrate was applied to the plants in a selected are of the experimental plot. Whole plants (above ground portions) were harvested seven times during the seed-filling period and analyzed from dry weight, reduced N, and P. Although seedhead removal depressed the rates of dry weight, reduced N, and P accumulation by whole shoots, it extended the duration of accumulation of these constituents, relative to headed control plants. As a result, the final whole shoot dry weight and N and P contents at seed maturity were similar for deheaded and headed plants. Seedhead removal also affected the partitioning of dry matter, reduced N, and P but the relative proportions varied as a function of constituent and growth stage. Analysis of {sup 15}N present in whole shoots at physiological maturity showed that similar amounts of nitrate were absorbed during the postflowering period by headed and deheaded plants. These data indicate that the absence of seeds does not affect the total accumulation of dry matter, reduced N, or P, by sunflower plants, but does alter the rates of accumulation and partitioning of these constituents.

  7. Evaluation of aluminum indices to predict aluminum toxicity to plants grown in nutrient solutions

    SciTech Connect

    Alva, A.K.; Blamey, F.P.C.; Edwards, D.G.; Asher, C.J.

    1986-01-01

    Difficulty has been experienced in establishing a suitable aluminum (Al) index to predict Al toxicity to plants grown in nutrient solutions with a wide range of properties. In the present study, relationships were evaluated between root length and (i) concentration of total Al, (ii) concentration of monomeric Al, and (iii) the sum of the activities of monomeric Al species (..sigma..a/sub Al mono/) in solution. Results are reported for soybean (Glycine max (L.) Merr.), subterranean clover (Trifolium subterraneum L.), alfalfa (Medicago sativa L.), and sunflower (Helianthus annuus L.). Total Al concentration in solution, comprising polymeric and monomeric Al species, was a poor index of Al toxicity, confirming the hypothesis that only monomeric Al is toxic to root growth. In solutions with widely differing composition, the concentration of monomeric Al also proved unsatisfactory due to ionic strength effects on the activities of monomeric Al species. ..sigma..a/sub Al mono/ was the best index of Al toxicity, accounting for 72 to 92% of the variation in root length depending on the plant species. Root length was reduced by 50% at ..sigma..a/sub Al mono/ of 7-16 ..mu..M in soybean, 13 ..mu..M in subterranean clover and alfalfa, and 11 ..mu..M in sunflower.

  8. Effects of increased gravity force on nutations of sunflower hypocotyls

    NASA Technical Reports Server (NTRS)

    Brown, A. H.; Chapman, D. K.

    1977-01-01

    A centrifuge was used to provide sustained acceleration in order to study the hypocotyl nutation of 6-day-old Helianthus annuus L. over a range of g-forces, up to 20 times normal g. At the upper end of this g-range, nutation was impeded and at times was erratic evidently because the weight of the cotyledons exceeded the supportive abilities of the hypocotyls. Over the range 1 to 9 g, the period of nutation was independent of the resultant force vector. Over the same g-range, the amplitude of nutation was nearly independent of the chronic g-force. If nutation in sunflower seedlings is an oscillation caused by a succession of geotropic responses which continue to overshoot the equilibrium position (plumb line), its amplitude might be expected to be more sensitive to changes in magnitude of the sustained g-force. In order to preserve the geotropic model, in which nutation is considered to be a sustained oscillation driven by geotropic reactions, it is necessary to assume that geotropic response must increase with increasing g most rapidly in the region of the g-parameter below the terrestrial value of 1 g.

  9. Toluene emissions from plants

    NASA Astrophysics Data System (ADS)

    Heiden, A. C.; Kobel, K.; Komenda, M.; Koppmann, R.; Shao, M.; Wildt, J.

    The emission of toluene from different plants was observed in continuously stirred tank reactors and in field measurements. For plants growing without stress, emission rates were low and ranged from the detection limit up to 2·10-16 mol·cm-2·s-1. Under conditions of stress, the emission rates exceeded 10-14 mol·cm-2·s-1. Exposure of sunflower (Helianthus annuus L. cv. Gigantheus) to 13CO2 resulted in 13C-labeling of the emitted toluene on a time scale of hours. Although no biochemical pathway for the production of toluene is known, these results indicate that toluene is synthesized by the plants. The emission rates of toluene from sunflower are dependent on nutrient supply and wounding. Since α-pinene emission rates are also influenced by these factors, toluene and α-pinene emissions show a high correlation. During pathogen attack on Scots pines (Pinus sylvestris L.) significant toluene emissions were observed. In this case emissions of toluene and α-pinene also show a good correlation. Toluene emissions were also found in field experiments with pines using branch enclosures.

  10. Acclimation of photosynthesis to low leaf water potentials

    SciTech Connect

    Matthews, M.A.; Boyer, J.S.

    1984-01-01

    Photosynthesis is reduced at low leaf water potentials (PSI/sub l/) but repeated water deficits can decrease this reduction, resulting in photosynthetic acclimation. The contribution of the stomata and the chloroplasts to this acclimation is unknown. The authors evaluated stomatal and chloroplast contributions when soil-grown sunflower (Helianthus annuus L.) plants were subjected to water deficit pretreatments for 2 weeks. The relationship between photosynthesis and PSI/sub l/, determined from gas-exchange and isopiestic thermocouple psychometry, was shifted 3 to 4 bars towards lower PSI/sub l/ in pretreated plants. Leaf diffusive resistance was similarly affected. Chloroplast activity, demonstrated in situ with measurements of quantum yield and the capacity to fix CO/sub 2/ at all partial pressures of CO/sub 2/, and in vitro by photosystem II activity of isolated organelles, was inhibited at low PSI/sub l/ but less in pretreated plants than in control plants. The magnitude of this inhibition indicated that decreases in chloroplast activity contributed more than closure of stomata both to losses in photosynthesis and to the acclimation of photosynthesis to low PSI/sub l/. 32 references, 8 figures.

  11. Physiological and proteome study of sunflowers exposed to a polymetallic constraint.

    PubMed

    Printz, Bruno; Sergeant, Kjell; Guignard, Cedric; Renaut, Jenny; Hausman, Jean-Francois

    2013-06-01

    The new energy requirements of the growing world population together with the actual ecological trend of phytoremediation have made challenging the cultivation of energetic crops on nonagricultural lands, such as those contaminated with trace elements. In this study, phenotypical characterization and biochemical analyses were combined to emphasize the global response of young sunflowers (Helianthus annuus L.) grown in hydroponic media contaminated with different Cd, Ni, and Zn concentrations. Leaves and roots of sunflowers reaching the stage "2-extended leaves" and exposed to different trace metal concentrations were harvested and analyzed by 2D-DIGE in order to study in depth the molecular responses of the young plants upon the polymetallic exposure. Proteomics confirmed the observed global reduction in growth and development. If photosynthetic light reactions and carbon metabolism were the most affected in leaves, in roots significant disruptions were observed in proteins involved in respiration, oxidative balance, protein and gene expression, and in the induction of programmed cell death. Elemental analyses of the plantlets indicated a profound impact of the treatment resulting in misbalance in essential micronutrients. Altogether, this study highlights the sensitivity of the sunflower to a polymetallic pollution and indicates that its use as a remediative tool of trace element polluted soils is limited.

  12. Thiamethoxam Seed Treatments Have No Impact on Pest Numbers or Yield in Cultivated Sunflowers.

    PubMed

    Bredeson, Michael M; Lundgren, Jonathan G

    2015-12-01

    The use of neonicotinoid seed treatments is a nearly ubiquitous practice in sunflower (Helianthus annuus) pest management. Sunflowers have a speciose pest complex, but also harbor a diverse and abundant community of beneficial, nontarget organisms which may be negatively affected by pest management practices. Here, we investigate how the foliar and subterranean arthropod pest communities in sunflower fields were affected by a thiamethoxam seed treatment over three site years (two years on one farm, and another year at an additional field in the second year). Thiamethoxam and its metabolite clothianidin in leaf tissue were quantified throughout the growing season, and yield differences between treatments were measured. Across site years, foliar herbivores and key pests of sunflowers were unaffected by the seed treatment. Likewise, subterranean herbivores were unaffected. Thiamethoxam was measurable in leaf tissue through the R1 plant stage, while its metabolite clothianidin was detected throughout flowering (R6). No difference in sunflower yield was observed between treatments across site years. This research suggests that neonicotinoid seed treatments in sunflowers do not always provide economic benefits to farmers in the form of pest reductions or yield improvements. Future research should focus on sunflower integrated pest management strategies that limit nontarget effects of agrochemicals, while providing greater economic returns to farmers.

  13. Circumnutations of sunflower hypocotyls in satellite orbit

    NASA Technical Reports Server (NTRS)

    Brown, A. H.; Chapman, D. K.; Lewis, R. F.; Venditti, A. L.

    1990-01-01

    The principal objective of the research reported here was to determine whether a plant's periodic growth oscillations, called circumnutations, would persist in the absence of a significant gravitational or inertial force. The definitive experiment was made possible by access to the condition of protracted near weightlessness in an earth satellite. The experiment, performed during the first flight of Spacelab on the National Aeronautics and Space Administration shuttle, Columbia, in November and December, 1983, tested a biophysical model, proposed in 1967, that might account for circumnutation as a gravity-dependent growth response. However, circumnutations were observed in microgravity. They continued for many hours without stimulation by a significant g-force. Therefore, neither a gravitational nor an inertial g-force was an absolute requirement for initiation [correction of initation] or continuation of circumnutation. On average, circumnutation was significantly more vigorous in satellite orbit than on earth-based clinostats. Therefore, at least for sunflower (Helianthus annuus L.) circumnutation, clinostatting is not the functional equivalent of weightlessness.

  14. Leaf magnesium alters photosynthetic response of low water potentials in sunflower

    SciTech Connect

    Rao, I.M.; Sharp, R.E.; Boyer, J.S. )

    1987-08-01

    We grew sunflower (Helianthus annuus L.) plants in nutrient solutions having nutritionally adequate but low or high Mg{sup 2+} concentrations and determined whether photosynthesis was effected as leaf water potentials ({psi}{sub w}) decreased. Leaf Mg contents were 3- to 4-fold higher in the plants grown in high Mg{sup 2+} concentrations (10 millimolar) than in those grown in low concentrations (0.25 millimolar). These contents were sufficient to support maximum growth, plant dry weight, and photosynthesis, and the plants appeared normal. As low {psi}{sub w} developed, photosynthesis was inhibited but more so in high Mg leaves than in low Mg leaves. The effect was particularly apparent under conditions of light- and CO{sub 2}-saturation, indicating that the chloroplast capacity to fix CO{sub 2} was altered. The differential inhibition observed in leaves of differing Mg contents was not observed in leaves having differing K contents, suggesting that the effect may have been specific for Mg. Because Mg{sup 2+} inhibits photophosphorylation and coupling factor activities at concentrations likely to occur as leaves dehydrate, Mg may play a role in the inhibition of chloroplast reactions at low {psi}{sub w}, especially in leaves such as sunflower that markedly decrease in water content as {psi}{sub w} decreases.

  15. Isotopic inhomogeneity of leaf water: Evidence and implications for the use of isotopic signals transduced by plants

    NASA Astrophysics Data System (ADS)

    Yakir, Dan; DeNiro, Michael J.; Rundel, Philip W.

    1989-10-01

    Variations as large as 11%. in δ18O values and 50%. in δD values were observed among different fractions of water in leaves of ivy (Hedera helix) and sunflower (Helianthus annuus). This observation contradicts previous experimental approaches to leaf water as an isotopically uniform pool. Using ion analysis of the water fractions to identify sources within the leaf, we conclude that the isotopic composition of the water within cells, which is involved in biosynthesis and therefore recorded in the plant organic matter, differs substantially from that of total leaf water. This conclusion must be taken into account in studies in which isotope ratios of fossil plant cellulose are interpreted in paleoclimatic terms. In addition, our results have implications for attempts to explain the Dole effect and to account for the variations of 18O/16O ratios in atmospheric carbon dioxide, since the isotopic composition of cell water, not of total leaf water, influences theδ18O values of O2 and CO2 released from plants into the atmosphere.

  16. Influence of the g-force on the circumnutations of sunflower hypocotyls

    NASA Technical Reports Server (NTRS)

    Zachariassen, E.; Johnsson, A.; Brown, A. H.; Chapman, D. K.; Johnson-Glebe, C.

    1987-01-01

    Circumnutations of hypocotyls of sunflower (Helianthus annuus L. cv. Californicus) were studied under 1 g and 3 g conditions. Root mean square values of the hypocotyl deviation from the plumbline and period of the movements were determined from calculations of the autocorrelation functions of the movements. The amplitude and the period of the circumnutations increased under 3 g as compared to 1 g. A transition from 3 to 1 g or vice versa also caused changes in period and amplitude of the movements. The results are interpreted as a support for the idea that gravity influences the circumnutation parameters in this sunflower variety. A comparison is made with published results on the dwarf sunflower cv. Teddy Bear where the force influence is very small or negligible. Simulations of a model for circumnutations show movements which are in qualitative agreement with the experimental results, provided adaptation to g-levels is included in the model. Finally, the results are discussed with the recent Spacelab-experiment (SL1) as a background.

