Teaching iSTART to Understand Spanish
ERIC Educational Resources Information Center
Dascalu, Mihai; Jacovina, Matthew E.; Soto, Christian M.; Allen, Laura K.; Dai, Jianmin; Guerrero, Tricia A.; McNamara, Danielle S.
2017-01-01
iSTART is a web-based reading comprehension tutor. A recent translation of iSTART from English to Spanish has made the system available to a new audience. In this paper, we outline several challenges that arose during the development process, specifically focusing on the algorithms that drive the feedback. Several iSTART activities encourage…
Starting geometry creation and design method for freeform optics.
Bauer, Aaron; Schiesser, Eric M; Rolland, Jannick P
2018-05-01
We describe a method for designing freeform optics based on the aberration theory of freeform surfaces that guides the development of a taxonomy of starting-point geometries with an emphasis on manufacturability. An unconventional approach to the optimization of these starting designs wherein the rotationally invariant 3rd-order aberrations are left uncorrected prior to unobscuring the system is shown to be effective. The optimal starting-point geometry is created for an F/3, 200 mm aperture-class three-mirror imager and is fully optimized using a novel step-by-step method over a 4 × 4 degree field-of-view to exemplify the design method. We then optimize an alternative starting-point geometry that is common in the literature but was quantified here as a sub-optimal candidate for optimization with freeform surfaces. A comparison of the optimized geometries shows the performance of the optimal geometry is at least 16× better, which underscores the importance of the geometry when designing freeform optics.
NASA Astrophysics Data System (ADS)
Wurdiyanto, G.; Candra, H.
2016-03-01
The standardization of radioactive sources (125I, 131I, 99mTc and 18F) to calibrate the nuclear medicine equipment had been carried out in PTKMR-BATAN. This is necessary because the radioactive sources used in the field of nuclear medicine has a very short half-life in other that to obtain a quality measurement results require special treatment. Besides that, the use of nuclear medicine techniques in Indonesia develop rapidly. All the radioactive sources were prepared by gravimetric methods. Standardization of 125I has been carried out by photon- photon coincidence methods, while the others have been carried out by gamma spectrometry methods. The standar sources are used to calibrate a Capintec CRC-7BT radionuclide calibrator. The results shows that calibration factor for Capintec CRC-7BT dose calibrator is 1,03; 1,02; 1,06; and 1,04 for 125I, 131I, 99mTc and 18F respectively, by about 5 to 6% of the expanded uncertainties.
[Ni(cod) 2][Al(OR F) 4], a Source for Naked Nickel(I) Chemistry
DOE Office of Scientific and Technical Information (OSTI.GOV)
Schwab, Miriam M.; Himmel, Daniel; Kacprzak, Sylwia
The straightforward synthesis of the cationic, purely organometallic Ni I salt [Ni(cod) 2] +[Al(OR F) 4] - was realized through a reaction between [Ni(cod) 2] and Ag[Al(OR F) 4] (cod=1,5-cyclooctadiene). Crystal-structure analysis and EPR, XANES, and cyclic voltammetry studies confirmed the presence of a homoleptic NiI olefin complex. Weak interactions between the metal center, the ligands, and the anion provide a good starting material for further cationic NiI complexes.
StairStepper: An Adaptive Remedial iSTART Module
ERIC Educational Resources Information Center
Perret, Cecile A.; Johnson, Amy M.; McCarthy, Kathryn S.; Guerrero, Tricia A.; Dai, Jianmin; McNamara, Danielle S.
2017-01-01
This paper introduces StairStepper, a new addition to Interactive Strategy Training for Active Reading and Thinking (iSTART), an intelligent tutoring system (ITS) that provides adaptive self-explanation training and practice. Whereas iSTART focuses on improving comprehension at levels geared toward answering challenging questions associated with…
47 CFR 1.10003 - When can I start operating?
Code of Federal Regulations, 2010 CFR
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false When can I start operating? 1.10003 Section 1.10003 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE International Bureau Filing System § 1.10003 When can I start operating? You can begin operating your facility or...
iSTART-2: A Reading Comprehension and Strategy Instruction Tutor
ERIC Educational Resources Information Center
Snow, Erica L.; Jacovina, Matthew E.; Jackson, G. Tanner; McNamara, Danielle S.
2016-01-01
This chapter provides an overview of the Interactive Strategy Tutor for Active Reading and Thinking-2 (iSTART-2). iSTART-2 is a game-based tutoring system designed to improve students' reading comprehension skills. It does so by providing them with instruction on how to self-explain using comprehension strategies. In this chapter, we first discuss…
Flight evaluation of the DEEC secondary control air-start capability
NASA Technical Reports Server (NTRS)
Johnson, J. B.; Nelson, J.
1983-01-01
The air-start capability of a secondary engine control (SEC) was tested for a DEEC-equipped F100 engine and installed in an F-15 airplane. Two air-start schedules were tested. The first was referred to as the group I schedule; the second or revised schedule was the group II start schedule. Using the group I start schedule, an airspeed of 300 knots was required to ensure successful 40- and 25-percent SEC-mode air starts. If N2 were less than 40 percent, a stall would occur when the start bleeds closed 40 sec after initiation of the air start. All JFS-assisted air starts were successful with the group start schedule. For the group II schedule, the time between pressurization and start-bleed closure ranged between 50 and 72 sec depending on altitude. All air starts were successful above 225 knots givin a 75-knot reduction in required airspeed for a successful air start. Spooldown air starts of 40 percent were successful at 200 knots at altitudes up to 10,650 m and at 175 knots at altitudes up to 6100 m. Idle rpm was lower than the desired 65 percent for air starts at higher altitudes and lower airspeeds. All JSF-assisted air starts were successful.
I(f) inhibition in cardiovascular diseases.
Thollon, Catherine; Vilaine, Jean-Paul
2010-01-01
Heart rate (HR) is determined by the pacemaker activity of cells from the sinoatrial node (SAN), located in the right atria. Spontaneous electrical activity of SAN cells results from a diastolic depolarization (DD). Despite controversy in the exact contribution of funny current (I(f)) in pacemaking, it is a major contributor of DD. I(f) is an inward Na(+)/K(+) current, activated upon hyperpolarization and directly modulated by cyclic adenosine monophosphate. The f-proteins are hyperpolarization-activated cyclic nucleotide-gated channels, HCN4 being the main isoform of SAN. Ivabradine (IVA) decreases DD and inhibits I(f) in a use-dependent manner. Under normal conditions IVA selectively reduces HR and limits exercise-induced tachycardia, in animals and young volunteers. Reduction in HR with IVA both decreases myocardial oxygen consumption and increases its supply due to prolongation of diastolic perfusion time. In animal models and in human with coronary artery disease (CAD), IVA has anti-anginal and anti-ischemic efficacy, equipotent to classical treatments, β-blockers, or calcium channel blockers. As expected from its selectivity for I(f), the drug is safe and well tolerated with minor visual side effects. As a consequence, IVA is the first inhibitor of I(f) approved for the treatment of stable angina. Available clinical data indicate that IVA could improve the management of stable angina in all patients including those treated with β-blockers. As chronic elevation of resting HR is an independent predictor of mortality, pure HR reduction by inhibition of I(f) could, beyond the control of anti-anginal symptoms, improve the prognosis of CAD and heart failure; this therapeutic potential is currently under evaluation with IVA. Copyright © 2010 Elsevier Inc. All rights reserved.
Haloacyl complexes of boron, [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br, I).
Finze, Maik; Bernhardt, Eduard; Willner, Helge; Lehmann, Christian W
2005-11-04
The haloacyltris(trifluoromethyl)borate anions [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br, I) have been synthesized by reacting (CF3)3BCO with either MHal (M=K, Cs; Hal=F) in SO2 or MHal (M=[nBu4N]+, [Et4N]+, [Ph4P]+; Hal=Cl, Br, I) in dichloromethane. Metathesis reactions of the fluoroacyl complex with Me3SiHal (Hal=Cl, Br, I) led to the formation of its higher homologues. The thermal stabilities of the haloacyltris(trifluoromethyl)borates decrease from the fluorine to the iodine derivative. The chemical reactivities decrease in the same order as demonstrated by a series of selected reactions. The new [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br) salts are used as starting materials in the syntheses of novel compounds that contain the (CF3)3B-C fragment. All borate anions [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br, I) have been characterized by multinuclear NMR spectroscopy (11B, 13C, 17O, 19F) and vibrational spectroscopy. [PPh4][(CF3)3BC(O)Br] crystallizes in the monoclinic space group P2/c (no. 13) and the bond parameters are compared with those of (CF3)3BCO and K[(CF3)3BC(O)F]. The interpretation of the spectroscopic and structural data are supported by DFT calculations [B3LYP/6-311+G(d)].