  17. Effect of multiple metal resistant bacteria from contaminated lake sediments on metal accumulation and plant growth.

    PubMed

    Li, Kefeng; Ramakrishna, Wusirika

    2011-05-15

    Naturally occurring bacteria play an important role in bioremediation of heavy metal pollutants in soil and wastewater. This study identified high levels of resistance to zinc, cesium, lead, arsenate and mercury in eight copper resistant Pseudomonas strains previously isolated from Torch Lake sediment. These strains showed variable susceptibility to different antibiotics. Furthermore, these metal resistant strains were capable of bioaccumulation of multiple metals and solubilization of copper. Bacterial strains TLC 3-3.5-1 and TLC 6-6.5-1 showed high bioaccumulation ability of Zn (up to 15.9 mg/g dry cell) and Pb (80.7 mg/g dry cell), respectively. All the strains produced plant growth promoting indole-3-acetic acid (IAA), iron chelating siderophore and solubilized mineral phosphate and metals. The effect of bacterial inoculation on plant growth and copper uptake by maize (Zea mays) and sunflower (Helianthus annuus) was investigated using one of the isolates (Pseudomonas sp. TLC 6-6.5-4) with higher IAA production and phosphate and metal solubilization, which resulted in a significant increase in copper accumulation in maize and sunflower, and an increase in the total biomass of maize. The multiple metal-resistant bacterial isolates characterized in our study have potential applications for remediation of metal contaminated soils in combination with plants and metal contaminated water. PMID:21420236

  18. Dynamics of three organic acids (malic, acetic and succinic acid) in sunflower exposed to cadmium and lead.

    PubMed

    Niu, Zhixin; Li, Xiaodong; Sun, Lina; Sun, Tieheng

    2013-01-01

    Sunflower (Helianthus annuus L.) has been considered as a good candidate for bioaccumulation of heavy metals. In the present study, sunflower was used to enrich the cadmium and lead in sand culture during 90 days. Biomass, Cd and Pb uptake, three organic acids and pH in cultures were investigated. Results showed that the existence of Cd and Pb showed different interactions on the organic acids exudation. In single Cd treatments, malic and acetic acids in Cd10 showed an incremental tendency with time. In the mixed treatments of Cd and Pb, malic acids increased when 10 and 40 mg x L(-1) Cd were added into Pb50, but acetic acids in Pb50 were inhibited by Cd addition. The Cd10 supplied in Pb10 stimulated the secretion of malic and succinic acids. Moreover, the Cd or Pb uptake in sunflower showed various correlations with pH and some organic acids, which might be due to the fact that the Cd and Pb interfere with the organic acids secretion in rhizosphere of sunflower, and the changes of organic acids altered the form and bioavailability of Cd and Pb in cultures conversely.

  19. Characterization and modelling of the hydrophobic domain of a sunflower oleosin.

    PubMed

    Alexander, Lucille G; Sessions, Richard B; Clarke, Anthony R; Tatham, Arthur S; Shewry, Peter R; Napier, Johnathan A

    2002-02-01

    The oleosins are a group of hydrophobic proteins present on the surface of oil bodies in seeds, where they are thought to prevent coalescence. They contain a central hydrophobic domain of 68-74 residues that is thought to form a loop into the triacylglycerol matrix of the oil body, but the conformation adopted by this sequence is uncertain. We have therefore expressed an oleosin cDNA from sunflower (Helianthus annuus L.) in Escherichia coli as a fusion with maltose-binding protein (MBP) and isolated a peptide corresponding to the hydrophobic domain by sequential digestion with factor Xa (to remove the MBP) followed by trypsin and Staphylococcus V8 protease to remove the N- and C-terminal domains of the oleosin. Circular dichroism spectroscopy of the peptide in two solvent systems chosen to mimic the environment within the oil body (trifluoroethanol and SDS) demonstrated high proportions of alpha-helical structure, with no beta-sheet. A model was therefore developed in which the domain forms an alpha-helical hairpin structure, the two helices being separated by a turn region. We consider that this model is consistent with our current knowledge of oleosin structure and properties.

  20. Drought-Induced Increases in Abscisic Acid Levels in the Root Apex of Sunflower 1

    PubMed Central

    Robertson, J. Mason; Pharis, Richard P.; Huang, Yan Y.; Reid, David M.; Yeung, Edward C.

    1985-01-01

    Abscisic acid (ABA) levels in 3-mm apical root segments of slowly droughted sunflower plants (Helianthus annuus L. cv Russian Giant) were analyzed as the methyl ester by selected ion monitoring gas chromatography-mass spectrometry using characteristic ions. An internal standard, hexadeuterated ABA (d6ABA) was used for quantitative analysis. Sunflower seedlings, grown in aeroponic chambers, were slowly droughted over a 7-day period. Drought stress increased ABA levels in the root tips at 24, 72, and 168 hour sample times. Control plants had 57 to 106 nanograms per gram ABA dry weight in the root tips (leaf water potential, −0.35 to −0.42 megapascals). The greatest increase in ABA, about 20-fold, was found after 72 hours of drought (leaf water potential, −1.34 to −1.47 megapascals). Levels of ABA also increased (about 7− to 54-fold) in 3-mm apical root segments which were excised and then allowed to dessicate for 1 hour at room temperature. PMID:16664535

  1. Xanthium italicum, Xanthium strumarium and Arctium lappa as new hosts for Diaporthe helianthi.

    PubMed

    Vrandecic, Karolina; Jurkovic, Drazenka; Riccioni, Luca; Cosic, Jasenka; Duvnjak, Tomislav

    2010-07-01

    Sunflower (Helianthus annuus) stem canker caused by Diaporthe helianthi is one of the most important sunflower diseases in Croatia. Until recently, sunflower was the only known host for D. helianthi. In our research carried out in the area of Eastern Croatia, isolates of Diaporthe/Phomospis were collected from Xanthium italicum, X. strumarium and Arctium lappa. Using morphological, cultural and molecular ITS rDNA data, isolates from these weeds were identified as D. helianthi. The following isolates were used in the pathogenicity test: one isolate originated from sunflower (Su5/04), three from X. italicum (Xa2, Xa3 and Xa5), two from X. strumarium (Xa9 and Xa12), one from Xanthium sp. (Xa13) and one from A. lappa (Ar3). According to the results, it was determined that isolate Xa5 (originated from X. italicum) was the most pathogenic to sunflower stems. The average length of the lesion was 11.3 cm. The lowest level of pathogenicity was found in Xa9 (isolated from X. strumarium). The length of the lesion was 0.1 cm.

  2. Simulating sunflower canopy temperatures to infer root-zone soil water potential

    NASA Technical Reports Server (NTRS)

    Choudhury, B. J.; Idso, S. B.

    1983-01-01

    A soil-plant-atmosphere model for sunflower (Helianthus annuus L.), together with clear sky weather data for several days, is used to study the relationship between canopy temperature and root-zone soil water potential. Considering the empirical dependence of stomatal resistance on insolation, air temperature and leaf water potential, a continuity equation for water flux in the soil-plant-atmosphere system is solved for the leaf water potential. The transpirational flux is calculated using Monteith's combination equation, while the canopy temperature is calculated from the energy balance equation. The simulation shows that, at high soil water potentials, canopy temperature is determined primarily by air and dew point temperatures. These results agree with an empirically derived linear regression equation relating canopy-air temperature differential to air vapor pressure deficit. The model predictions of leaf water potential are also in agreement with observations, indicating that measurements of canopy temperature together with a knowledge of air and dew point temperatures can provide a reliable estimate of the root-zone soil water potential.

  3. Increasing leaf hydraulic conductance with transpiration rate minimizes the water potential drawdown from stem to leaf.

    PubMed

    Simonin, Kevin A; Burns, Emily; Choat, Brendan; Barbour, Margaret M; Dawson, Todd E; Franks, Peter J

    2015-03-01

    Leaf hydraulic conductance (k leaf) is a central element in the regulation of leaf water balance but the properties of k leaf remain uncertain. Here, the evidence for the following two models for k leaf in well-hydrated plants is evaluated: (i) k leaf is constant or (ii) k leaf increases as transpiration rate (E) increases. The difference between stem and leaf water potential (ΔΨstem-leaf), stomatal conductance (g s), k leaf, and E over a diurnal cycle for three angiosperm and gymnosperm tree species growing in a common garden, and for Helianthus annuus plants grown under sub-ambient, ambient, and elevated atmospheric CO₂ concentration were evaluated. Results show that for well-watered plants k leaf is positively dependent on E. Here, this property is termed the dynamic conductance, k leaf(E), which incorporates the inherent k leaf at zero E, which is distinguished as the static conductance, k leaf(0). Growth under different CO₂ concentrations maintained the same relationship between k leaf and E, resulting in similar k leaf(0), while operating along different regions of the curve owing to the influence of CO₂ on g s. The positive relationship between k leaf and E minimized variation in ΔΨstem-leaf. This enables leaves to minimize variation in Ψleaf and maximize g s and CO₂ assimilation rate over the diurnal course of evaporative demand.

  4. Phytoremediation of carbamazepine and its metabolite 10,11-epoxycarbamazepine by C3 and C4 plants.

    PubMed

    Ryšlavá, Helena; Pomeislová, Alice; Pšondrová, Šárka; Hýsková, Veronika; Smrček, Stanislav

    2015-12-01

    The anticonvulsant drug carbamazepine is considered as an indicator of sewage water pollution: however, its uptake by plants and effect on metabolism have not been sufficiently documented, let alone its metabolite (10,11-epoxycarbamazepine). In a model system of sterile, hydroponically cultivated Zea mays (as C4 plant) and Helianthus annuus (as C3 plant), the uptake and effect of carbamazepine and 10,11-epoxycarbamazepine were studied in comparison with those of acetaminophen and ibuprofen. Ibuprofen and acetaminophen were effectively extracted from drug-supplemented media by both plants, while the uptake of more hydrophobic carbamazepine was much lower. On the other hand, the carbamazepine metabolite, 10,11-epoxycarbamazepine, was, unlike sunflower, willingly taken up by maize plants (after 96 h 88 % of the initial concentration) and effectively stored in maize tissues. In addition, the effect of the studied pharmaceuticals on the plant metabolism (enzymes of Hatch-Slack cycle, peroxidases) was followed. The activity of bound peroxidases, which could cause xylem vessel lignification and reduction of xenobiotic uptake, was at the level of control plants in maize leaves contrary to sunflower. Therefore, our results indicate that maize has the potential to remove 10,11-epoxycarbamazepine from contaminated soils. PMID:26310701

  5. Effect of microbial inoculation and EDTA on the uptake and translocation of heavy metal by corn and sunflower.

    PubMed

    Usman, Adel Rabie Ahmed; Mohamed, Hashem M

    2009-08-01

    A greenhouse experiment was carried out to study the effect of microbial inoculation and EDTA as synthetic chelator on heavy metals (Zn, Cu, Pb and Cd) uptake into and translocation within corn (Zea mays) and sunflower (Helianthus annuus) grown on contaminated soil. Four treatments were included: the control, EDTA as synthetic chelator, inoculation with arbuscular mycorrhizal fungi (AMF), and the inoculation with yeast. Microbial inoculation increased biomass of both species of agricultural crop plants, but EDTA addition decreased only biomass of sunflower. The results also showed that EDTA was more effective than microbial inoculation at increasing the concentrations of all metals in plants. Generally, there were significant differences among the treatments in the most metals taken up, especially by corn plants, with an order: AM fungi>yeast>EDTA>control except for Pb. It was found that the efficiency of EDTA in increasing Pb uptake was significantly higher than that of microbial inoculation treatments. The most effective treatments to stimulate the translocation of the studied metals from roots to shoots were EDTA and/or AM fungi. Overall, the maximum metal uptake and phytoextraction efficiencies were pronounced for corn either with AM fungi treatment for Zn, Cu and Cd or after EDTA addition for Pb. However, heavy metals uptake was not high enough to achieve extraction rates which would be necessary for practical use. PMID:19524998

  6. Integrated micro-biochemical approach for phytoremediation of cadmium and zinc contaminated soils.

    PubMed

    Mani, Dinesh; Kumar, Chitranjan; Patel, Niraj Kumar

    2015-01-01

    The integrated potential of oilcake manure (OM), elemental sulphur (S(0)), Glomus fasciculatum and Pseudomonas putida by growing Helianthus annuus L for phytoremediation of cadmium and zinc contaminated soils was investigated under pot experiment. The integrated treatment (2.5 g kg(-1) OM, 0.8 g kg(-1) S(0) and co-inoculation with G. fasciculatum and P. putida promoted the dry biomass of the plant. The treatment was feasible for enhanced cadmium accumulation up to 6.56 and 5.25 mg kg(-1) and zinc accumulation up to 45.46 and 32.56 mg kg(-1) in root and shoot, respectively, which caused maximum remediation efficiency (0.73 percent and 0.25 percent) and bioaccumulation factor (2.39 and 0.83) for Cd and Zn, respectively showing feasible uptake (in mg kg(-1) dry biomass) of Cd (5.55) and Zn (35.51) at the contaminated site. Thus, authors conclude to integrate oilcake manure, S(0) and microbial co-inoculation for enhanced clean-up of cadmium and zinc-contaminated soils. PMID:25450919

  7. Leaching and utilization of nitrogen during a spring wheat catch crop succession.

    PubMed

    Herrera, Juan M; Liedgens, Markus

    2009-01-01

    An experiment covering a 2-yr spring wheat (Triticum aestivum L.) catch crop succession was conducted in lysimeters to account for the losses of N due to leaching. We sought to relate these losses to the N uptake of the main crop and to integrate the estimated N loss and uptake into a balance. The non-winter hardy catch crops [yellow mustard (Sinapis alba L.), Phacelia (Phacelia tanacetifolia Benth), and sunflower (Helianthus annuus L.)] as well as bare soil fallow were studied at low and high N input levels of 4 and 29 g N m(-2) yr(-1), respectively. Catch crops allowed for an effective reduction of N leaching of 0.33 to 1.67 g N m(-2) yr(-1) compared to fallow. Reductions in N leaching were achieved mainly by avoiding the fallow period during autumn and winter while the catch crop species grown had little impact. During the spring wheat growing season, N leaching losses were highest after yellow mustard, the most effective catch crop for the entire crop succession. A balance of N indicated that the reductions in N leaching exerted by the catch crops did not result in a higher overall utilization of N by spring wheat. Thus, the efficacy shown by catch crops in reducing N leaching during growth is relatively lower when considering the entire crop succession. In addition, the N saved by growing catch crops does not increase N utilization by succeeding spring wheat. PMID:19465716

  8. Production of an endoinulinase from Aspergillus niger AUMC 9375, by solid state fermentation of agricultural wastes, with purification and characterization of the free and immobilized enzyme.

    PubMed

    Housseiny, Manal M

    2014-05-01

    Two different substrates, sunflower (Helianthus annuus L.) tubers and lettuce (Lactuca sativa) roots, were tested. Using a mixture of both wastes resulted in higher production of endoinulinase than either waste alone. Also, ten fungal species grown on these substrates as inexpensive, carbon sources were screened for the best production of endoinulinase activities. Of these, Aspergillus niger AUMC 9375 was the most productive, when grown on the mixture using a 6:1 w/w ratio of sun flower: lettuce, and yielded the highest levels of inulinase at 50% moisture, 30°C, pH 5.0, with seven days of incubation, and with yeast extract as the best nitrogen source. Inulinase was purified to homogeneity by ion-exchange chromatography and gel-filtration giving a 51.11 fold purification. The mixture of sunflower tubers and lettuce roots has potential to be an effective and economical substrate for inulinase production. Inulinase was successfully immobilized with an immobilization yield of 71.28%. After incubation for 2 h at 60°C, the free enzyme activity decreased markedly to 10%, whereas that of the immobilized form decreased only to 87%. A reusability test demonstrated the durability of the immobilized inulinase for 10 cycles and in addition, that it could be stored for 32 days at 4°C. These results indicate that this inulinase, in the immobilized form, is a potential candidate for large-scale production of high purity fructose syrups. PMID:24810318

  9. Shrinkage and growth compensation in common sunflowers: refining estimates of damage

    USGS Publications Warehouse

    Sedgwick, James A.; Oldemeye, John L.; Swenson, Elizabeth L.

    1986-01-01

    Shrinkage and growth compensation of artificially damaged common sunflowers (Helianthus annuus) were studied in central North Dakota during 1981-1982 in an effort to increase accuracy of estimates of blackbird damage to sunflowers. In both years, as plants matured damaged areas on seedheads shrank at a greater rate than the sunflower heads themselves. This differential shrinkage resulted in an underestimation of the area damaged. Sunflower head and damaged-area shrinkage varied widely by time and degree of damage and by size of the seedhead damaged. Because variation in shrinkage by time of damage was so large, predicting when blackbird damage occurs may be the most important factor in estimating seed loss. Yield'occupied seed area was greater (P < 0.05) for damaged than undamaged heads and tended to increase as degree of damage inflicted increased, indicating growth compensation was occurring in response to lost seeds. Yields of undamaged seeds in seedheads damaged during early seed development were higher than those of heads damaged later. This suggested that there was a period of maximal response to damage when plants were best able to redirect growth to seeds remaining in the head. Sunflowers appear to be able to compensate for damage of ≤ 15% of the total hear area. Estimates of damage can be improved by applying empirical results of differential shrinkage and growth compensations.

  10. Increasing leaf hydraulic conductance with transpiration rate minimizes the water potential drawdown from stem to leaf

    PubMed Central

    Simonin, Kevin A.; Burns, Emily; Choat, Brendan; Barbour, Margaret M.; Dawson, Todd E.; Franks, Peter J.

    2015-01-01

    Leaf hydraulic conductance (k leaf) is a central element in the regulation of leaf water balance but the properties of k leaf remain uncertain. Here, the evidence for the following two models for k leaf in well-hydrated plants is evaluated: (i) k leaf is constant or (ii) k leaf increases as transpiration rate (E) increases. The difference between stem and leaf water potential (ΔΨstem–leaf), stomatal conductance (g s), k leaf, and E over a diurnal cycle for three angiosperm and gymnosperm tree species growing in a common garden, and for Helianthus annuus plants grown under sub-ambient, ambient, and elevated atmospheric CO2 concentration were evaluated. Results show that for well-watered plants k leaf is positively dependent on E. Here, this property is termed the dynamic conductance, k leaf(E), which incorporates the inherent k leaf at zero E, which is distinguished as the static conductance, k leaf(0). Growth under different CO2 concentrations maintained the same relationship between k leaf and E, resulting in similar k leaf(0), while operating along different regions of the curve owing to the influence of CO2 on g s. The positive relationship between k leaf and E minimized variation in ΔΨstem–leaf. This enables leaves to minimize variation in Ψleaf and maximize g s and CO2 assimilation rate over the diurnal course of evaporative demand. PMID:25547915

  11. Membranous appendices of spherosomes (oleosomes) : Possible role in fat utilization in germinating oil seeds.

    PubMed

    Wanner, G; Theimer, R R

    1978-01-01

    Spherosomes (oleosomes) of cotyledons of rape (Brassica napus L.), sunflower (Helianthus annuus L.), and watermelon (Citrullus vulgaris, Schrad.) seedlings are delimited by a "half unit membrane" that appears to be continuous with each of the osmiophilic layers of a tripartite unit membrane forming a handlelike appendix of the spherosomes. Prior to any noticeable utilization of the spherosomal storage fat, ribosomes were found to be attached to these "handles". At later stages appendices of the spherosomes are smooth, showing a diameter of about 22 nm that greatly exceeds the thickness of any other unit membrane profiles identical in structure and diameter osomes appears to be continuous with the thick lipid layer of the handles. In intermediate stages of fat depletion the spherosomal bodies become invaginated with cytoplasmic material. Finally vesicles with cytoplasmic contents surrounded by a membrane with a typically thick lipid layer are left in the cells. Membrane profiles indentical in structure and diameter to the spherosomal appendices were also present in electron micrographs of the lipolytic membrane fraction recovered from sucrose density gradients after centrifugation of a microsomal cell fraction. The ultrastructural observations are taken for evidence that the spherosomal appendices represent the lipase-carrying membranes isolated previously (Theimer and Rosnitschek, 1978). A novel hypothesis for development and utilization of fat-storing spherosomes is also proposed. PMID:24414473

  12. Seed fates in crop–wild hybrid sunflower: crop allele and maternal effects

    PubMed Central

    Pace, Brian A; Alexander, Helen M; Emry, Jason D; Mercer, Kristin L

    2015-01-01

    Domestication has resulted in selection upon seed traits found in wild populations, yet crop-wild hybrids retain some aspects of both parental phenotypes. Seed fates of germination, dormancy, and mortality can influence the success of crop allele introgression in crop-wild hybrid zones, especially if crop alleles or crop-imparted seed coverings result in out-of-season germination. We performed a seed burial experiment using crop, wild, and diverse hybrid sunflower (Helianthus annuus) cross types to test how a cross type's maternal parent and nuclear genetic composition might affect its fate under field conditions. We observed higher maladaptive fall germination in the crop- and F1- produced seeds than wild-produced seeds and, due to an interaction with percent crop alleles, fall germination was higher for cross types with more crop-like nuclear genetics. By spring, crop-produced cross types had the highest overwintering mortality, primarily due to higher fall germination. Early spring germination was identical across maternal types, but germination continued for F1-produced seeds. In conclusion, the more wild-like the maternal parent or the less proportion of the cross type's genome contributed by the crop, the greater likelihood a seed will remain ungerminated than die. Wild-like dormancy may facilitate introgression through future recruitment from the soil seed bank. PMID:25685189

  13. Life history traits and phenotypic selection among sunflower crop–wild hybrids and their wild counterpart: implications for crop allele introgression

    PubMed Central

    Kost, Matthew A; Alexander, Helen M; Jason Emry, D; Mercer, Kristin L

    2015-01-01

    Hybridization produces strong evolutionary forces. In hybrid zones, selection can differentially occur on traits and selection intensities may differ among hybrid generations. Understanding these dynamics in crop–wild hybrid zones can clarify crop-like traits likely to introgress into wild populations and the particular hybrid generations through which introgression proceeds. In a field experiment with four crop–wild hybrid Helianthus annuus (sunflower) cross types, we measured growth and life history traits and performed phenotypic selection analysis on early season traits to ascertain the likelihood, and routes, of crop allele introgression into wild sunflower populations. All cross types overwintered, emerged in the spring, and survived until flowering, indicating no early life history barriers to crop allele introgression. While selection indirectly favored earlier seedling emergence and taller early season seedlings, direct selection only favored greater early season leaf length. Further, there was cross type variation in the intensity of selection operating on leaf length. Thus, introgression of multiple early season crop-like traits, due to direct selection for greater early season leaf length, should not be impeded by any cross type and may proceed at different rates among generations. In sum, alleles underlying early season sunflower crop-like traits are likely to introgress into wild sunflower populations. PMID:26029263

  14. Functional analysis of superoxide dismutases (SODs) in sunflower under biotic and abiotic stress conditions. Identification of two new genes of mitochondrial Mn-SOD.

    PubMed

    Fernández-Ocaña, Ana; Chaki, Mounira; Luque, Francisco; Gómez-Rodríguez, María V; Carreras, Alfonso; Valderrama, Raquel; Begara-Morales, Juan C; Hernández, Luis E; Corpas, Francisco J; Barroso, Juan B

    2011-07-15

    Superoxide dismutases (SODs) are a family of metalloenzymes that catalyse the disproportionation of superoxide radicals into hydrogen peroxide and oxygen. In sunflower (Helianthus annuus L.) seedlings, two new Mn-SOD isozymes, designated as I and II, were identified. However, no evidence for a Fe-SOD was found. Both Mn-SOD I and Mn-SOD II have a cleaved sequence of 14 residues that target the mitochondrion with a probability of 81% and 95%, respectively. The gene expression of these new mitochondrial Mn-SODs as well as the previously reported cytosolic and chloroplastic CuZnSODs was analyzed by real-time quantitative reverse transcription-PCR. This was done in the main organs (roots, hypocotyls, and cotyledons) of sunflower seedlings and also under biotic (infection by the pathogen Plasmopara halstedii) and abiotic stress conditions, including high and low temperature and mechanical wounding. Both CuZn-SODs had a gene expression of 1000-fold higher than that of mitochondrial Mn-SODs. And the expression of the Mn-SOD I was approximately 12-fold higher than that of Mn-SOD II. The Mn-SOD I showed a significant modulation in response to the assayed biotic and abiotic stresses even when it had no apparent oxidative stress, such as low temperature. Thus, it is proposed that the mitochondrial Mn-SOD I gene could act as an early sensor of adverse conditions to prevent potential oxidative damage.

  15. High temperature triggers the metabolism of S-nitrosothiols in sunflower mediating a process of nitrosative stress which provokes the inhibition of ferredoxin-NADP reductase by tyrosine nitration.