EEG-Informed fMRI: A Review of Data Analysis Methods
Abreu, Rodolfo; Leal, Alberto; Figueiredo, Patrícia
2018-01-01
The simultaneous acquisition of electroencephalography (EEG) with functional magnetic resonance imaging (fMRI) is a very promising non-invasive technique for the study of human brain function. Despite continuous improvements, it remains a challenging technique, and a standard methodology for data analysis is yet to be established. Here we review the methodologies that are currently available to address the challenges at each step of the data analysis pipeline. We start by surveying methods for pre-processing both EEG and fMRI data. On the EEG side, we focus on the correction for several MR-induced artifacts, particularly the gradient and pulse artifacts, as well as other sources of EEG artifacts. On the fMRI side, we consider image artifacts induced by the presence of EEG hardware inside the MR scanner, and the contamination of the fMRI signal by physiological noise of non-neuronal origin, including a review of several approaches to model and remove it. We then provide an overview of the approaches specifically employed for the integration of EEG and fMRI when using EEG to predict the blood oxygenation level dependent (BOLD) fMRI signal, the so-called EEG-informed fMRI integration strategy, the most commonly used strategy in EEG-fMRI research. Finally, we systematically review methods used for the extraction of EEG features reflecting neuronal phenomena of interest. PMID:29467634
1980-08-01
AXIAL- INITIAL [00 NS CL 13~ rf START DEGOF SATI END CONS;0LI- PRINCIPIAL s T. -s STRAIN AT PU n I DIE~)0.1 AT S f A RT OF IA WON STES I ru Pcf cO DA...SAM.PLE. LUCAII’N FIELD SMk -11 N,) (1711H CLOLOCIZ Cii... 3~ ( i_ . __ _ _ _ __ _ _ TNE I LNETU)D AT API’lOV’U) V~ CA CLASSIFICATION Il!LL ill/P1
20 CFR 404.240 - Old-start method-general.
Code of Federal Regulations, 2010 CFR
2010-04-01
....240 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Old-Start Method of Computing Primary Insurance Amounts § 404.240 Old-start method—general. If you had all or substantially all your social security...
Using "I Am Moving, I Am Learning" to Increase Quality Instruction in Head Start Classrooms
ERIC Educational Resources Information Center
Allar, Ishonté; Jones, Emily; Bulger, Sean
2018-01-01
Quality teacher-child interactions are characteristic of effective classrooms resulting in benefits for all children, but may be particularly important for children from low-income families. The purpose of this study was to explore the perception of Illinois Head Start teachers related to how "I am Moving, I am Learning" (IMIL) could…
iSTART Therefore I Understand: But Metacognitive Supports Did Not Enhance Comprehension Gains
ERIC Educational Resources Information Center
McCarthy, Kathryn S.; Jacovina, Matthew E.; Snow, Erica L.; Guerrero, Tricia A.; McNamara, Danielle S.
2017-01-01
iSTART is an intelligent tutoring system designed to provide self-explanation instruction and practice to improve students' comprehension of complex, challenging text. This study examined the effects of extended game-based practice within the system as well as the effects of two metacognitive supports implemented within this practice. High school…
Adaptive Reading and Writing Instruction in iSTART and W-Pal
ERIC Educational Resources Information Center
Johnson, Amy M.; McCarthy, Kathryn S.; Kopp, Kristopher J.; Perret, Cecile A.; McNamara, Danielle S.
2017-01-01
Intelligent tutoring systems for ill-defined domains, such as reading and writing, are critically needed, yet uncommon. Two such systems, the Interactive Strategy Training for Active Reading and Thinking (iSTART) and Writing Pal (W-Pal) use natural language processing (NLP) to assess learners' written (i.e., typed) responses and provide immediate,…
[Women of 40 and older in i.v.f. and i.c.s.i.: the FIVNAT data].
Belaisch-Allart, J; Devaux, A; Ayel, J-P; de Mouzon, J
2004-09-01
The proportion of women over 40 in i.v.f. and in i.c.s.i. has been dramatically increasing to reach 12% in 2002. Tubal and unexplained infertility increases with age. Short protocols or protocols with GnRH antagonists are more and more often used for older women. Best results are nevertheless still obtained with long protocols! Up to 35 years, pregnancy rates are similar with two or three transferred embryos. Over 35, better results are observed with three embryos. However, the rate of twins only falls below 20% when the woman is over 38, in i.v.f. as well as in i.c.s.i. The decreasing pregnancy rate should be better known by patients and clinicians so that women are treated sooner for i.v.f.
Natural Language Processing and Game-Based Practice in iSTART
ERIC Educational Resources Information Center
Jackson, Tanner; Boonthum-Denecke, Chutima; McNamara, Danielle
2015-01-01
Intelligent Tutoring Systems (ITSs) are situated in a potential struggle between effective pedagogy and system enjoyment and engagement. iSTART (Interactive Strategy Training for Active Reading and Thinking), a reading strategy tutoring system in which students practice generating self-explanations and using reading strategies, employs two devices…
Wang, Chao; Cen, Kefa; Ni, Mingjiang; Li, Xiaodong
2018-01-01
Polychlorinated dibenzo-p-dioxin and polychlorinated dibenzofuran (PCDD/F) emission characteristics and vapour/particulate phase partitions under three continued operation conditions, i.e. shut-down, start-up and after start-up, were investigated by sampling stack gas. The results indicated that the PCDD/F emission levels were 0.40–18.03 ng I-TEQ Nm−3, much higher than the annual monitoring level (0.016 ng I-TEQ Nm−3). Additionally, the PCDD/F emission levels in start-up were higher than the other two conditions. Furthermore, the PCDD/F congener profiles differed markedly between shut-down and start-up, and the chlorination degree of PCDD/F increased in shut-down and decreased evidently in start-up. Moreover, PCDD/F vapour/particulate phase distributions varied significantly under three transient conditions. The PCDD/F vapour phase proportion decreased as the shut-down process continued, then increased as the start-up process proceeded, finally more than 98% of the PCDD/F congeners were distributed in the vapour phase after start-up. The correlations between log(Cv/Cs) versus log pL0 of each PCDD/F congener in stack gas were disorganized in shut-down, and trend to a linear distribution after start-up. Besides, polychlorinated biphenyl emissions show behaviour similar to that of PCDD/F, and the lower chlorinated congeners have a stronger relationship with 2,3,7,8-PCDD/Fs, such as M1CB and D2CB. PMID:29410821
Natural Language Processing and Game-Based Practice in iSTART
ERIC Educational Resources Information Center
Jackson, G. Tanner; Boonthum-Denecke, Chutima; McNamara, Danielle S.
2015-01-01
Intelligent Tutoring Systems (ITSs) are situated in a potential struggle between effective pedagogy and system enjoyment and engagement. iSTART, a reading strategy tutoring system in which students practice generating self-explanations and using reading strategies, employs two devices to engage the user. The first is natural language processing…
Dynamics of the F(-) + CH3I → HF + CH2I(-) Proton Transfer Reaction.
Zhang, Jiaxu; Xie, Jing; Hase, William L
2015-12-17
Direct chemical dynamics simulations, at collision energies Erel of 0.32 and 1.53 eV, were performed to obtain an atomistic understanding of the F(-) + CH3I reaction dynamics. There is only the F(-) + CH3I → CH3F + I(-) bimolecular nucleophilic substitution SN2 product channel at 0.32 eV. Increasing Erel to 1.53 eV opens the endothermic F(-) + CH3I → HF + CH2I(-) proton transfer reaction, which is less competitive than the SN2 reaction. The simulations reveal proton transfer occurs by two direct atomic-level mechanisms, rebound and stripping, and indirect mechanisms, involving formation of the F(-)···HCH2I complex and the roundabout. For the indirect trajectories all of the CH2I(-) is formed with zero-point energy (ZPE), while for the direct trajectories 50% form CH2I(-) without ZPE. Without a ZPE constraint for CH2I(-), the reaction cross sections for the rebound, stripping, and indirect mechanisms are 0.2 ± 0.1, 1.2 ± 0.4, and 0.7 ± 0.2 Å(2), respectively. Discarding trajectories that do not form CH2I(-) with ZPE reduces the rebound and stripping cross sections to 0.1 ± 0.1 and 0.7 ± 0.5 Å(2). The HF product is formed rotationally and vibrationally unexcited. The average value of J is 2.6 and with histogram binning n = 0. CH2I(-) is formed rotationally excited. The partitioning between CH2I(-) vibration and HF + CH2I(-) relative translation energy depends on the treatment of CH2I(-) ZPE. Without a CH2I(-) ZPE constraint the energy partitioning is primarily to relative translation with little CH2I(-) vibration. With a ZPE constraint, energy partitioning to CH2I(-) rotation, CH2I(-) vibration, and relative translation are statistically the same. The overall F(-) + CH3I rate constant at Erel of both 0.32 and 1.53 eV is in good agreement with experiment and negligibly affected by the treatment of CH2I(-) ZPE, since the SN2 reaction is the major contributor to the total reaction rate constant. The potential energy surface and reaction dynamics for F
Varrone, Andrea; Gulyás, Balázs; Takano, Akihiro; Stabin, Michael G; Jonsson, Cathrine; Halldin, Christer
2012-02-01
[(18)F]FE-PE2I is a promising dopamine transporter (DAT) radioligand. In nonhuman primates, we examined the accuracy of simplified quantification methods and the estimates of radiation dose of [(18)F]FE-PE2I. In the quantification study, binding potential (BP(ND)) values previously reported in three rhesus monkeys using kinetic and graphical analyses of [(18)F]FE-PE2I were used for comparison. BP(ND) using the cerebellum as reference region was obtained with four reference tissue methods applied to the [(18)F]FE-PE2I data that were compared with the kinetic and graphical analyses. In the whole-body study, estimates of adsorbed radiation were obtained in two cynomolgus monkeys. All reference tissue methods provided BP(ND) values within 5% of the values obtained with the kinetic and graphical analyses. The shortest imaging time for stable BP(ND) estimation was 54 min. The average effective dose of [(18)F]FE-PE2I was 0.021 mSv/MBq, similar to 2-deoxy-2-[(18)F]fluoro-d-glucose. The results in nonhuman primates suggest that [(18)F]FE-PE2I is suitable for accurate and stable DAT quantification, and its radiation dose estimates would allow for a maximal administered radioactivity of 476 MBq in human subjects. Copyright © 2012 Elsevier Inc. All rights reserved.