    PubMed

    Chaki, Mounira; Valderrama, Raquel; Fernández-Ocaña, Ana M; Carreras, Alfonso; Gómez-Rodríguez, Maria V; López-Jaramillo, Javier; Begara-Morales, Juan C; Sánchez-Calvo, Beatriz; Luque, Francisco; Leterrier, Marina; Corpas, Francisco J; Barroso, Juan B

    2011-11-01

    High temperature (HT) is considered a major abiotic stress that negatively affects both vegetative and reproductive growth. Whereas the metabolism of reactive oxygen species (ROS) is well established under HT, less is known about the metabolism of reactive nitrogen species (RNS). In sunflower (Helianthus annuus L.) seedlings exposed to HT, NO content as well as S-nitrosoglutathione reductase (GSNOR) activity and expression were down-regulated with the simultaneous accumulation of total S-nitrosothiols (SNOs) including S-nitrosoglutathione (GSNO). However, the content of tyrosine nitration (NO(2) -Tyr) studied by high-performance liquid chromatography with tandem mass spectrometry (LC-MS/MS) and by confocal laser scanning microscope was induced. Nitroproteome analysis under HT showed that this stress induced the protein expression of 13 tyrosine-nitrated proteins. Among the induced proteins, ferredoxin-NADP reductase (FNR) was selected to evaluate the effect of nitration on its activity after heat stress and in vitro conditions using 3-morpholinosydnonimine (SIN-1) (peroxynitrite donor) as the nitrating agent, the FNR activity being inhibited. Taken together, these results suggest that HT augments SNOs, which appear to mediate protein tyrosine nitration, inhibiting FNR, which is involved in the photosynthesis process.

  16. Cytological characterization of sunflower by in situ hybridization using homologous rDNA sequences and a BAC clone containing highly represented repetitive retrotransposon-like sequences.

    PubMed

    Talia, P; Greizerstein, E; Quijano, C Díaz; Peluffo, L; Fernández, L; Fernández, P; Hopp, H E; Paniego, N; Heinz, R A; Poggio, L

    2010-03-01

    In the present work we report new tools for the characterization of the complete chromosome complement of sunflower (Helianthus annuus L.), using a bacterial artificial chromosome (BAC) clone containing repetitive sequences with similarity to retrotransposons and a homologous rDNA sequence isolated from the sunflower genome as probes for FISH. The rDNA signal was found in 3 pairs of chromosomes, coinciding with the location of satellites. The BAC clone containing highly represented retroelements hybridized with all the chromosome complement in FISH, and used together with the rDNA probe allowed the discrimination of all chromosome pairs of sunflower. Their distinctive distribution pattern suggests that these probes could be useful for karyotype characterization and for chromosome identification. The karyotype could be subdivided into 3 clear-cut groups of 12 metacentric pairs, 1 submetacentric pair, and 4 subtelocentric pairs, thus resolving previously described karyotype controversies. The use of BAC clones containing single sequences of specific markers and (or) genes associated with important agricultural traits represents an important tool for future locus-specific identification and physical mapping.

  17. Co-localization of putative calcium channels (phenylalkylamine-binding sites) on oil bodies in protoplasts from dark-grown sunflower seedling cotyledons.

    PubMed

    Vandana, Shweta; Bhatla, Satish C

    2009-07-01

    Oil bodies are spherical entities containing a triacylglycerol (TAG) matrix encased by a phospholipid monolayer, which is stabilized by oil body-specific proteins, principally oleosins. Biochemical investigations in the recent past have also demonstrated the expression of calcium-binding proteins, called caleosins, as a component of oil body membranes during seed germination. Using DM-Bodipy-phenylalkylamine (PAA; a fluorescent derivative of phenylalkylamine)-a fluorescent probe known to bind L-type calcium channel proteins, present investigations provide the first report on the localization and preferential accumulation of putative calcium channel proteins on/around oil bodies during peak lipolytic phase in protoplasts derived from dark-grown sunflower (Helianthus annuus L. cv Morden) seedling cotyledons. Specificity of DM-Bodipy-PAA labeling was confirmed by using bepridil, a non-fluorescent competitor of PAA while non-specific dye accumulation has been ruled out by using Bodipy-FL as control. Co-localization of fluorescence from DM-Bodipy-PAA binding sites (ex: 504 nm; em: 511 nm) and nile red fluorescing oil bodies (ex: 552 nm; em: 636 nm) has been undertaken by epifluorescence and confocal laser scanning microscopy (CLSM). It revealed the affinity of PAA-sensitive ion channels for the oil body surface. Findings from the current investigations highlight the significance of calcium and calcium channel proteins during oil body mobilization in sunflower. PMID:19820351

  18. Co-localization of putative calcium channels (phenylalkylamine-binding sites) on oil bodies in protoplasts from dark-grown sunflower seedling cotyledons

    PubMed Central

    Vandana, Shweta

    2009-01-01

    Oil bodies are spherical entities containing a triacylglycerol (TAG) matrix encased by a phospholipid monolayer, which is stabilized by oil body-specific proteins, principally oleosins. Biochemical investigations in the recent past have also demonstrated the expression of calcium-binding proteins, called caleosins, as a component of oil body membranes during seed germination. Using DM-Bodipy-phenylalkylamine (PAA; a fluorescent derivative of phenylalkylamine)-a fluorescent probe known to bind L-type calcium channel proteins, present investigations provide the first report on the localization and preferential accumulation of putative calcium channel proteins on/around oil bodies during peak lipolytic phase in protoplasts derived from dark-grown sunflower (Helianthus annuus L. cv Morden) seedling cotyledons. Specificity of DM-Bodipy-PAA labeling was confirmed by using bepridil, a non-fluorescent competitor of PAA while non-specific dye accumulation has been ruled out by using Bodipy-FL as control. Co-localization of fluorescence from DM-Bodipy-PAA binding sites (ex: 504 nm; em: 511 nm) and nile red fluorescing oil bodies (ex: 552 nm; em: 636 nm) has been undertaken by epifluorescence and confocal laser scanning microscopy (CLSM). It revealed the affinity of PAA-sensitive ion channels for the oil body surface. Findings from the current investigations highlight the significance of calcium and calcium channel proteins during oil body mobilization in sunflower. PMID:19820351

  19. Plant uptake of depleted uranium from manure-amended and citrate treated soil.

    PubMed

    Sevostianova, Elena; Lindemann, William C; Ulery, April L; Remmenga, Marta D

    2010-08-01

    Six plant species were tested for their ability to accumulate depleted uranium in their above-ground biomass from deployed munitions contaminated soil in New Mexico. In greenhouse experiments, Kochia (Kochia scoparia L. Schrad.) and pigweed (Amaranthus retroflexus L) were grown with steer manure added at rates of 22.4, 44.8, and 89.6 Mg ha(-1). Citric acid and glyphosate (N-(phosphonomethyl) glycine) applied at the end of the growing season increased DU concentrations from 2.5 to 17 times. Leaf and stem DU concentrations in kochia increased from 17.0 to 41.9 mg kg(-1) and from 3.5 to 18.0 mg kg(-1), respectively. In pigweed, leaf and stem DU concentrations increased from 1.0 to 17.3 and from 1.0 to 4.7 mg kg(-1), respectively. Manure generally decreased or had no effect on DU uptake. The effect of citric acid and ammonium citrate on DU uptake by kochia, sunflower (Helianthus annuus L), and sweet corn (Zea mays L) was also studied. Ammonium citrate was just as effective in enhancing DU uptake as citric acid. This implies that the citrate ion is more important in DU uptake and translocation than the solubilization of DU through acidification. In both experiments, leaves had higher DU concentrations than stems. PMID:21166280

  20. [Cloning and expression analysis of a LIM-domain protein gene from cotton (Gossypium hirsuturm L.)].

    PubMed

    Luo, Ming; Xiao, Yue-Hua; Hou, Lei; Luo, Xiao-Ying; Li, De-Mou; Pei, Yan

    2003-02-01

    LIM-domain protein plays an important role in various cellular processes, including construction of cytoskeleton, transcription control and signal transduction. Based on cotton fiber EST database and contig analysis, the coding region of a cotton LIM-domain protein gene (GhLIM1) was obtained by RT-PCR from 4DPA (day post anthesis) ovule with fiber. The cloned fragment of 848 bp contains an open reading frame of 570 bp, coding for a polypeptide of 189 amino acids. It was demonstrated that the deduced GhLIM1 protein was highly homologous to the LIM-domain protein of sunflower (Helianthus annuus), tobacco (Nicotiana tabacum) and Arabidopsis thaliana. Two intact LIM-domains, with the conserved sequence of a double zinc-finger structure (C-X2-C-X17-19-H-X2-C-X2-C-X2-C-X16-24-C-X2-H), were found in the GhLIM1 protein. RT-PCR and Northern blot analysis showed that GhLIM1 gene expressed in root, shoot tip, hypocotyls, bud, leaf, anther, ovule and fiber (4DPA, 12DPA, 18DPA). However it was preferentially expressed in the shoot tip, fiber and ovule. It was proposed that the express of GhLIM1 gene is related to cotton fiber development. PMID:12776607

  1. Co-regulation of water and K(+) transport in sunflower plants during water stress recovery.

    PubMed

    Benlloch, Manuel; Benlloch-González, María

    2016-06-01

    16-day-old sunflower (Helianthus annuus L.) plants were subjected to deficit irrigation for 12 days. Following this period, plants were rehydrated for 2 days to study plant responses to post-stress recovery. The moderate water stress treatment applied reduced growth in all plant organs and the accumulation of K(+) in the shoot. After the rehydration period, the stem recovered its growth and reached a similar length to the control, an effect which was not observed in either root or leaves. Moreover, plant rehydration after water stress favored the accumulation of K(+) in the apical zone of the stem and expanding leaves. In the roots of plants under water stress, watering to field capacity, once the plants were de- topped, rapidly favored K(+) and water transport in the excised roots. This quick and short-lived response was not observed in roots of plants recovered from water stress for 2 days. These results suggest that the recovery of plant growth after water stress is related to coordinated water and K(+) transport from the root to the apical zone of the ​​stem and expanding leaves. This stimulation of K(+) transport in the root and its accumulation in the cells of the growing zones of the ​​stem must be one of the first responses induced in the plant during water stress recovery.

  2. Evolutionary Origins of a Bioactive Peptide Buried within Preproalbumin[C][W

    PubMed Central

    Elliott, Alysha G.; Delay, Christina; Liu, Huanle; Phua, Zaiyang; Rosengren, K. Johan; Benfield, Aurélie H.; Panero, Jose L.; Colgrave, Michelle L.; Jayasena, Achala S.; Dunse, Kerry M.; Anderson, Marilyn A.; Schilling, Edward E.; Ortiz-Barrientos, Daniel; Craik, David J.; Mylne, Joshua S.

    2014-01-01

    The de novo evolution of proteins is now considered a frequented route for biological innovation, but the genetic and biochemical processes that lead to each newly created protein are often poorly documented. The common sunflower (Helianthus annuus) contains the unusual gene PawS1 (Preproalbumin with SFTI-1) that encodes a precursor for seed storage albumin; however, in a region usually discarded during albumin maturation, its sequence is matured into SFTI-1, a protease-inhibiting cyclic peptide with a motif homologous to unrelated inhibitors from legumes, cereals, and frogs. To understand how PawS1 acquired this additional peptide with novel biochemical functionality, we cloned PawS1 genes and showed that this dual destiny is over 18 million years old. This new family of mostly backbone-cyclic peptides is structurally diverse, but the protease-inhibitory motif was restricted to peptides from sunflower and close relatives from its subtribe. We describe a widely distributed, potential evolutionary intermediate PawS-Like1 (PawL1), which is matured into storage albumin, but makes no stable peptide despite possessing residues essential for processing and cyclization from within PawS1. Using sequences we cloned, we retrodict the likely stepwise creation of PawS1’s additional destiny within a simple albumin precursor. We propose that relaxed selection enabled SFTI-1 to evolve its inhibitor function by converging upon a successful sequence and structure. PMID:24681618

  3. Feasibility of Using Phytoextraction to Remediate a Compost-Based Soil Contaminated with Cadmium.

    PubMed

    Parisien, Michele A; Rutter, Allison; Zeeb, Barbara A

    2015-01-01

    Greenhouse and in-situ field experiments were used to determine the potential for phytoextraction to remediate soil contaminated with Cd from municipal solid waste (MSW) and sewage sludge (SS) compost application at a Peterborough (Canada) site. For the greenhouse experiment, one native (Chenopodium album) and three naturalized (Poa compressa, Brassica juncea, Helianthus annuus) plant species were planted in soil containing no detectable Cd (<1.0 μg·g(-1)), and soil from the site containing low (5.0 ± 0.3 μg·g(-1) Cd), and high (16.5 ± 1.2 μg⋅g(-1) Cd) Cd concentrations. Plant uptake was low (root BAFs ≤0.5) for all species except P. compressa in the low Cd treatment (BAF 1.0). Only B. juncea accumulated Cd in its shoots, though uptake was low (BAF ≤0.3). For the field experiment, B. juncea was planted in-situ in areas of low and high Cd concentrations. Brassica juncea Cd uptake was low (root and shoot BAFs <0.2) in both treatments. Sequential extraction analysis indicated that Cd is retained primarily by low bioavailability soil fractions, and phytoextraction is therefore not feasible at this site. Though low Cd bioavailability has negative implications for Cd phytoextraction from MSW/SS compost-based soils, it may limit receptor exposure to Cd sufficiently to eliminate the potential for risk at this site. PMID:25848836