Muckraking Free Speech: I.F. Stone and the Trial of Socrates.
ERIC Educational Resources Information Center
Birkhead, Douglas
1989-01-01
Reviews I.F. Stone's "The Trial of Socrates," discussing the application of Stone's particular perspective (vintage American liberalism) and method (the muckraking tradition) to his reassessment of democracy and free speech in ancient Athens via Socrates' trial and condemnation. Compares Ancient Greek and modern concepts of free speech…
123I-Mibg scintigraphy and 18F-Fdg-Pet imaging for diagnosing neuroblastoma
Bleeker, Gitta; Tytgat, Godelieve Am; Adam, Judit A; Caron, Huib N; Kremer, Leontien Cm; Hooft, Lotty; van Dalen, Elvira C
2015-01-01
accuracy of 18F-FDG-PET(-CT) imaging in case of a negative 123I-MIBG scintigraphy could not be calculated, because only very limited data were available. Also the detection of the diagnostic accuracy of index test 18F-FDG-PET(-CT) imaging for detecting a neuroblastoma tumour and its metastases, and to compare this to comparator test 123I-MIBG (SPECT-CT) scintigraphy, could not be calculated because of the limited available data at time of this search. At the start of this project, we did not expect to find only very limited data on specificity. We now consider it would have been more appropriate to use the term "the sensitivity to assess the presence of neuroblastoma" instead of "diagnostic accuracy" for the objectives. PLAIN LANGUAGE SUMMARY 123I-MIBG- and 18F-FDG-PET-imaging, two nuclear imaging methods for diagnosing neuroblastoma tumours Background and rationale Neuroblastoma is a childhood tumour that can be visualized by a specific nuclear imaging compound, called metaiodobenzylguanidine (123I -MIBG). 123I-MIBG-imaging is not only important for the diagnosis of neuroblastoma, but also for localization of metastases (spread of the disease to other organs). Sometimes, the neuroblastoma does not take up 123I-MIBG and as a result the neuroblastoma is not visible on the scan. In that case, another type of nuclear imaging might be useful to visualize the neuroblastoma: fluoro-deoxy-glucose – positron emission tomography (18F-FDG-PET)-imaging. In the literature the ability to discriminate between neuroblastoma and non-neuroblastoma lesions for these two types of nuclear imaging methods vary. Prognosis, treatment and response to therapy of patients with neuroblastoma are currently based on scoring the amount of metastases per body segment visible on 123I-MIBG scans. Therefore, it is important to determine the exact ability to discriminate between neuroblastoma and non-neuroblastoma on 123I-MIBG-imaging and 18F-FDG-PET-imaging. We reviewed the evidence about the accuracy of
Ackermann, Uwe; Plougastel, Lucie; Goh, Yit Wooi; Yeoh, Shinn Dee; Scott, Andrew M
2014-12-01
The synthesis of [(18)F]2-fluoroethyl azide and its subsequent click reaction with 5-ethynyl-2'-deoxyuridine (EDU) to form [(18)F]FLETT was performed using an iPhase FlexLab module. The implementation of a vacuum distillation method afforded [(18)F]2-fluoroethyl azide in 87±5.3% radiochemical yield. The use of Cu(CH3CN)4PF6 and TBTA as catalyst enabled us to fully automate the [(18)F]FLETT synthesis without the need for the operator to enter the radiation field. [(18)F]FLETT was produced in higher overall yield (41.3±6.5%) and shorter synthesis time (67min) than with our previously reported manual method (32.5±2.5% in 130min). Copyright © 2014 Elsevier Ltd. All rights reserved.
Daily iTBS worsens hand motor training--a combined TMS, fMRI and mirror training study.
Läppchen, C H; Ringer, T; Blessin, J; Schulz, K; Seidel, G; Lange, R; Hamzei, F
2015-02-15
Repetitive transcranial magnetic stimulation (rTMS) is used to increase regional excitability to improve motor function in combination with training after neurological diseases or events such as stroke. We investigated whether a daily application of intermittent theta burst stimulation (iTBS; a short-duration rTMS that increases regional excitability) improves the training effect compared with sham stimulation in association with a four-day hand training program using a mirror (mirror training, MT). The right dorsal premotor cortex (dPMC right) was chosen as the target region for iTBS because this region has recently been emphasized as a node within a network related to MT. Healthy subjects were randomized into the iTBS group or sham group (control group CG). In the iTBS group, iTBS was applied daily over dPMC right, which was functionally determined in an initial fMRI session prior to starting MT. MT involved 20 min of hand training daily in a mirror over four days. The hand tests, the intracortical excitability and fMRI were evaluated prior to and at the end of MT. The results of the hand training tests of the iTBS group were surprisingly significantly poorer compared with those from the CG group. Both groups showed a different course of excitability in both M1 and a different course of fMRI activation within the supplementary motor area and M1 left. We suggest the inter-regional functional balance was affected by daily iTBS over dPMC right. Maybe an inter-regional connectivity within a network is differentially balanced. An excitability increase within an inhibitory-balanced network would therefore disturb the underlying network. Copyright © 2014 Elsevier Inc. All rights reserved.
Phase I. Lanthanum-based Start Materials for Hydride Batteries
DOE Office of Scientific and Technical Information (OSTI.GOV)
Gschneidner, K. A.; Schmidt, F. A.; Frerichs, A. E.
The purpose of Phase I of this work is to focus on developing a La-based start material for making nickel-metal (lanthanum)-hydride batteries based on our carbothermic-silicon process. The goal is to develop a protocol for the manufacture of (La 1-xR x)(Ni 1-yM y)(Si z), where R is a rare earth metal and M is a non-rare earth metal, to be utilized as the negative electrode in nickel-metal hydride (NiMH) rechargeable batteries.
The Quality of the Head Start Planned Variation Data. Volume I.
ERIC Educational Resources Information Center
Walker, Debbie Klein; And Others
This publication, the first of two volumes, describes the cognitive, psychomotor, and socioemotional measures used in all years of the Head Start Planned Variation Evaluation. Part I discusses generally the issues involved in evaluating the quality of the data, and summarizes findings. Part II contains technical reports on 12 of the individual…
Coutinho, Artur M.N.; Porto, Fábio H.G.; Zampieri, Poliana F.; Otaduy, Maria C.; Perroco, Tíbor R.; Oliveira, Maira O.; Nunes, Rafael F.; Pinheiro, Toulouse Leusin; Bottino, Cassio M.C.; Leite, Claudia C.; Buchpiguel, Carlos A.
2015-01-01
Reduction of regional brain glucose metabolism (rBGM) measured by [18F]FDG-PET in the posterior cingulate cortex (PCC) has been associated with a higher conversion rate from mild cognitive impairment (MCI) to Alzheimer's disease (AD). Magnetic Resonance Spectroscopy (MRS) is a potential biomarker that has disclosed Naa/mI reductions within the PCC in both MCI and AD. Studies investigating the relationships between the two modalities are scarce. Objective To evaluate differences and possible correlations between the findings of rBGM and NAA/mI in the PCC of individuals with AD, MCI and of cognitively normal volunteers. Methods Patients diagnosed with AD (N=32) or MCI (N=27) and cognitively normal older adults (CG, N=28), were submitted to [18F]FDG-PET and MRS to analyze the PCC. The two methods were compared and possible correlations between the modalities were investigated. Results The AD group exhibited rBGM reduction in the PCC when compared to the CG but not in the MCI group. MRS revealed lower NAA/mI values in the AD group compared to the CG but not in the MCI group. A positive correlation between rBGM and NAA/mI in the PCC was found. NAA/mI reduction in the PCC differentiated AD patients from control subjects with an area under the ROC curve of 0.70, while [18F]FDG-PET yielded a value of 0.93. Conclusion rBGM and Naa/mI in the PCC were positively correlated in patients with MCI and AD. [18F]FDG-PET had greater accuracy than MRS for discriminating AD patients from controls. PMID:29213988
NASA Technical Reports Server (NTRS)
Smedley, J. E.; Leone, S. R.