  4. Comprehensive protein-based artificial microRNA screens for effective gene silencing in plants.

    PubMed

    Li, Jian-Feng; Chung, Hoo Sun; Niu, Yajie; Bush, Jenifer; McCormack, Matthew; Sheen, Jen

    2013-05-01

    Artificial microRNA (amiRNA) approaches offer a powerful strategy for targeted gene manipulation in any plant species. However, the current unpredictability of amiRNA efficacy has limited broad application of this promising technology. To address this, we developed epitope-tagged protein-based amiRNA (ETPamir) screens, in which target mRNAs encoding epitope-tagged proteins were constitutively or inducibly coexpressed in protoplasts with amiRNA candidates targeting single or multiple genes. This design allowed parallel quantification of target proteins and mRNAs to define amiRNA efficacy and mechanism of action, circumventing unpredictable amiRNA expression/processing and antibody unavailability. Systematic evaluation of 63 amiRNAs in 79 ETPamir screens for 16 target genes revealed a simple, effective solution for selecting optimal amiRNAs from hundreds of computational predictions, reaching ∼100% gene silencing in plant cells and null phenotypes in transgenic plants. Optimal amiRNAs predominantly mediated highly specific translational repression at 5' coding regions with limited mRNA decay or cleavage. Our screens were easily applied to diverse plant species, including Arabidopsis thaliana, tobacco (Nicotiana benthamiana), tomato (Solanum lycopersicum), sunflower (Helianthus annuus), Catharanthus roseus, maize (Zea mays) and rice (Oryza sativa), and effectively validated predicted natural miRNA targets. These screens could improve plant research and crop engineering by making amiRNA a more predictable and manageable genetic and functional genomic technology.

  5. Correction of Flow Resistances of Plants Measured From Covered and Exposed Leaves

    PubMed Central

    Turner, Neil C.

    1981-01-01

    The difference in water potential between an enclosed nontranspiring leaf and an adjacent exposed transpiring leaf, and the transpiration rate of a similarly exposed leaf, were used to calculate the change in hydraulic resistance of sorghum (Sorghum bicolor [L.] Moench) and sunflower (Helianthus annuus L.) leaves throughout the day and at various rates of transpiration. Since cotton (Gossypium hirsutum L.) leaves enclosed in aluminum foil alone had enclosed leaf water potentials about 0.06 megapascals lower than similar leaves enclosed in a polyethylene bag shielded with aluminum foil, the sorghum and sunflower leaves were enclosed in polyethylene bags shielded with aluminum foil. Enclosing the exposed leaf in a plastic sheath just prior to excision led to the water potential measured by the pressure chamber technique being 0.3 to 0.4 megapascals higher at rapid transpiration rates than in exposed leaves not sheathed just prior to excision. This error, previously shown to arise from rapid water loss after excision, led to an overestimation of the leaf hydraulic resistance in both species. Correction of the error reduced the resistance by 40 to 90% in irrigated sorghum and by about 40% in irrigated and unirrigated sunflower. After correction, the hydraulic resistances were still flow-dependent, but the dependency was markedly reduced in sorghum. PMID:16662056

  6. Continuous Monitoring of Plant Water Potential

    PubMed Central

    Schaefer, Nick L.; Trickett, Edward S.; Ceresa, Anthony; Barrs, Henry D.

    1986-01-01

    Plant water potential was monitored continuously with a Wescor HR-33T dewpoint hygrometer in conjunction with a L51 chamber. This commercial instrument was modified by replacing the AC-DC mains power converter with one stabilized by zener diode controlled transistors. The thermocouple sensor and electrical lead needed to be thermally insulated to prevent spurious signals. For rapid response and faithful tracking a low resistance for water vapor movement between leaf and sensor had to be provided. This could be effected by removing the epidermis either by peeling or abrasion with fine carborundum cloth. A variety of rapid plant water potential responses to external stimuli could be followed in a range of crop plants (sunflower (Helianthus annuus L., var. Hysun 30); safflower (Carthamus tinctorious L., var. Gila); soybean (Glycine max L., var. Clark); wheat (Triticum aestivum L., var. Egret). These included light dark changes, leaf excision, applied pressure to or anaerobiosis of the root system. Water uptake by the plant (safflower, soybean) mirrored that for water potential changes including times when plant water status (soybean) was undergoing cyclical changes. PMID:16664805

  7. Acetohydroxyacid synthase activity and transcripts profiling reveal tissue-specific regulation of ahas genes in sunflower.

    PubMed

    Ochogavía, Ana C; Breccia, Gabriela; Vega, Tatiana; Felitti, Silvina A; Picardi, Liliana A; Nestares, Graciela

    2014-07-01

    Acetohydroxyacid synthase (AHAS) is the target site of several herbicides and catalyses the first step in the biosynthesis of branched chain amino acid. Three genes coding for AHAS catalytic subunit (ahas1, ahas2 and ahas3) have been reported for sunflower. The aim of this work was to study the expression pattern of ahas genes family and AHAS activity in sunflower (Helianthus annuus L.). Different organs (leaves, hypocotyls, roots, flowers and embryos) were evaluated at several developmental stages. The transcriptional profile was studied through RT-qPCR. The highest expression for ahas1 was shown in leaves, where all the induced and natural gene mutations conferring herbicide resistance were found. The maximal expression of ahas2 and ahas3 occurred in immature flowers and embryos. The highest AHAS activity was found in leaves and immature embryos. Correlation analysis among ahas gene expression and AHAS activity was discussed. Our results show that differences in ahas genes expression are tissue-specific and temporally regulated. Moreover, the conservation of multiple AHAS isoforms in sunflower seems to result from different expression requirements controlled by tissue-specific regulatory mechanisms at different developmental stages. PMID:24908515

  8. Circumnutations of Sunflower Hypocotyls in Satellite Orbit 1

    PubMed Central

    Brown, Allan H.; Chapman, David K.; Lewis, Robert F.; Venditti, Allen L.

    1990-01-01

    The principal objective of the research reported here was to determine whether a plant's periodic growth oscillations, called circumnutations, would persist in the absence of a significant gravitational or inertial force. The definitive experiment was made possible by access to the condition of protracted near weightlessness in an earth satellite. The experiment, performed during the first flight of Spacelab on the National Aeronautics and Space Administration shuttle, Columbia, in November and December, 1983, tested a biophysical model, proposed in 1967, that might account for circumnutation as a gravity-dependent growth response. However, circumnutations were observed in microgravity. They continued for many hours without stimulation by a significant g-force. Therefore, neither a gravitational nor an inertial g-force was an absolute requirement for initation or continuation of circumnutation. On average, circumnutation was significantly more vigorous in satellite orbit than on earth-based clinostats. Therefore, at least for sunflower (Helianthus annuus L.) circumnutation, clinostatting is not the functional equivalent of weightlessness. PMID:11537478

  9. Continuous monitoring of plant water potential.

    PubMed

    Schaefer, N L; Trickett, E S; Ceresa, A; Barrs, H D

    1986-05-01

    Plant water potential was monitored continuously with a Wescor HR-33T dewpoint hygrometer in conjunction with a L51 chamber. This commercial instrument was modified by replacing the AC-DC mains power converter with one stabilized by zener diode controlled transistors. The thermocouple sensor and electrical lead needed to be thermally insulated to prevent spurious signals. For rapid response and faithful tracking a low resistance for water vapor movement between leaf and sensor had to be provided. This could be effected by removing the epidermis either by peeling or abrasion with fine carborundum cloth. A variety of rapid plant water potential responses to external stimuli could be followed in a range of crop plants (sunflower (Helianthus annuus L., var. Hysun 30); safflower (Carthamus tinctorious L., var. Gila); soybean (Glycine max L., var. Clark); wheat (Triticum aestivum L., var. Egret). These included light dark changes, leaf excision, applied pressure to or anaerobiosis of the root system. Water uptake by the plant (safflower, soybean) mirrored that for water potential changes including times when plant water status (soybean) was undergoing cyclical changes. PMID:16664805

  10. Substitution of Germanium for Boron in Plant Growth 1

    PubMed Central

    McIlrath, Wayne J.; Skok, John

    1966-01-01

    The observation was confirmed that the addition of germanium dioxide (soluble form) to the nutrient solution can delay for a short time the appearance of boron deficiency symptoms on the shoots of sunflower plants (Helianthus annuus L.). This appeared to be true, however, only under growing conditions in which the plants had a low boron requirement. The delay in the appearance of boron deficiency symptoms by administering germanium was demonstrated in sunflower plants ranging in age from 7 to 20 days. This effect was noted whether the germanium was administered prior to or at the time the plants were transferred to minus-boron nutrient solution. It is proposed that germanium does not truly substitute for boron in metabolic processes of the plant but rather functions through increasing the mobility of soluble boron within the plant and in binding nonmetabolic polyhydroxyl sites thus serving in a sparing role for the limited quantity of soluble boron in the growth centers. Images Fig. 1 PMID:16656385

  11. Gravitropism in Higher Plant Shoots 1

    PubMed Central

    Salisbury, Frank B.; Gillespie, Linda; Rorabaugh, Patricia

    1988-01-01

    An alternative to the Cholodny-Went, auxin-transport hypothesis of gravitropic stem bending was proposed as early as 1958, suggesting that gravistimulation induces changes in sensitivity to auxin, accounting for differential growth and bending. To test the sensitivity hypothesis, we immersed marked, decapitated sunflower (Helianthus annuus L.) hypocotyl sections in buffered auxin solutions over a wide concentration range (0, 10−8 to 10−2 molar IAA), photographed them at half-hour intervals, analyzed the negatives with a digitizer/computer, and evaluated surface-length changes in terms of Michaelis-Menten enzyme kinetics. Bending decreases with increasing auxin concentration; above about 10−4 molar IAA the hypocotyls bend down; increasing auxin inhibits elongation growth of lower surfaces (which is high at zero or relatively low auxin levels) but promotes upper-surface growth (which is low at low auxin levels). Thus, lower surfaces have a greater Km sensitivity to applied auxin than upper surfaces. At optimum auxin levels (maximum growth), growth of bottom surfaces exceeds that of top surfaces, so bottom tissues have a greater Vmax sensitivity. Vmax sensitivity of vertical controls is slightly lower than it is for either horizontal surface; Km sensitivity is intermediate. Clearly, gravistimulation leads to significant changes in tissue sensitivity to applied auxin. Perhaps these changes are also important in normal gravitropism. Images Fig. 2 Fig. 3 PMID:11537435

  12. Novel Fibonacci and non-Fibonacci structure in the sunflower: results of a citizen science experiment

    PubMed Central

    Swinton, Jonathan; Ochu, Erinma

    2016-01-01

    This citizen science study evaluates the occurrence of Fibonacci structure in the spirals of sunflower (Helianthus annuus) seedheads. This phenomenon has competing biomathematical explanations, and our core premise is that observation of both Fibonacci and non-Fibonacci structure is informative for challenging such models. We collected data on 657 sunflowers. In our most reliable data subset, we evaluated 768 clockwise or anticlockwise parastichy numbers of which 565 were Fibonacci numbers, and a further 67 had Fibonacci structure of a predefined type. We also found more complex Fibonacci structures not previously reported in sunflowers. This is the third, and largest, study in the literature, although the first with explicit and independently checkable inclusion and analysis criteria and fully accessible data. This study systematically reports for the first time, to the best of our knowledge, seedheads without Fibonacci structure. Some of these are approximately Fibonacci, and we found in particular that parastichy numbers equal to one less than a Fibonacci number were present significantly more often than those one more than a Fibonacci number. An unexpected further result of this study was the existence of quasi-regular heads, in which no parastichy number could be definitively assigned. PMID:27293788

  13. Reactive oxygen species, abscisic acid and ethylene interact to regulate sunflower seed germination.

    PubMed

    El-Maarouf-Bouteau, Hayat; Sajjad, Yasar; Bazin, Jérémie; Langlade, Nicolas; Cristescu, Simona M; Balzergue, Sandrine; Baudouin, Emmanuel; Bailly, Christophe

    2015-02-01

    Sunflower (Helianthus annuus L.) seed dormancy is regulated by reactive oxygen species (ROS) and can be alleviated by incubating dormant embryos in the presence of methylviologen (MV), a ROS-generating compound. Ethylene alleviates sunflower seed dormancy whereas abscisic acid (ABA) represses germination. The purposes of this study were to identify the molecular basis of ROS effect on seed germination and to investigate their possible relationship with hormone signalling pathways. Ethylene treatment provoked ROS generation in embryonic axis whereas ABA had no effect on their production. The beneficial effect of ethylene on germination was lowered in the presence of antioxidant compounds, and MV suppressed the inhibitory effect of ABA. MV treatment did not alter significantly ethylene nor ABA production during seed imbibition. Microarray analysis showed that MV treatment triggered differential expression of 120 probe sets (59 more abundant and 61 less abundant genes), and most of the identified transcripts were related to cell signalling components. Many transcripts less represented in MV-treated seeds were involved in ABA signalling, thus suggesting an interaction between ROS and ABA signalling pathways at the transcriptional level. Altogether, these results shed new light on the crosstalk between ROS and plant hormones in seed germination.