1983-01-01
Wavelength-specific relative quantum yields of metastable I from pulsed laser photodissociation of i-C3F7I and n-C3F7I in the range 265-336 nm are determined by measuring the time-resolved infrared emission from the atomic I(P-2(1/2) P-2(3/2) transition. It is shown that although this yield appears to be unity from 265 to 298 nm, it decreases dramatically at longer wavelengths. Values are also reported for the enhancement of emission from metastable I due to exciplex formation at several temperatures. The exciplex formation emission increases linearly with parent gas pressure, but decreases with increasing temperature. Absorption spectra of i- and n-C3F7I between 303 and 497 K are presented, and the effect of temperature on the quantum yields at selected wavelengths greater than 300 nm, where increasing the temperature enhances the absorption considerably, are given. The results are discussed in regard to the development of solar-pumped iodine lasers.
Malinowski, Przemysław J; Kurzydłowski, Dominik; Grochala, Wojciech
2015-12-07
The reaction of AgF2 with P2O3F4 yields a mixed valence Ag(I)/Ag(II) difluorophosphate salt with AgAg(PO2F2)14 stoichiometry - the first Ag(ii)-PO2F2 system known. This highly moisture sensitive brown solid is thermally stable up to 120 °C, which points at further feasible extension of the chemistry of Ag(ii)-PO2F2 systems. The crystal structure shows a very complex bonding pattern, comprising of polymeric Ag(PO2F2)14(4-) anions and two types of Ag(I) cations. One particular Ag(II) site present in the crystal structure of Ag9(PO2F2)14 is the first known example of square pyramidal penta-coordinated Ag(ii) in an oxo-ligand environment. Ag(i)PO2F2 - the product of the thermal decomposition of Ag9(PO2F2)14 - has also been characterized by thermal analysis, IR spectroscopy and X-ray powder diffraction. It has a complicated crystal structure as well, which consists of infinite 1D [Ag(I)O4/2] chains which are linked to more complex 3D structures via OPO bridges. The PO2F2(-) anions bind to cations in both compounds as bidentate oxo-ligands. The terminal F atoms tend to point inside the van der Waals cavities in the crystal structure of both compounds. All important structural details of both title compounds were corroborated by DFT calculations.
Yan, Ji-Geng; Zhang, Lin-ling; Agresti, Michael; Yan, Yuhui; LoGiudice, John; Sanger, James R.; Matloub, Hani S.; Pritchard, Kirkwood A.; Jaradeh, Safwan S.; Havlik, Robert
2017-01-01
Background Insidious cumulative brain injury from motor vehicle-induced whole-body vibration (MV-WBV) has not yet been studied. The objective of the present study is to validate whether whole-body vibration for long periods causes cumulative brain injury and impairment of the cerebral function. We also explored a preventive method for MV-WBV injury. Methods A study simulating whole-body vibration was conducted in 72 male Sprague-Dawley rats divided into 9 groups (N = 8): (1) 2-week normal control; (2) 2-week sham control (in the tube without vibration); (3) 2-week vibration (exposed to whole-body vibration at 30 Hz and .5 G acceleration for 4 hours/day, 5 days/week for 2 weeks; vibration parameters in the present study are similar to the most common driving conditions); (4) 4-week sham control; (5) 4-week vibration; (6) 4-week vibration with human apolipoprotein A-I molecule mimetic (4F)-preconditioning; (7) 8-week sham control; (8) 8-week vibration; and (9) 8-week 4F-preconditioning group. All the rats were evaluated by behavioral, physiological, and histological studies of the brain. Results Brain injury from vibration is a cumulative process starting with cerebral vasoconstriction, squeezing of the endothelial cells, increased free radicals, decreased nitric oxide, insufficient blood supply to the brain, and repeated reperfusion injury to brain neurons. In the 8-week vibration group, which indicated chronic brain edema, shrunken neuron numbers increased and whole neurons atrophied, which strongly correlated with neural functional impairment. There was no prominent brain neuronal injury in the 4F groups. Conclusions The present study demonstrated cumulative brain injury from MV-WBV and validated the preventive effects of 4F preconditioning. PMID:26433438
Code of Federal Regulations, 2011 CFR
2011-01-01
... 5 Administrative Personnel 2 2011-01-01 2011-01-01 false May I keep my dental and/or vision... DENTAL AND VISION INSURANCE PROGRAM Annuitants and Compensationers § 894.701 May I keep my dental and/or vision coverage when I retire or start receiving workers' compensation? (a) Your FEDVIP coverage...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false May I keep my dental and/or vision... DENTAL AND VISION INSURANCE PROGRAM Annuitants and Compensationers § 894.701 May I keep my dental and/or vision coverage when I retire or start receiving workers' compensation? (a) Your FEDVIP coverage...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 5 Administrative Personnel 2 2013-01-01 2013-01-01 false May I keep my dental and/or vision coverage when I retire or start receiving workers' compensation? 894.701 Section 894.701 Administrative... DENTAL AND VISION INSURANCE PROGRAM Annuitants and Compensationers § 894.701 May I keep my dental and/or...
Code of Federal Regulations, 2014 CFR
2014-01-01
... 5 Administrative Personnel 2 2014-01-01 2014-01-01 false May I keep my dental and/or vision coverage when I retire or start receiving workers' compensation? 894.701 Section 894.701 Administrative... DENTAL AND VISION INSURANCE PROGRAM Annuitants and Compensationers § 894.701 May I keep my dental and/or...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 5 Administrative Personnel 2 2012-01-01 2012-01-01 false May I keep my dental and/or vision coverage when I retire or start receiving workers' compensation? 894.701 Section 894.701 Administrative... DENTAL AND VISION INSURANCE PROGRAM Annuitants and Compensationers § 894.701 May I keep my dental and/or...
Metacognitive Prompt Overdose: Positive and Negative Effects of Prompts in iSTART
ERIC Educational Resources Information Center
McCarthy, Kathryn S.; Johnson, Amy M.; Likens, Aaron D.; Martin, Zachary; McNamara, Danielle S.
2017-01-01
Interactive Strategy Training for Active Reading and Thinking (iSTART) is an intelligent tutoring system that supports reading comprehension through self-explanation (SE) training. This study tested how two metacognitive features, presented in a 2 x 2 design, affected students' SE scores during training. The "performance notification"…
Start-Up of a Pulsed Beam Free Electron Laser (FEL) Oscillator
1983-04-01
By slightly increasing the frequency of the R.F. accelerating field, Wacc during the start-up period, i.e., decreasing the beam pulse separation, the...levels. The required fractional increase in Wacc is 16L 1- 6L2 1/Lbow 10 - 6 for the parameters of ref. (3,4). The same 6 effect may also be realized
Command Flight Path Display. Phase I and II. Appendix F.
1983-09-01
AD -R145 858 COMMAND FLIGHT PATH DISPLAY PHASE I AND 11 APPENDIX F / (U) SYSTEMS ASSOCIATES INC LONG BEACH CA RESOURCE MANAGEMENT SYSTEMS DIY SEP...34- (Appendix F) .ś. SYSTEMS ASSOCIATES INC* of CALIFORNIA t. Resource Management Systems Division DTICL it~~~ll ELECTE 1 o..-- , ~SEP 2 4 1984...Availability Codos Avail and/or Dist Special "i j L i 7 7 .... Contained in this appendix are the various plots generated dur- ing data reduction. Parameters
Pellegrino, Giovanni; Machado, Alexis; von Ellenrieder, Nicolas; Watanabe, Satsuki; Hall, Jeffery A.; Lina, Jean-Marc; Kobayashi, Eliane; Grova, Christophe
2016-01-01
Objective: We aimed at studying the hemodynamic response (HR) to Interictal Epileptic Discharges (IEDs) using patient-specific and prolonged simultaneous ElectroEncephaloGraphy (EEG) and functional Near InfraRed Spectroscopy (fNIRS) recordings. Methods: The epileptic generator was localized using Magnetoencephalography source imaging. fNIRS montage was tailored for each patient, using an algorithm to optimize the sensitivity to the epileptic generator. Optodes were glued using collodion to achieve prolonged acquisition with high quality signal. fNIRS data analysis was handled with no a priori constraint on HR time course, averaging fNIRS signals to similar IEDs. Cluster-permutation analysis was performed on 3D reconstructed fNIRS data to identify significant spatio-temporal HR clusters. Standard (GLM with fixed HRF) and cluster-permutation EEG-fMRI analyses were performed for comparison purposes. Results: fNIRS detected HR to IEDs for 8/9 patients. It mainly consisted oxy-hemoglobin increases (seven patients), followed by oxy-hemoglobin decreases (six patients). HR was lateralized in six patients and lasted from 8.5 to 30 s. Standard EEG-fMRI analysis detected an HR in 4/9 patients (4/9 without enough IEDs, 1/9 unreliable result). The cluster-permutation EEG-fMRI analysis restricted to the region investigated by fNIRS showed additional strong and non-canonical BOLD responses starting earlier than the IEDs and lasting up to 30 s. Conclusions: (i) EEG-fNIRS is suitable to detect the HR to IEDs and can outperform EEG-fMRI because of prolonged recordings and greater chance to detect IEDs; (ii) cluster-permutation analysis unveils additional HR features underestimated when imposing a canonical HR function (iii) the HR is often bilateral and lasts up to 30 s. PMID:27047325
Haupa, Karolina Anna; Lim, Manho; Lee, Yuan-Pern
2018-05-09
The photolysis of 1,2-diiodotetrafluoroethane (CF2ICF2I) has served as a prototypical system in ultrafast reaction dynamics. Even though the intermediates, anti- and gauche-iodotetrafluoroethyl (˙C2F4I) radicals, have been characterized with electron diffraction and X-ray diffraction, their infrared spectra are unreported. We report the formation and infrared identification of these radical intermediates upon ultraviolet photodissociation of CF2ICF2I in solid para-hydrogen (p-H2) at 3.3 K. Lines at 1364.9/1358.5, 1283.2, 1177.1, 1162.2, 1126.8, 837.3, 658.0, 574.2, and 555.2 cm-1 are assigned to anti-˙C2F4I, and lines at 1325.9, 1259.7, 1143.4, 1063.4, 921.0, and 765.3 cm-1 to gauche-˙C2F4I. A secondary photodissociation leading to C2F4 was also observed. The assignments were derived according to behavior on secondary photolysis, comparison of the vibrational wavenumbers and the IR intensities of the observed lines with values predicted with the B3PW91/aug-cc-pVTZ-pp method. This spectral identification provides valuable information for future direct spectral probes of these important intermediates.