  14. Contribution of botanical origin and sugar composition of honeys on the crystallization phenomenon.

    PubMed

    Escuredo, Olga; Dobre, Irina; Fernández-González, María; Seijo, M Carmen

    2014-04-15

    The present work provides information regarding the statistical relationships among the palynological characteristics, sugars (fructose, glucose, sucrose, melezitose and maltose), moisture content and sugar ratios (F+G, F/G and G/W) of 136 different honey types (including bramble, chestnut, eucalyptus, heather, acacia, lime, rape, sunflower and honeydew). Results of the statistical analyses (multiple comparison Bonferroni test, Spearman rank correlations and principal components) revealed the valuable significance of the botanical origin on the sugar ratios (F+G, F/G and G/W). Brassica napus and Helianthus annuus pollen were the variables situated near F+G and G/W ratio, while Castanea sativa, Rubus and Eucalyptus pollen were located further away, as shown in the principal component analysis. The F/G ratio of sunflower, rape and lime honeys were lower than those found for the chestnut, eucalyptus, heather, acacia and honeydew honeys (>1.4). A lower value F/G ratio and lower water content were related with a faster crystallization in the honey. PMID:24295680

  15. Growth in liverworts of the Marchantiales is promoted by epiphytic methylobacteria

    NASA Astrophysics Data System (ADS)

    Kutschera, U.; Koopmann, V.

    2005-07-01

    Liverworts, the most basal lineage of extant land plants, have been used as model systems in the reconstruction of adaptations to life on land. In this study, we used gemmae (specialized propagules) that were isolated from mature gemma cups of two distantly related species of liverworts, Marchantia polymorpha L. and Lunularia cruciata L. (order Marchantiales). We show that methylobacteria (genus Methylobacterium), microbes that inhabit the surfaces of land plants where they secrete phytohormones (cytokinines), promote the growth of isolated gemmae cultivated on agar plates. As a control, two species of higher plants, maize (Zea mays L.) and sunflower (Helianthus annuus L.) were raised aseptically from sterile seeds (i.e., caryopses, achenes). Inoculation of these propagules with methylobacteria was without effect on growth in the above-ground phytosphere (expansion of stems and leaves). We conclude that normal development in Marchantia and Lunularia is dependent on (and possibly regulated by) epiphytic methylobacteria, whereas representative higher plants grow at optimal rates in the absence of these prokaryotic epiphytes.

  16. Quantum Yields and Rate Constants of Photochemical and Nonphotochemical Excitation Quenching (Experiment and Model).

    PubMed Central

    Laisk, A.; Oja, V.; Rasulov, B.; Eichelmann, H.; Sumberg, A.

    1997-01-01

    Sunflower (Helianthus annuus L.), cotton (Gossypium hirsutum L.), tobacco (Nicotiana tabacum L.), sorghum (Sorghum bicolor Moench.), amaranth (Amaranthus cruentus L.), and cytochrome b6f complex-deficient transgenic tobacco leaves were used to test the response of plants exposed to differnt light intensities and CO2 concentrations before and after photoinhibition at 4000 [mu]mol photons m-2 s-1 and to thermoinhibition up to 45[deg]C. Quantum yields of photochemical and nonphotochemical excitation quenching (YP and YN) and the corresponding relative rate constants for excitation capture from the antenna-primary radical pair equilibrium system (k[prime]P and k[prime]N) were calculated from measured fluorescence parameters. The above treatments resulted in decreases in YP and K[prime]P and in approximately complementary increases in YN and K[prime]N under normal and inhibitory conditions. The results were reproduced by a mathematical model of electron/proton transport and O2 evolution/CO2 assimilation in photosynthesis based on budget equations for the intermediates of photosynthesis. Quantitative differences between model predictions and experiments are explainable, assuming that electron transport is organized into domains that contain relatively complete electron and proton transport chains (e.g. thylakoids). With the complementation that occurs between the photochemical and nonphotochemical excitation quenching, the regulatory system can constantly maintain the shortest lifetime of excitation necessary to avoid the formation of chlorophyll triplet states and singlet oxygen. PMID:12223845

  17. Phytoremediation of carbamazepine and its metabolite 10,11-epoxycarbamazepine by C3 and C4 plants.

    PubMed

    Ryšlavá, Helena; Pomeislová, Alice; Pšondrová, Šárka; Hýsková, Veronika; Smrček, Stanislav

    2015-12-01

    The anticonvulsant drug carbamazepine is considered as an indicator of sewage water pollution: however, its uptake by plants and effect on metabolism have not been sufficiently documented, let alone its metabolite (10,11-epoxycarbamazepine). In a model system of sterile, hydroponically cultivated Zea mays (as C4 plant) and Helianthus annuus (as C3 plant), the uptake and effect of carbamazepine and 10,11-epoxycarbamazepine were studied in comparison with those of acetaminophen and ibuprofen. Ibuprofen and acetaminophen were effectively extracted from drug-supplemented media by both plants, while the uptake of more hydrophobic carbamazepine was much lower. On the other hand, the carbamazepine metabolite, 10,11-epoxycarbamazepine, was, unlike sunflower, willingly taken up by maize plants (after 96 h 88 % of the initial concentration) and effectively stored in maize tissues. In addition, the effect of the studied pharmaceuticals on the plant metabolism (enzymes of Hatch-Slack cycle, peroxidases) was followed. The activity of bound peroxidases, which could cause xylem vessel lignification and reduction of xenobiotic uptake, was at the level of control plants in maize leaves contrary to sunflower. Therefore, our results indicate that maize has the potential to remove 10,11-epoxycarbamazepine from contaminated soils.

  18. Translocation of Radioactive Carbon after the Application of 14C-Alanine and 14CO2 to Sunflower Leaves 1

    PubMed Central

    Chopowick, R. E.; Forward, D. F.

    1974-01-01

    14C-(UL)-l-Alanine was applied to the surface of mature leaves at the second node of sunflower (Helianthus annuus L. cv Commander) plants, under illumination. The alanine was absorbed during a 4-hour period, and some of it was metabolized by the absorbing tissue. After a lag period of about 15 minutes from first application, distribution of 14C through the plant proceeded in much the same pattern as when 14CO2 is assimilated by similar leaves. Most, if not all, of the 14C exported from the absorbing regions was in sucrose. Only minute amounts appeared in alanine or other amino acids in surrounding parts of the leaf blade or in the petiole, although these were strongly labeled in the tissue absorbing 14C-alanine. When 14CO2 was supplied for 15 minutes to leaves of different ages, amino acids were lightly labeled in the leaf blade. Mature green leaves exported only sucrose. Yellowing leaves on 60-day-old plants exported a variety of substances including amino acids. PMID:16658645

  19. Hybrid zones and the genetic architecture of a barrier to gene flow between two sunflower species.

    PubMed Central

    Rieseberg, L H; Whitton, J; Gardner, K

    1999-01-01

    Genetic analyses of reproductive barriers represent one of the few methods by which theories of speciation can be tested. However, genetic study is often restricted to model organisms that have short generation times and are easily propagated in the laboratory. Replicate hybrid zones with a diversity of recombinant genotypes of varying age offer increased resolution for genetic mapping experiments and expand the pool of organisms amenable to genetic study. Using 88 markers distributed across 17 chromosomes, we analyze the introgression of chromosomal segments of Helianthus petiolaris into H. annuus in three natural hybrid zones. Introgression was significantly reduced relative to neutral expectations for 26 chromosomal segments, suggesting that each segment contains one or more factors that contribute to isolation. Pollen sterility is significantly associated with 16 of these 26 segments, providing a straightforward explanation of why this subset of blocks is disadvantageous in hybrids. In addition, comparison of rates of introgression across colinear vs. rearranged chromosomes indicates that close to 50% of the barrier to introgression is due to chromosomal rearrangements. These results demonstrate the utility of hybrid zones for identifying factors contributing to isolation and verify the prediction of increased resolution relative to controlled crosses. PMID:10353912

  20. Could blackbird mortality from avicide DRC-1339 contribute to avian botulism outbreaks in North Dakota?

    USGS Publications Warehouse

    Goldberg, D.R.; Samuel, M.D.; Rocke, T.E.; Johnson, K.M.; Linz, G.

    2004-01-01

    Blackbird (family lcteridae) depredation on sunflower (Helianthus annuus) crops in the prairie states of the United States has motivated the proposed use of an avicide, DRC-1339 (3-chloro-4-methylaniline), to decrease their numbers. The resulting mortality of blackbirds at wetland roosts could increase the potential of avian botulism occurring in affected marshes. To assess this possibility, we seeded (artificially placed) blackbird carcasses in selected wetlands in Stutsman County, North Dakota, during August-September 2000 and July-September 2001 to evaluate their rate of decomposition and role in initiating avian botulism outbreaks. We monitored carcasses to determine their persistence, the frequency and amount of maggots produced, and the presence of type C botulinum toxin. In 10 of our 12 study wetlands, blackbird carcasses were not rapidly removed by scavengers, thus providing substrate for maggot growth and potential production of Clostridium botulinum toxin. Decomposition of carcasses occurred rapidly, and maggot production averaged 4a??5 g per carcass within 9 days. We were unable to detect C. botulinum type C toxin in any of the 377 blackbird carcasses or the 112 samples of maggots we collected in 2000 or 2001. None of the 25 blackbird carcasses we tested contained botulinum spores, the most probable explanation for the absence of botulinum toxin production. Our results indicate that the likelihood of DRC-1339-poisoned blackbirds causing botulism outbreaks would be minimal in North Dakota wetlands during late summer and early autumn.

  1. Growth in liverworts of the Marchantiales is promoted by epiphytic methylobacteria.

    PubMed

    Kutschera, U; Koopmann, V

    2005-07-01

    Liverworts, the most basal lineage of extant land plants, have been used as model systems in the reconstruction of adaptations to life on land. In this study, we used gemmae (specialized propagules) that were isolated from mature gemma cups of two distantly related species of liverworts, Marchantia polymorpha L. and Lunularia cruciata L. (order Marchantiales). We show that methylobacteria (genus Methylobacterium), microbes that inhabit the surfaces of land plants where they secrete phytohormones (cytokinines), promote the growth of isolated gemmae cultivated on agar plates. As a control, two species of higher plants, maize (Zea mays L.) and sunflower (Helianthus annuus L.) were raised aseptically from sterile seeds (i.e., caryopses, achenes). Inoculation of these propagules with methylobacteria was without effect on growth in the above-ground phytosphere (expansion of stems and leaves). We conclude that normal development in Marchantia and Lunularia is dependent on (and possibly regulated by) epiphytic methylobacteria, whereas representative higher plants grow at optimal rates in the absence of these prokaryotic epiphytes.

  2. Novel Fibonacci and non-Fibonacci structure in the sunflower: results of a citizen science experiment.

    PubMed

    Swinton, Jonathan; Ochu, Erinma

    2016-05-01

    This citizen science study evaluates the occurrence of Fibonacci structure in the spirals of sunflower (Helianthus annuus) seedheads. This phenomenon has competing biomathematical explanations, and our core premise is that observation of both Fibonacci and non-Fibonacci structure is informative for challenging such models. We collected data on 657 sunflowers. In our most reliable data subset, we evaluated 768 clockwise or anticlockwise parastichy numbers of which 565 were Fibonacci numbers, and a further 67 had Fibonacci structure of a predefined type. We also found more complex Fibonacci structures not previously reported in sunflowers. This is the third, and largest, study in the literature, although the first with explicit and independently checkable inclusion and analysis criteria and fully accessible data. This study systematically reports for the first time, to the best of our knowledge, seedheads without Fibonacci structure. Some of these are approximately Fibonacci, and we found in particular that parastichy numbers equal to one less than a Fibonacci number were present significantly more often than those one more than a Fibonacci number. An unexpected further result of this study was the existence of quasi-regular heads, in which no parastichy number could be definitively assigned. PMID:27293788

  3. Catalase is a key enzyme in seed recovery from ageing during priming.

    PubMed

    Kibinza, Serge; Bazin, Jérémie; Bailly, Christophe; Farrant, Jill M; Corbineau, Françoise; El-Maarouf-Bouteau, Hayat

    2011-09-01

    Ageing induces seed deterioration expressed as the loss of seed vigour and/or viability. Priming treatment, which consists in soaking of seeds in a solution of low water potential, has been shown to reinvigorate aged seeds. We investigate the importance of catalase in oxidation protection during accelerated ageing and repair during subsequent priming treatment of sunflower (Helianthus annuus L.) seeds. Seeds equilibrated to 0.29g H2Og(-1) dry matter (DM) were aged at 35°C for different durations and then primed by incubation for 7 days at 15°C in a solution of polyethylene glycol 8000 at -2MPa. Accelerated ageing affected seed germination and priming treatment reversed partially the ageing effect. The inhibition of catalase by the addition of aminotriazol during priming treatment reduced seed repair indicating that catalase plays a key role in protection and repair systems during ageing. Ageing was associated with H2O2 accumulation as showed by biochemical quantification and CeCl3 staining. Catalase was reduced at the level of gene expression, protein content and affinity. Interestingly, priming induced catalase synthesis by activating expression and translation of the enzyme. Immunocytolocalization of catalase showed that the enzyme co-localized with H2O2 in the cytosol. These results clearly indicate that priming induce the synthesis of catalase which is involved in seed recovery during priming.