Werner, Rudolf A; Rischpler, Christoph; Onthank, David; Lapa, Constantin; Robinson, Simon; Samnick, Samuel; Javadi, Mehrbod; Schwaiger, Markus; Nekolla, Stephan G; Higuchi, Takahiro
2015-09-01
(18)F-N-[3-bromo-4-(3-fluoro-propoxy)-benzyl]-guanidine ((18)F-LMI1195) is a new PET tracer designed for noninvasive assessment of sympathetic innervation of the heart. The (18)F label facilitates the imaging advantages of PET over SPECT technology while allowing centralized manufacturing. Highly specific neural uptake of (18)F-LMI1195 has previously been established, but the retention kinetics are not yet fully understood. Healthy New Zealand White rabbits were studied with (18)F-LMI1195 using a small-animal PET system. Dynamic 40-min chest scans were started just before intravenous bolus injection of (18)F-LMI1195. Imaging was performed under norepinephrine transport inhibition with desipramine pretreatment, a 1.5 mg/kg desipramine chase administered 10 min after tracer injection, and saline treatment of controls. As a reference, cardiac uptake of (11)C-hydroxyephedrine and (123)I-metaiodobenzylguanidine ((123)I-MIBG) was examined by PET and planar scintigraphy, respectively. Cardiac uptake of all 3 tracers was inhibited by pretreatment with desipramine. Stable cardiac tracer retention was delineated by dynamic PET in control rabbits for (11)C-hydroxyephedrine (washout rate, 0.42% ± 0.57%/min) and (18)F-LMI1195 (washout rate, 0.058% ± 0.28%/min). A desipramine chase increased (11)C-hydroxyephedrine washout from the heart (2.43% ± 0.15%/min, P < 0.001), whereas (18)F-LMI1195 washout was not influenced (0.059% ± 0.11%/min, not statistically significant). Additionally, a desipramine chase did not change the cardiac (123)I-MIBG uptake (delayed heart-to-mediastinum ratio, 1.99 ± 0.12 (desipramine chase) vs. 2.05 ± 0.16 (controls), not statistically significant). In vivo norepinephrine transporter (NET) blockade with desipramine confirmed specific neural uptake of (18)F-LMI1195, (11)C-hydroxyephedrine, and (123)I-MIBG in rabbit hearts. (11)C-hydroxyephedrine cardiac retention was sensitive to a NET inhibitor chase, indicating a cycle of continuous NET uptake and
123I-MIBG scintigraphy and 18F-FDG-PET imaging for diagnosing neuroblastoma.
Bleeker, Gitta; Tytgat, Godelieve A M; Adam, Judit A; Caron, Huib N; Kremer, Leontien C M; Hooft, Lotty; van Dalen, Elvira C
2015-09-29
be calculated, because only very limited data were available. Also the detection of the diagnostic accuracy of index test (18)F-FDG-PET(-CT) imaging for detecting a neuroblastoma tumour and its metastases, and to compare this to comparator test ¹²³I-MIBG (SPECT-CT) scintigraphy, could not be calculated because of the limited available data at time of this search.At the start of this project, we did not expect to find only very limited data on specificity. We now consider it would have been more appropriate to use the term "the sensitivity to assess the presence of neuroblastoma" instead of "diagnostic accuracy" for the objectives.
Can f(R) gravity contribute to (dark) radiation?
DOE Office of Scientific and Technical Information (OSTI.GOV)
Morais, João; Bouhmadi-López, Mariam; Capozziello, Salvatore, E-mail: jviegas001@ikasle.ehu.eus, E-mail: mbl@ubi.pt, E-mail: capozziello@na.infn.it
2015-09-01
We discuss the possibility that suitable modifications of gravity could account for some amount of the radiation we observe today, in addition to the possibility of explaining the present speed up of the universe. We start introducing and reviewing cosmological reconstruction methods for metric f(R) theories of gravity that can be considered as one of the straightforward modifications of Einstein's gravity as soon as f(R)≠ R. We then take into account two possible f(R) models which could give rise to (dark) radiation. Constraints on the models are found by using the Planck Collaboration 2015 data within a cosmographic approach and bymore » obtaining the matter power spectrum of those models. The conclusion is that f(R) gravity can only contribute minimally to the (dark) radiation to avoid departures from the observed matter power spectrum at the smallest scales (of the order of 0.01Mpc{sup −1}), i.e., precisely those scales that exited the horizon at the radiation dominated epoch. This result could strongly contribute to select reliable f(R) models.« less
Remote sensing of the ionospheric F layer by use of O I 6300-A and O I 1356-A observations
NASA Technical Reports Server (NTRS)
Chandra, S.; Reed, E. I.; Meier, R. R.; Opal, C. B.; Hicks, G. T.
1975-01-01
The possibility of using airglow techniques for estimating the electron density and height of the F layer is studied on the basis of a simple relationship between the height of the F2 peak and the column emission rates of the O I 6300 A and O I 1356 A lines. The feasibility of this approach is confirmed by a numerical calculation of F2 peak heights and electron densities from simultaneous measurements of O I 6300 A and O I 1356 A obtained with earth-facing photometers carried by the Ogo 4 satellite. Good agreement is established with the F2 peak heights estimates from top-side and bottom-side ionospheric sounding.
Coutinho, Artur M N; Porto, Fábio H G; Zampieri, Poliana F; Otaduy, Maria C; Perroco, Tíbor R; Oliveira, Maira O; Nunes, Rafael F; Pinheiro, Toulouse Leusin; Bottino, Cassio M C; Leite, Claudia C; Buchpiguel, Carlos A
2015-01-01
Reduction of regional brain glucose metabolism (rBGM) measured by [18F]FDG-PET in the posterior cingulate cortex (PCC) has been associated with a higher conversion rate from mild cognitive impairment (MCI) to Alzheimer's disease (AD). Magnetic Resonance Spectroscopy (MRS) is a potential biomarker that has disclosed Naa/mI reductions within the PCC in both MCI and AD. Studies investigating the relationships between the two modalities are scarce. To evaluate differences and possible correlations between the findings of rBGM and NAA/mI in the PCC of individuals with AD, MCI and of cognitively normal volunteers. Patients diagnosed with AD (N=32) or MCI (N=27) and cognitively normal older adults (CG, N=28), were submitted to [18F]FDG-PET and MRS to analyze the PCC. The two methods were compared and possible correlations between the modalities were investigated. The AD group exhibited rBGM reduction in the PCC when compared to the CG but not in the MCI group. MRS revealed lower NAA/mI values in the AD group compared to the CG but not in the MCI group. A positive correlation between rBGM and NAA/mI in the PCC was found. NAA/mI reduction in the PCC differentiated AD patients from control subjects with an area under the ROC curve of 0.70, while [18F]FDG-PET yielded a value of 0.93. rBGM and Naa/mI in the PCC were positively correlated in patients with MCI and AD. [18F]FDG-PET had greater accuracy than MRS for discriminating AD patients from controls.
iSTART-ALL: Confronting Adult Low Literacy with Intelligent Tutoring for Reading Comprehension
ERIC Educational Resources Information Center
Johnson, Amy M.; Guerrero, Tricia A.; Tighe, Elizabeth L.; McNamara, Danielle S.
2017-01-01
There is little empirical research available on the substantial problem of adult low literacy rates, and limited educational technologies are available to address distinct instructional needs of this population. This paper reports on development and testing of a version of Interactive Strategy Training for Active Reading and Thinking (iSTART) for…
7 CFR 15f.26 - May I seek judicial review of the final determination?
Code of Federal Regulations, 2013 CFR
2013-01-01
... 7 Agriculture 1 2013-01-01 2013-01-01 false May I seek judicial review of the final determination? 15f.26 Section 15f.26 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 What if I Do Not Agree With the Final Determination by USDA? § 15f.26 May I seek judicial review...
7 CFR 15f.26 - May I seek judicial review of the final determination?
Code of Federal Regulations, 2014 CFR
2014-01-01
... 7 Agriculture 1 2014-01-01 2014-01-01 false May I seek judicial review of the final determination? 15f.26 Section 15f.26 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 What if I Do Not Agree With the Final Determination by USDA? § 15f.26 May I seek judicial review...