  4. Biological seed priming mitigates the effects of water stress in sunflower seedlings.

    PubMed

    Singh, Narsingh Bahadur; Singh, Deepmala; Singh, Amit

    2015-04-01

    The sunflower (Helianthus annuus L. cv. PAC 36) seedlings were inoculated with plant growth promoting rhizobacteria (PGPR), viz. Azotobacter chroococcum (A+), Bacillus polymyxa (B+), separately and in combination of the two (AB+). Relative water content and seedling growth were maximum in AB+ seedlings under control. Water stress significantly decreased the RWC, growth and dry mass of non-inoculated seedlings. However, inoculated seedlings maintained higher growth even under water stress. Pigments and protein contents decreased under water stress, but higher amount of the same was observed in stressed AB+ seedlings. Enhanced activity of nitrate reductase was recorded in AB+ seedlings with maximum in control. Water stress significantly decreased the nitrate reductase activity. A significant increase in the activity of superoxide dismutase (SOD) in leaves was recorded under water stress except in B+ with maximum increase in non-inoculated seedlings. Catalase (CAT) activity decreased in stressed non-inoculated seedlings while increased in the leaves of A+ and AB+ seedlings. Almost similar trends were recorded for both leaves and cotyledons. PGPR improved the water status in stressed seedlings and thereby physiological and biochemical parameters and thus ameliorated the severe effects of water stress.

  5. Organization of lipid reserves in cotyledons of primed and aged sunflower seeds.

    PubMed

    Walters, Christina; Landré, Pierre; Hill, Lisa; Corbineau, Françoise; Bailly, Christophe

    2005-10-01

    Imbibing sunflower (Helianthus annuus L., cv. Briosol) seeds at water potentials between -2 MPa and -5 MPa leads to faster (priming) or slower (accelerated ageing) germination depending on the temperature and duration of treatment. Mobilization of food reserves may be associated with the changes in seed vigor. To study this, morphological, biochemical and phase properties of lipid, the major food reserve in sunflower, were compared in freshly harvested (i.e., control), primed and aged sunflower cotyledons using electron microscopy, biochemical analyses and differential scanning calorimetry, respectively. Lipid bodies became smaller and more dispersed throughout the cytoplasm during priming and ageing. Despite ultrastructural changes, there were few measured changes in biochemistry of the neutral lipid component; lipid content, proportion of saturated and unsaturated fatty acids and level of free fatty acids were unchanged in primed and slightly aged seeds, with only severely aged seeds showing a net decrease in polyunsaturated fatty acids and an increase in free fatty acids. Subtle changes in the calorimetric behavior of lipids within sunflower cotyledons were observed. Sunflower lipids exhibited polymorphic crystalline and amorphous solid phases when cooled to <-100 degrees C, but priming decreased the rate of crystallization in vivo and ageing increased the rate of crystallization, but decreased percentage crystallinity. The observed changes in thermal behavior in vivo are consistent with losses and gains, respectively, of interacting non-lipid moieties in the triacylglycerol matrix.

  6. Turgor and the transport of CO2 and water across the cuticle (epidermis) of leaves.

    PubMed

    Boyer, John S

    2015-05-01

    Leaf photosynthesis relies on CO₂ diffusing in while water vapour diffuses out. When stomata close, cuticle waxes on the epidermal tissues increasingly affect this diffusion. Also, changes in turgor can shrink or swell a leaf, varying the cuticle size. In this study, the properties of the cuticle were investigated while turgor varied in intact leaves of hypo stomatous grape (Vitis vinifera L.) or amphistomatous sunflower (Helianthus annuus L.). For grape, stomata on the abaxial surface were sealed and high CO₂ concentrations outside the leaf were used to maximize diffusion through the adaxial, stoma-free cuticle. For sunflower, stomata were closed in the dark or with abscisic acid to maximize the cuticle contribution to the path. In both species, the internal CO₂ concentration was measured directly and continuously while other variables were determined to establish the cuticle properties. The results indicated that stomatal closure diminished the diffusion of both gases in both species, but for CO₂ more than for water vapour. Decreasing the turgor diminished the movement of both gases through the cuticle of both species. Because this turgor effect was observed in the adaxial surface of grape, which had no stomata, it could only be attributed to cuticle tightening. Comparing calculated and measured concentrations of CO₂ in leaves revealed differences that became large as stomata began to close. These differences in transport, together with turgor effects, suggest calculations of the CO₂ concentration inside leaves need to be viewed with caution when stomata begin to close.

  7. Tracking the spring migration of a bar-headed goose (Anser indicus) across the Himalaya with satellite telemetry

    USGS Publications Warehouse

    Javed, Salim; Takekawa, John Y.; Douglas, David C.; Rahmani, Asad R.; Kanai, Yutaka; Nagendran, Meenakshi; Choudhury, Binod C.; Sharma, Shruti

    2000-01-01

    Soil-food-chain-pesticide wildlife relationships were investigated to learn the concentration of pesticide residues present in soils, macro-invertebrates, vertebrates, and seeds as a result of annual applications of aldrin at recommended rates for pest control. Two central Missouri cornfields treated witb aldrin at 1 lb/acre, for 16 and 15 of the past 17 years, were selected for study during 1965-67. Primary samples collected for residue analyses included soils, earthworms (Lumbricidae), crickets (GryIlidae), and two kinds of ground beetles (Carabidae) obtained during early April, June, August, and October. Vertebrates and plant seeds collected during 1967 included white-footed mice (Peromyscus maniculatus), toads (Bufo americanus), snakes (Thamnophis sirtalis and Pituophis sayi), corn (Zea Mays), foxtail (Setaria Faberii), and annual sunflower (Helianthus annuus). Pesticide residues consisted primarily of dieldrin, the degradation product of aldrin. Combined aldrin and dieldrin residues, as two field all-season averages, wet weight basis, were: soils, 0.31 ppm; earthworms, 1.49 ppm; crickets, 0.23 ppm; Harpalus ground beetles, 1.10 ppm; Poecilus ground beetles, 9.67 ppm; white-footed mice, 0.98 ppm; toads, 3.53 ppm; garter snakes, 12.35 ppm; and corn, foxtail, and sunflower seeds less than 0.02 ppm each. Unusually high average residues (37.48 ppm) in Poecilus beetles during June, 1967, were attributed to abnormally high soil moisture and predacious feeding habits of these insects.

  8. A biomarker based on gene expression indicates plant water status in controlled and natural environments.

    PubMed

    Marchand, Gwenaëlle; Mayjonade, Baptiste; Varès, Didier; Blanchet, Nicolas; Boniface, Marie-Claude; Maury, Pierre; Nambinina Andrianasolo, Fety; Nambinina, Fety Andrianasolo; Burger, Philippe; Debaeke, Philippe; Casadebaig, Pierre; Vincourt, Patrick; Langlade, Nicolas B

    2013-12-01

    Plant or soil water status is required in many scientific fields to understand plant responses to drought. Because the transcriptomic response to abiotic conditions, such as water deficit, reflects plant water status, genomic tools could be used to develop a new type of molecular biomarker. Using the sunflower (Helianthus annuus L.) as a model species to study the transcriptomic response to water deficit both in greenhouse and field conditions, we specifically identified three genes that showed an expression pattern highly correlated to plant water status as estimated by the pre-dawn leaf water potential, fraction of transpirable soil water, soil water content or fraction of total soil water in controlled conditions. We developed a generalized linear model to estimate these classical water status indicators from the expression levels of the three selected genes under controlled conditions. This estimation was independent of the four tested genotypes and the stage (pre- or post-flowering) of the plant. We further validated this gene expression biomarker under field conditions for four genotypes in three different trials, over a large range of water status, and we were able to correct their expression values for a large diurnal sampling period.

  9. Molecular mapping of a sunflower rust resistance gene from HAR6

    PubMed Central

    Bulos, Mariano; Ramos, María L.; Altieri, Emiliano; Sala, Carlos A.

    2013-01-01

    Sunflower rust, caused by Puccinia helianthi Schw., can result in significant yield losses in cultivated sunflower (Helianthus annuus L. var. macrocarpus Ckll.). HAR6 is a germplasm population resistant to most predominant rust races. The objectives of this study were to map the resistance factor present in HAR6 (RHAR6), and to provide and validate molecular tools for the identification of this gene for marker assisted selection purposes. Virulence reaction of seedlings for the F2 population and F2:3 families suggested that a single dominant gene confers rust resistance in HAR6-1, a selected rust resistance line from the original population. Genetic mapping with eight markers covered 97.4 cM of genetic distance on linkage group 13 of the sunflower consensus map. A co-dominant marker ZVG61 is the closest marker distal to RHAR6 at a genetic distance of 0.7 cM, while ORS581, a dominant marker linked in the coupling phase, is proximal to RHAR6 at a genetic distance of 1.5 cM. Validation of these markers was assessed by converting a susceptible line into a rust resistant isoline by means of marker assisted backcrossing. The application of these results to assist the breeding process and to design new strategies for rust control in sunflower is discussed. PMID:23641190

  10. Association between photosynthesis and contrasting features of minor veins in leaves of summer annuals loading phloem via symplastic versus apoplastic routes.

    PubMed

    Muller, Onno; Cohu, Christopher M; Stewart, Jared J; Protheroe, Johanna A; Demmig-Adams, Barbara; Adams, William W

    2014-09-01

    Foliar vascular anatomy and photosynthesis were evaluated for a number of summer annual species that either load sugars into the phloem via a symplastic route (Cucumis sativus L. cv. Straight Eight; Cucurbita pepo L. cv. Italian Zucchini Romanesco; Citrullus lanatus L. cv. Faerie Hybrid; Cucurbita pepo L. cv. Autumn Gold) or an apoplastic route (Nicotiana tabacum L.; Solanum lycopersicum L. cv. Brandywine; Gossypium hirsutum L.; Helianthus annuus L. cv. Soraya), as well as winter annual apoplastic loaders (Spinacia oleracea L. cv. Giant Nobel; Arabidopsis thaliana (L.) Heynhold Col-0, Swedish and Italian ecotypes). For all summer annuals, minor vein cross-sectional xylem area and tracheid number as well as the ratio of phloem loading cells to phloem sieve elements, each when normalized for foliar vein density (VD), was correlated with photosynthesis. These links presumably reflect (1) the xylem's role in providing water to meet foliar transpirational demand supporting photosynthesis and (2) the importance of the driving force of phloem loading as well as the cross-sectional area for phloem sap flux to match foliar photosynthate production. While photosynthesis correlated with the product of VD and cross-sectional phloem cell area among symplastic loaders, photosynthesis correlated with the product of VD and phloem cell number per vein among summer annual apoplastic loaders. Phloem cell size has thus apparently been a target of selection among symplastic loaders (where loading depends on enzyme concentration within loading cells) versus phloem cell number among apoplastic loaders (where loading depends on membrane transporter numbers).

  11. Physicochemical properties of honey from Marche, Central Italy: classification of unifloral and multifloral honeys by multivariate analysis.