7 CFR 15f.26 - May I seek judicial review of the final determination?
Code of Federal Regulations, 2012 CFR
2012-01-01
... 7 Agriculture 1 2012-01-01 2012-01-01 false May I seek judicial review of the final determination? 15f.26 Section 15f.26 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 What if I Do Not Agree With the Final Determination by USDA? § 15f.26 May I seek judicial review...
7 CFR 15f.26 - May I seek judicial review of the final determination?
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 1 2011-01-01 2011-01-01 false May I seek judicial review of the final determination? 15f.26 Section 15f.26 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 What if I Do Not Agree With the Final Determination by USDA? § 15f.26 May I seek judicial review...
7 CFR 15f.26 - May I seek judicial review of the final determination?
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false May I seek judicial review of the final determination? 15f.26 Section 15f.26 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 What if I Do Not Agree With the Final Determination by USDA? § 15f.26 May I seek judicial review...
Pardo, Beatriz; Paz-Ares, Luis; Tabernero, Josep; Ciruelos, Eva; García, Margarita; Salazar, Ramón; López, Ana; Blanco, María; Nieto, Antonio; Jimeno, José; Izquierdo, Miguel Angel; Trigo, José Manuel
2008-02-15
A dose-escalation, phase I study evaluated the safety, pharmacokinetics, and efficacy of a weekly 1-h regimen of kahalalide F, a cyclic depsipeptide isolated from the marine mollusk Elysia rufescens, in adult patients with advanced solid tumors and no standard treatment available. Patients received an i.v. 1-h infusion of kahalalide F once weekly until disease progression or unacceptable toxicity. The starting kahalalide F dose was 266 microg/m(2), and dose escalation proceeded based on the worst toxicity found in the previous cohort. Thirty-eight patients were enrolled at three Spanish institutions and received once-weekly kahalalide F 1-h infusions at doses between 266 and 1,200 microg/m(2). Dose-limiting toxicities consisted of transient grade 3/4 increases in transaminase blood levels. The maximum tolerated dose for this kahalalide F schedule was 800 microg/m(2), and the recommended dose for phase II studies was 650 microg/m(2). No accumulated toxicity was found. One patient with malignant melanoma had unconfirmed partial response, one patient with metastatic lung adenocarcinoma had minor response, and six patients with different types of metastatic solid tumors had stable disease for 2.8 to 12.7 months. The noncompartmental pharmacokinetics of this kahalalide F schedule was linear and showed a narrow distribution and short body residence. The transaminitis associated with kahalalide F was dose dependent. The maximum tolerated dose was 800 microg/m(2). Dose-limiting toxicities with weekly kahalalide F 1-h i.v. infusions were transient grade 3/4 increases in blood transaminase levels, and 650 microg/m(2) was declared the recommended dose for phase II studies. This schedule showed a favorable safety profile and hints of antitumor activity.
The phase transition of Pb8F14I2.
Weil, Matthias
2017-01-01
The reversible phase transition of Pb 8 F 14 I 2 is of continuous type and takes place at about 107 °C as monitored by temperature-dependent single crystal and powder X-ray diffraction measurements, optical microscopy, and differential scanning calorimetry. The low-temperature ferroelastic phase crystallizes in the orthorhombic crystal system (23 °C, Bmmb , Z = 2, a = 6.0699(6) Å, b = 6.0165(6) Å, c = 25.077(2) Å, 1487 structure factors, 41 parameter, R ( F 2 ) = 0.0346, wR ( F 2 ) = 0.0771) and changes its symmetry to the tetragonal crystal system into the high-temperature paraelastic phase (130 °C, I 4/ mmm , Z = 1, a = 4.2667(12) Å, c = 25.388(7) Å, 430 structure factors, 303 parameter, R ( F 2 ) = 0.0575, wR ( F 2 ) = 0.1564). Group-subgroup relationships between the two structures and a hypothetical intermediate structure are presented.
NASA Astrophysics Data System (ADS)
Suzuki, Muneyasu; Tsuchiya, Tetsuo; Akedo, Jun
2017-06-01
We report grain orientation control for bismuth layer-structured ferroelectrics (BLSFs) films deposited by aerosol deposition (AD) method at room temperature. Bi4Ti3O12 (BiT), SrBi2Ta2O9 (SBTa), and SrBi4Ti4O15 (SBTi) starting powders with particles of various shape (plate-like, spherical, and angular) were prepared by solid-state reaction and fused salt synthesis. Their AD films represented fine microstructures without pores, which agrees well with previous reports. Although the SBTa AD films deposited by using spherical particles exhibited an extremely low Lotgering factor (F), the BiT AD films deposited by using plate-like particles exhibited a marked c-axis orientation. The F of BiT and SBTi AD films decreased with increasing film thickness (t). We consider that the dispersion of agglomerated plate-like particles on the film surface and the densification of the compacted powder layer occurring while under particle impact are important in obtaining the grain-oriented AD films. These results of using the AD method with shape-controlled particles are expected to result in open up an innovative functional coating technique.
Methods and utility of EEG-fMRI in epilepsy
Lemieux, Louis; Chaudhary, Umair Javaid
2015-01-01
Brain activity data in general and more specifically in epilepsy can be represented as a matrix that includes measures of electrophysiology, anatomy and behaviour. Each of these sub-matrices has a complex interaction depending upon the brain state i.e., rest, cognition, seizures and interictal periods. This interaction presents significant challenges for interpretation but also potential for developing further insights into individual event types. Successful treatments in epilepsy hinge on unravelling these complexities, and also on the sensitivity and specificity of methods that characterize the nature and localization of underlying physiological and pathological networks. Limitations of pharmacological and surgical treatments call for refinement and elaboration of methods to improve our capability to localise the generators of seizure activity and our understanding of the neurobiology of epilepsy. Simultaneous electroencephalography and functional magnetic resonance imaging (EEG-fMRI), by potentially circumventing some of the limitations of EEG in terms of sensitivity, can allow the mapping of haemodynamic networks over the entire brain related to specific spontaneous and triggered epileptic events in humans, and thereby provide new localising information. In this work we review the published literature, and discuss the methods and utility of EEG-fMRI in localising the generators of epileptic activity. We draw on our experience and that of other groups, to summarise the spectrum of information provided by an increasing number of EEG-fMRI case-series, case studies and group studies in patients with epilepsy, for its potential role to elucidate epileptic generators and networks. We conclude that EEG-fMRI provides a multidimensional view that contributes valuable clinical information to localize the epileptic focus with potential important implications for the surgical treatment of some patients with drug-resistant epilepsy, and insights into the resting state and
Funane, Tsukasa; Sato, Hiroki; Yahata, Noriaki; Takizawa, Ryu; Nishimura, Yukika; Kinoshita, Akihide; Katura, Takusige; Atsumori, Hirokazu; Fukuda, Masato; Kasai, Kiyoto; Koizumi, Hideaki; Kiguchi, Masashi
2015-01-01
Abstract. It has been reported that a functional near-infrared spectroscopy (fNIRS) signal can be contaminated by extracerebral contributions. Many algorithms using multidistance separations to address this issue have been proposed, but their spatial separation performance has rarely been validated with simultaneous measurements of fNIRS and functional magnetic resonance imaging (fMRI). We previously proposed a method for discriminating between deep and shallow contributions in fNIRS signals, referred to as the multidistance independent component analysis (MD-ICA) method. In this study, to validate the MD-ICA method from the spatial aspect, multidistance fNIRS, fMRI, and laser-Doppler-flowmetry signals were simultaneously obtained for 12 healthy adult males during three tasks. The fNIRS signal was separated into deep and shallow signals by using the MD-ICA method, and the correlation between the waveforms of the separated fNIRS signals and the gray matter blood oxygenation level–dependent signals was analyzed. A three-way analysis of variance (signal depth×Hb kind×task) indicated that the main effect of fNIRS signal depth on the correlation is significant [F(1,1286)=5.34, p<0.05]. This result indicates that the MD-ICA method successfully separates fNIRS signals into spatially deep and shallow signals, and the accuracy and reliability of the fNIRS signal will be improved with the method. PMID:26157983
Yan, Ji-Geng; Zhang, Lin-ling; Agresti, Michael; Yan, Yuhui; LoGiudice, John; Sanger, James R; Matloub, Hani S; Pritchard, Kirkwood A; Jaradeh, Safwan S; Havlik, Robert
2015-12-01
Insidious cumulative brain injury from motor vehicle-induced whole-body vibration (MV-WBV) has not yet been studied. The objective of the present study is to validate whether whole-body vibration for long periods causes cumulative brain injury and impairment of the cerebral function. We also explored a preventive method for MV-WBV injury. A study simulating whole-body vibration was conducted in 72 male Sprague-Dawley rats divided into 9 groups (N = 8): (1) 2-week normal control; (2) 2-week sham control (in the tube without vibration); (3) 2-week vibration (exposed to whole-body vibration at 30 Hz and .5 G acceleration for 4 hours/day, 5 days/week for 2 weeks; vibration parameters in the present study are similar to the most common driving conditions); (4) 4-week sham control; (5) 4-week vibration; (6) 4-week vibration with human apolipoprotein A-I molecule mimetic (4F)-preconditioning; (7) 8-week sham control; (8) 8-week vibration; and (9) 8-week 4F-preconditioning group. All the rats were evaluated by behavioral, physiological, and histological studies of the brain. Brain injury from vibration is a cumulative process starting with cerebral vasoconstriction, squeezing of the endothelial cells, increased free radicals, decreased nitric oxide, insufficient blood supply to the brain, and repeated reperfusion injury to brain neurons. In the 8-week vibration group, which indicated chronic brain edema, shrunken neuron numbers increased and whole neurons atrophied, which strongly correlated with neural functional impairment. There was no prominent brain neuronal injury in the 4F groups. The present study demonstrated cumulative brain injury from MV-WBV and validated the preventive effects of 4F preconditioning. Copyright © 2015 National Stroke Association. All rights reserved.