    PubMed

    Truzzi, Cristina; Illuminati, Silvia; Annibaldia, Anna; Finale, Carolina; Rossetti, Monica; Scarponi, Giuseppe

    2014-11-01

    The purpose of this study was the physicochemical characterization and classification of Italian honey from Marche Region with a chemometric approach. A total of 135 honeys of different botanical origins [acacia (Robinia pseudoacacia L.), chestnut (Castanea sativa), coriander (Coriandrum sativum L.), lime (Tilia spp.), sunflower (Helianthus annuus L.), Metcalfa honeydew and multifloral honey] were considered. The average results of electrical conductivity (0.14-1.45 mS cm(-1)), pH (3.89-5.42), free acidity (10.9-39.0 meq(NaOH) kg(-1)), lactones (2.4-4.5 meq(NaOH) kg(-1)), total acidity (14.5-40.9 meq(NaOH) kg(-1)), proline (229-665 mg kg(-1)) and 5-(hydroxy-methyl)-2-furaldehyde (0.6-3.9 mg kg(-1)) content show wide variability among the analysed honey types, with statistically significant differences between the different honey types. Pattern recognition methods such as principal component analysis and discriminant analysis were performed in order to find a relationship between variables and types of honey and to classify honey on the basis of its physicochemical properties. The variables of electrical conductivity, acidity (free, lactones), pH and proline content exhibited higher discriminant power and provided enough information for the classification and distinction of unifloral honey types, but not for the classification of multifloral honey (100% and 85% of samples correctly classified, respectively). PMID:25532290

  12. Assessing the effects of heavy metals in ACC deaminase and IAA production on plant growth-promoting bacteria.

    PubMed

    Carlos, Mendoza-Hernández José; Stefani, Perea-Vélez Yazmin; Janette, Arriola-Morales; Melani, Martínez-Simón Sara; Gabriela, Pérez-Osorio

    2016-01-01

    This study poses a methodology in order to simultaneously quantify ACC deaminase and IAA levels in the same culture medium. Ten bacterial strains isolated from plant rhizosphere naturally settled in mining residues were chosen. These bacterial strains were characterized as PGPB, and all of them showed at least three characteristics (indole-3 acetic acid and siderophore production, ACC deaminase enzyme activity, and inorganic phosphate solubilization). Taxonomic identification showed that the strains belong to Enterobacter, Serratia, Klebsiella, and Escherichia genera. Similarly, both the ACC deaminase enzyme activity and the IAA synthesis in the presence of Cu, As, Pb, Ni, Cd, and Mn were measured. The results showed that both the ACC deaminase enzyme activity and the IAA synthesis were higher with the Pb, As, and Cu treatments than with the Escherichia N16, Enterobacter K131, Enterobacter N9, and Serratia K120 control treatments. On the other hand, Ni, Cd, and Mn negatively affected both the ACC deaminase enzyme activity and the IAA production on every bacterium except on the Klebsiella Mc173 strain. Serratia K120 bacterium got a positive correlation between ACC deaminase and IAA in the presence of every heavy metal, and it also promoted Helianthus annuus plant growth, showing a potential use in phytoremediation systems. PMID:27296962

  13. Dieldrin-dissolving abilities of the xylem saps of several plant families, particularly Cucurbita pepo L.

    PubMed

    Murano, Hirotatsu; Otani, Takashi; Seike, Nobuyasu

    2010-10-01

    The uptake ability of hydrophobic organic chemicals by plants and the nature of xylem sap of the plants were studied. The plants were grown in soil contaminated with dieldrin. High amounts of dieldrin were detected in the shoots of Cucurbita pepo and Cucumis sativus, but little was seen in the shoots of Brassica oleracea var. italica, Solanum lycopersicum, Glycine max, Zea mays, and Helianthus annuus. The xylem saps of C. pepo and C. sativus leached dieldrin adsorbed on C8 granules, but those of the other plants did not. The xylem saps of C. pepo and C. sativus eluted high amounts of dieldrin from the size-exclusion chromatography column near the fractions of RNase A (13.7 kDa) after Aprotinin (6.5 kDa), which has a larger molecular weight than dieldrin (381). The enhancement of dieldrin solubility by xylem sap was reduced by proteinase and heating. It was suspected that the protein-like materials in the xylem sap delivered dieldrin from the roots to the shoots.

  14. Development of a 10,000 locus genetic map of the sunflower genome based on multiple crosses.

    PubMed

    Bowers, John E; Bachlava, Eleni; Brunick, Robert L; Rieseberg, Loren H; Knapp, Steven J; Burke, John M

    2012-07-01

    Genetic linkage maps have the potential to facilitate the genetic dissection of complex traits and comparative analyses of genome structure, as well as molecular breeding efforts in species of agronomic importance. Until recently, the majority of such maps was based on relatively low-throughput marker technologies, which limited marker density across the genome. The availability of high-throughput genotyping technologies has, however, made possible the efficient development of high-density genetic maps. Here, we describe the analysis and integration of genotypic data from four sunflower (Helianthus annuus L.) mapping populations to produce a consensus linkage map of the sunflower genome. Although the individual maps (which contained 3500-5500 loci each) were highly colinear, we observed localized variation in recombination rates in several genomic regions. We also observed several gaps up to 26 cM in length that completely lacked mappable markers in individual crosses, presumably due to regions of identity by descent in the mapping parents. Because these regions differed by cross, the consensus map of 10,080 loci contained no such gaps, clearly illustrating the value of simultaneously analyzing multiple mapping populations.

  15. Single Nucleotide Polymorphisms and Linkage Disequilibrium in Sunflower

    PubMed Central

    Kolkman, Judith M.; Berry, Simon T.; Leon, Alberto J.; Slabaugh, Mary B.; Tang, Shunxue; Gao, Wenxiang; Shintani, David K.; Burke, John M.; Knapp, Steven J.

    2007-01-01

    Genetic diversity in modern sunflower (Helianthus annuus L.) cultivars (elite oilseed inbred lines) has been shaped by domestication and breeding bottlenecks and wild and exotic allele introgression−the former narrowing and the latter broadening genetic diversity. To assess single nucleotide polymorphism (SNP) frequencies, nucleotide diversity, and linkage disequilibrium (LD) in modern cultivars, alleles were resequenced from 81 genic loci distributed throughout the sunflower genome. DNA polymorphisms were abundant; 1078 SNPs (1/45.7 bp) and 178 insertions-deletions (INDELs) (1/277.0 bp) were identified in 49.4 kbp of DNA/genotype. SNPs were twofold more frequent in noncoding (1/32.1 bp) than coding (1/62.8 bp) sequences. Nucleotide diversity was only slightly lower in inbred lines (θ = 0.0094) than wild populations (θ = 0.0128). Mean haplotype diversity was 0.74. When extraploted across the genome (∼3500 Mbp), sunflower was predicted to harbor at least 76.4 million common SNPs among modern cultivar alleles. LD decayed more slowly in inbred lines than wild populations (mean LD declined to 0.32 by 5.5 kbp in the former, the maximum physical distance surveyed), a difference attributed to domestication and breeding bottlenecks. SNP frequencies and LD decay are sufficient in modern sunflower cultivars for very high-density genetic mapping and high-resolution association mapping. PMID:17660563

  16. Development of a 10,000 Locus Genetic Map of the Sunflower Genome Based on Multiple Crosses

    PubMed Central

    Bowers, John E.; Bachlava, Eleni; Brunick, Robert L.; Rieseberg, Loren H.; Knapp, Steven J.; Burke, John M.

    2012-01-01

    Genetic linkage maps have the potential to facilitate the genetic dissection of complex traits and comparative analyses of genome structure, as well as molecular breeding efforts in species of agronomic importance. Until recently, the majority of such maps was based on relatively low-throughput marker technologies, which limited marker density across the genome. The availability of high-throughput genotyping technologies has, however, made possible the efficient development of high-density genetic maps. Here, we describe the analysis and integration of genotypic data from four sunflower (Helianthus annuus L.) mapping populations to produce a consensus linkage map of the sunflower genome. Although the individual maps (which contained 3500–5500 loci each) were highly colinear, we observed localized variation in recombination rates in several genomic regions. We also observed several gaps up to 26 cM in length that completely lacked mappable markers in individual crosses, presumably due to regions of identity by descent in the mapping parents. Because these regions differed by cross, the consensus map of 10,080 loci contained no such gaps, clearly illustrating the value of simultaneously analyzing multiple mapping populations. PMID:22870395

  17. SNP Discovery and Development of a High-Density Genotyping Array for Sunflower

    PubMed Central

    Bachlava, Eleni; Taylor, Christopher A.; Tang, Shunxue; Bowers, John E.; Mandel, Jennifer R.; Burke, John M.; Knapp, Steven J.

    2012-01-01

    Recent advances in next-generation DNA sequencing technologies have made possible the development of high-throughput SNP genotyping platforms that allow for the simultaneous interrogation of thousands of single-nucleotide polymorphisms (SNPs). Such resources have the potential to facilitate the rapid development of high-density genetic maps, and to enable genome-wide association studies as well as molecular breeding approaches in a variety of taxa. Herein, we describe the development of a SNP genotyping resource for use in sunflower (Helianthus annuus L.). This work involved the development of a reference transcriptome assembly for sunflower, the discovery of thousands of high quality SNPs based on the generation and analysis of ca. 6 Gb of transcriptome re-sequencing data derived from multiple genotypes, the selection of 10,640 SNPs for inclusion in the genotyping array, and the use of the resulting array to screen a diverse panel of sunflower accessions as well as related wild species. The results of this work revealed a high frequency of polymorphic SNPs and relatively high level of cross-species transferability. Indeed, greater than 95% of successful SNP assays revealed polymorphism, and more than 90% of these assays could be successfully transferred to related wild species. Analysis of the polymorphism data revealed patterns of genetic differentiation that were largely congruent with the evolutionary history of sunflower, though the large number of markers allowed for finer resolution than has previously been possible. PMID:22238659

  18. Interrelationship between viscosity and electrical properties for edible oils.

    PubMed

    Kumar, Dilip; Singh, Amarjit; Tarsikka, Paramjit Singh

    2013-06-01

    Electrical properties of edible oil depend upon its total polar component, temperature and the frequency of the applied voltage. Dielectric constant, dielectric loss tangent and electrical conductivity were measured for cottonseed (Gossypium sp.), ground nut (Apios americana), mustard (Brasicca compestriss) and sun flower (Helianthus annuus) oils in the temperature range of 20 to 100°C so as to assess the potential of their applicability for assessing the quality of oils. Viscosity of the oils is an other important physical property associated with their processing and quality control. Viscosity of these oils was experimentally measured. The correlation of viscosity with dielectric loss tangent and viscosity with electrical conductivity were tested. The best correlating relations along with correlation constants, valid for the temperature range of 20-100°C are presented. The regression equation developed relating viscosity with loss tangent and electrical conductivity had high correlation coefficient (R(2) > 0.96) for all the four oils within temperature range of 20-100°C.

  19. Turgor and the transport of CO2 and water across the cuticle (epidermis) of leaves.

    PubMed

    Boyer, John S

    2015-05-01

    Leaf photosynthesis relies on CO₂ diffusing in while water vapour diffuses out. When stomata close, cuticle waxes on the epidermal tissues increasingly affect this diffusion. Also, changes in turgor can shrink or swell a leaf, varying the cuticle size. In this study, the properties of the cuticle were investigated while turgor varied in intact leaves of hypo stomatous grape (Vitis vinifera L.) or amphistomatous sunflower (Helianthus annuus L.). For grape, stomata on the abaxial surface were sealed and high CO₂ concentrations outside the leaf were used to maximize diffusion through the adaxial, stoma-free cuticle. For sunflower, stomata were closed in the dark or with abscisic acid to maximize the cuticle contribution to the path. In both species, the internal CO₂ concentration was measured directly and continuously while other variables were determined to establish the cuticle properties. The results indicated that stomatal closure diminished the diffusion of both gases in both species, but for CO₂ more than for water vapour. Decreasing the turgor diminished the movement of both gases through the cuticle of both species. Because this turgor effect was observed in the adaxial surface of grape, which had no stomata, it could only be attributed to cuticle tightening. Comparing calculated and measured concentrations of CO₂ in leaves revealed differences that became large as stomata began to close. These differences in transport, together with turgor effects, suggest calculations of the CO₂ concentration inside leaves need to be viewed with caution when stomata begin to close. PMID:25737532

  20. Cellulosic bioethanol production from Jerusalem artichoke (Helianthus tuberosus L.) using hydrogen peroxide-acetic acid (HPAC) pretreatment.

    PubMed

    Song, Younho; Wi, Seung Gon; Kim, Ho Myeong; Bae, Hyeun-Jong

    2016-08-01

    Jerusalem artichoke (JA) is recognized as a suitable candidate biomass crop for bioethanol production because it has a rapid growth rate and high biomass productivity. In this study, hydrogen peroxide-acetic acid (HPAC) pretreatment was used to enhance the enzymatic hydrolysis and to effectively remove the lignin of JA. With optimized enzyme doses, synergy was observed from the combination of three different enzymes (RUT-C30, pectinase, and xylanase) which provided a conversion rate was approximately 30% higher than the rate with from treatment with RUT-C30 alone. Fermentation of the JA hydrolyzates by Saccharomyces cerevisiae produced a fermentation yield of approximately 84%. Therefore, Jerusalem artichoke has potential as a bioenergy crop for bioethanol production. PMID:27115748