HLA-F and MHC-I Open Conformers Cooperate in a MHC-I Antigen Cross-Presentation Pathway
Goodridge, Jodie P.; Lee, Ni; Burian, Aura; Pyo, Chul-Woo; Tykodi, Scott S.; Warren, Edus H.; Yee, Cassian; Riddell, Stanley R.
2013-01-01
Peptides that are presented by MHC class I (MHC-I) are processed from two potential sources, as follows: newly synthesized endogenous proteins for direct presentation on the surface of most nucleated cells and exogenous proteins for cross-presentation typically by professional APCs. In this study, we present data that implicate the nonclassical HLA-F and open conformers of MHC-I expressed on activated cells in a pathway for the presentation of exogenous proteins by MHC-I. This pathway is distinguished from the conventional endogenous pathway by its independence from TAP and tapasin and its sensitivity to inhibitors of lysosomal enzymes, and further distinguished by its dependence on MHC-I allotype-specific epitope recognition for Ag uptake. Thus, our data from in vitro experiments collectively support a previously unrecognized model of Ag cross-presentation mediated by HLA-F and MHC-I open conformers on activated lymphocytes and monocytes, which may significantly contribute to the regulation of immune system functions and the immune defense. PMID:23851683
Environmental Chemistry Methods (ECM) Index - F
Laboratories use testing methods to identify pesticides in water and soil. Environmental chemistry methods test soil and water samples to determine the fate of pesticides in the environment. Find methods for chemicals with F as the first character.
7 CFR 15f.25 - Will USDA pay my attorneys fees if I win?
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Will USDA pay my attorneys fees if I win? 15f.25 Section 15f.25 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 If I Request a Hearing, What Will Happen? How Will the Hearing Be Conducted? § 15f.25 Will USDA pay my...
7 CFR 15f.25 - Will USDA pay my attorneys fees if I win?
Code of Federal Regulations, 2014 CFR
2014-01-01
... 7 Agriculture 1 2014-01-01 2014-01-01 false Will USDA pay my attorneys fees if I win? 15f.25 Section 15f.25 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 If I Request a Hearing, What Will Happen? How Will the Hearing Be Conducted? § 15f.25 Will USDA pay my...
7 CFR 15f.25 - Will USDA pay my attorneys fees if I win?
Code of Federal Regulations, 2012 CFR
2012-01-01
... 7 Agriculture 1 2012-01-01 2012-01-01 false Will USDA pay my attorneys fees if I win? 15f.25 Section 15f.25 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 If I Request a Hearing, What Will Happen? How Will the Hearing Be Conducted? § 15f.25 Will USDA pay my...
7 CFR 15f.25 - Will USDA pay my attorneys fees if I win?
Code of Federal Regulations, 2013 CFR
2013-01-01
... 7 Agriculture 1 2013-01-01 2013-01-01 false Will USDA pay my attorneys fees if I win? 15f.25 Section 15f.25 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 If I Request a Hearing, What Will Happen? How Will the Hearing Be Conducted? § 15f.25 Will USDA pay my...
7 CFR 15f.25 - Will USDA pay my attorneys fees if I win?
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 1 2011-01-01 2011-01-01 false Will USDA pay my attorneys fees if I win? 15f.25 Section 15f.25 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER SECTION 741 If I Request a Hearing, What Will Happen? How Will the Hearing Be Conducted? § 15f.25 Will USDA pay my...
Cu-mediated C–H 18F-fluorination of electron-rich (hetero)arenes
DOE Office of Scientific and Technical Information (OSTI.GOV)
McCammant, Matthew S.; Thompson, Stephen; Brooks, Allen F.
This communication describes a method for the nucleophilic radiofluorination of electron-rich arenes. The reaction involves the initial C(sp 2)–H functionalization of an electron-rich arene with MesI(OH)OTs to form a (mesityl)(aryl)iodonium salt. This salt is then used in situ in a Cu-mediated radiofluorination with [ 18F]KF. This approach leverages the stability and availability of electron-rich arene starting materials to enable mild late-stage radiofluorination of toluene, anisole, aniline, pyrrole, and thiophene derivatives. Finally, the radiofluorination has been automated to access a 41 mCi dose of an 18F-labeled nimesulide derivative in high (2800 ± 700 Ci/mmol) specific activity.
Cu-mediated C–H 18F-fluorination of electron-rich (hetero)arenes
McCammant, Matthew S.; Thompson, Stephen; Brooks, Allen F.; ...
2017-06-30
This communication describes a method for the nucleophilic radiofluorination of electron-rich arenes. The reaction involves the initial C(sp 2)–H functionalization of an electron-rich arene with MesI(OH)OTs to form a (mesityl)(aryl)iodonium salt. This salt is then used in situ in a Cu-mediated radiofluorination with [ 18F]KF. This approach leverages the stability and availability of electron-rich arene starting materials to enable mild late-stage radiofluorination of toluene, anisole, aniline, pyrrole, and thiophene derivatives. Finally, the radiofluorination has been automated to access a 41 mCi dose of an 18F-labeled nimesulide derivative in high (2800 ± 700 Ci/mmol) specific activity.
"L.I.F.E.": A School-Based Heart-Health Screening and Intervention Program
ERIC Educational Resources Information Center
Northrup, Karen L.; Cottrell, Lesley A.; Wittberg, Richard A.
2008-01-01
This article describes the development and growth of "Lifestyle Improvements in the Family Environment" ("L.I.F.E."), a school-based heart-health screening and intervention program. The primary goals of "L.I.F.E." through three rounds of grant funding remained constant: (a) to identify cardiovascular risk factors in…
ERIC Educational Resources Information Center
Human Engineering Inst., Cleveland, OH.
THIS MODULE OF A 30-MODULE COURSE IS DESIGNED TO DEVELOP AN UNDERSTANDING OF THE OPERATION AND MAINTENANCE OF DIESEL ENGINE STARTING ENGINES. TOPICS ARE (1) STARTING ENGINE MAGNETO (WICO), (2) MAGNETO MAINTENANCE, (3) SPARK PLUGS, (4) GENERAL DESCRIPTION (STARTING DEVICES), (5) OPERATING (STARTING DEVICES), (6) LUBRICATION (STARTING DEVICES), (7)…
Method and apparatus for starting supersonic compressors
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lawlor, Shawn P
A supersonic gas compressor with bleed gas collectors, and a method of starting the compressor. The compressor includes aerodynamic duct(s) situated for rotary movement in a casing. The aerodynamic duct(s) generate a plurality of oblique shock waves for efficiently compressing a gas at supersonic conditions. A convergent inlet is provided adjacent to a bleed gas collector, and during startup of the compressor, bypass gas is removed from the convergent inlet via the bleed gas collector, to enable supersonic shock stabilization. Once the oblique shocks are stabilized at a selected inlet relative Mach number and pressure ratio, the bleed of bypassmore » gas from the convergent inlet via the bypass gas collectors is effectively eliminated.« less
F-18 Robust Control Design Using H2 and H-Infinity Methods
1990-09-01
INFINITY METHODS by Gerald A. Hartley September 1990 Thesis Advisor: Prof. D. J . Collins Approved for public release; distribution is unlimited. 91...AERONAUTICAL ENGINEERING from the NAVAL POSTGRADUATE SCHOOL September, 1990 Author: ’t -4 Cl > J 2 1I Gerald A. Hartley Approved by: -Y2__ ____ ____ Daniel... J Collins, Thesis Advisor Loui V. Schmidt, Second Reader Dep timent of Aeronauticsand-A tronautics iii ABSTRACT The open loop F-18 longitudinal
Structural Variation of Type I-F CRISPR RNA Guided DNA Surveillance.
Pausch, Patrick; Müller-Esparza, Hanna; Gleditzsch, Daniel; Altegoer, Florian; Randau, Lennart; Bange, Gert
2017-08-17
CRISPR-Cas systems are prokaryotic immune systems against invading nucleic acids. Type I CRISPR-Cas systems employ highly diverse, multi-subunit surveillance Cascade complexes that facilitate duplex formation between crRNA and complementary target DNA for R-loop formation, retention, and DNA degradation by the subsequently recruited nuclease Cas3. Typically, the large subunit recognizes bona fide targets through the PAM (protospacer adjacent motif), and the small subunit guides the non-target DNA strand. Here, we present the Apo- and target-DNA-bound structures of the I-Fv (type I-F variant) Cascade lacking the small and large subunits. Large and small subunits are functionally replaced by the 5' terminal crRNA cap Cas5fv and the backbone protein Cas7fv, respectively. Cas5fv facilitates PAM recognition from the DNA major groove site, in contrast to all other described type I systems. Comparison of the type I-Fv Cascade with an anti-CRISPR protein-bound I-F Cascade reveals that the type I-Fv structure differs substantially at known anti-CRISPR protein target sites and might therefore be resistant to viral Cascade interception. Copyright © 2017 Elsevier Inc. All rights reserved.
Aydin, Seyid; Personne, Yoann; Newire, Enas; Laverick, Rebecca; Russell, Oliver; Roberts, Adam P; Enne, Virve I
2017-08-01
Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and their associated cas genes are sequence-specific DNA nuclease systems found in bacteria and archaea. CRISPR/Cas systems use RNA transcripts of previously acquired DNA (spacers) to target invading genetic elements with the same sequence, including plasmids. In this research we studied the relationship between CRISPR/Cas systems and multidrug resistance in Escherichia coli . The presence of Type I-E and Type I-F CRISPR systems was investigated among 82 antimicrobial-susceptible and 96 MDR clinical E. coli isolates by PCR and DNA sequencing. Phylogrouping and MLST were performed to determine relatedness of isolates. RT-PCR was performed to ascertain the expression of associated cas genes. Type I-F CRISPR was associated with the B2 phylogroup and was significantly overrepresented in the susceptible group (22.0%) compared with the MDR group (2.1%). The majority of CRISPR I-F-containing isolates had spacer sequences that matched IncF and IncI plasmids. RT-PCR demonstrated that Type I-F cas genes were expressed and therefore potentially functional. The CRISPR I-F system is more likely to be found in antimicrobial-susceptible E. coli . Given that the Type I-F system is expressed in WT isolates, we suggest that this difference could be due to the CRISPR system potentially interfering with the acquisition of antimicrobial resistance plasmids, maintaining susceptibility in these isolates. © The Author 2017. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Structural dynamics of F-actin: I. Changes in the C terminus.
Orlova, A; Egelman, E H
1995-02-03
The biochemical properties of G-actin, and the kinetics of polymerization of G-actin into F-actin, are dependent upon whether Mg2+ or Ca2+ is bound at the high-affinity metal-binding site in actin. Three-dimensional reconstructions from electron micrographs show that a bridge of density, that we interpret as arising from a major shift of the C terminus, exists between the two strands of the filament in Ca(2+)-actin that is absent in Mg(2+)-actin. This bridge is also absent in models of F-actin built from an atomic structure of G-Ca(2+)-actin. The cleavage of the DNase I-binding loop in actin between residues 42 and 43, with the non-covalent association of the 42 cleaved residues with the remainder of the actin, induces an even larger bridge of density between the two strands. When the bridge is absent, the two C-terminal residues in F-actin are easily cleaved by trypsin, while these residues become increasingly resistant to tryptic cleavage as the bridge becomes more prominent. Conversely, cleavage of the two C-terminal residues leads to a conformational change in the DNase I-binding loop. Since both the DNase I-binding loop and the metal-binding site are quite distant from the C terminus, large allosteric effects must exist in F-actin. The conformational change in F-actin that results from the creation of this bridge may be induced by myosin binding, since this movement generates changes in actin's diffraction that are very similar to the changes in the muscle X-ray pattern during activation that are associated with the binding of myosin to the thin filament.
Cosmological viability conditions for f(T) dark energy models
DOE Office of Scientific and Technical Information (OSTI.GOV)
Setare, M.R.; Mohammadipour, N., E-mail: rezakord@ipm.ir, E-mail: N.Mohammadipour@uok.ac.ir
2012-11-01
Recently f(T) modified teleparallel gravity where T is the torsion scalar has been proposed as the natural gravitational alternative for dark energy. We perform a detailed dynamical analysis of these models and find conditions for the cosmological viability of f(T) dark energy models as geometrical constraints on the derivatives of these models. We show that in the phase space exists two cosmologically viable trajectory which (i) The universe would start from an unstable radiation point, then pass a saddle standard matter point which is followed by accelerated expansion de sitter point. (ii) The universe starts from a saddle radiation epoch,more » then falls onto the stable matter era and the system can not evolve to the dark energy dominated epoch. Finally, for a number of f(T) dark energy models were proposed in the more literature, the viability conditions are investigated.« less
Method and system for controlling start of a permanent magnet machine
Walters, James E.; Krefta, Ronald John
2003-10-28
Method and system for controlling a permanent magnet machine are provided. The method provides a sensor assembly for sensing rotor sector position relative to a plurality of angular sectors. The method further provides a sensor for sensing angular increments in rotor position. The method allows starting the machine in a brushless direct current mode of operation using a calculated initial rotor position based on an initial angular sector position information from the sensor assembly. Upon determining a transition from the initial angular sector to the next angular sector, the method allows switching to a sinusoidal mode of operation using rotor position based on rotor position information from the incremental sensor.
Liu, Yungen; Chen, Guo-Qiang; Tse, Chun-Wai; Guan, Xianguo; Xu, Zheng-Jiang; Huang, Jie-Sheng; Che, Chi-Ming
2015-01-01
Amination of CH bonds catalyzed by transition metal complexes via nitrene/imide insertion is an appealing strategy for CN bond formation, and the use of iminoiodinanes, or their in situ generated forms from 'PhI(OAc)2 +primary amides (such as sulfonamides, sulfamates, and carbamates)', as nitrogen sources for the amination reaction has been well documented. In this work, a 'metal catalyst+PhI(OAc)2 +primary arylamines' amination protocol has been developed using [Fe(F20 TPP)Cl] (H2 F20 TPP=meso-tetrakis(pentafluorophenyl)porphyrin) as a catalyst. This catalytic method is applicable for both intra- and intermolecular amination of sp(2) and sp(3) CH bonds (>27 examples), affording the amination products, including natural products such as rutaecarpine, in moderate-to-good yields. ESI-MS analysis and DFT calculations lend support for the involvement of {[Fe(F20 TPP)(NC6 H4 -p-NO2 )](PhI=NC6 H4 -p-NO2 )} + . intermediate in the catalysis. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
A TaqI PCR-RFLP detecting a novel SNP in exon 2 of the bovine POU1F1 gene.
Pan, Chuanying; Lan, Xianyong; Chen, Hong; Guo, Yikun; Shu, Jianhong; Lei, Chuzhao; Wang, Xinzhuang
2008-08-01
PCR-SSCP and DNA sequencing methods were applied to reveal three novel single nucleotide polymorphisms (SNPs) in exon 2 of the POU1F1 gene in 963 Chinese cattle belonging to eight breeds. Among them, a silent SNP (NM_174579:c.545G > A) detected by TaqI endonuclease is described. Frequencies of the POU1F1-G allele varied from 0.685 to 1.000. The association of TaqI polymorphism with growth traits was analyzed in 251 Nanyang cattle. No significant associations of the TaqI polymorphism with body weight and average daily gain for different growth periods (6, 12, 18, and 24 months old) were observed (P > 0.05), as well as for body sizes (P > 0.05).
Starting with "I": Personal Essays by Teenagers.
ERIC Educational Resources Information Center
Estepa, Andrea, Ed.; Kay, Philip, Ed.
In personal essays, teenagers express their views on serious subjects like violence, racism, and teen parenting, and discuss common teen experiences like dating, getting a job, and starting college. This collection contains the following: (1) "Brotherly Love" (Jessica Vicuna); (2) "How To Survive Shopping with Mom" (Chris Kanarick); (3) "A…
DOE Office of Scientific and Technical Information (OSTI.GOV)
Rippy, Kerry C.; Bukovsky, Eric V.; Clikeman, Tyler T.
The presence of Cu in reactions of triphenylene (TRPH) and 1,4-C4F8I2 at 360 °C led to regiospecific substitution of TRPH ortho C(β) atoms to form C4F8-containing rings, completely suppressing substitution on C(α) atoms. In addition, Cu caused selective reductive-defluorination/aromatization (RD/A) to form C4F4- containing aromatic rings. Without Cu, the reactions of TRPH and 1,4- C4F8I2 were not regiospecific and no RD/A was observed. These results, supported by DFT calculations, are the first examples of Cupromoted (i) regiospecific perfluoroannulation, (ii) preparative C–F activation, and (iii) RD/A. HPLC-purified products were characterized by X-ray diffraction, low-temperature PES, and 1H/19F NMR.
Olasz, Balázs; Szabó, István; Czakó, Gábor
2017-04-01
Bimolecular nucleophilic substitution (S N 2) and proton transfer are fundamental processes in chemistry and F - + CH 3 I is an important prototype of these reactions. Here we develop the first full-dimensional ab initio analytical potential energy surface (PES) for the F - + CH 3 I system using a permutationally invariant fit of high-level composite energies obtained with the combination of the explicitly-correlated CCSD(T)-F12b method, the aug-cc-pVTZ basis, core electron correlation effects, and a relativistic effective core potential for iodine. The PES accurately describes the S N 2 channel producing I - + CH 3 F via Walden-inversion, front-side attack, and double-inversion pathways as well as the proton-transfer channel leading to HF + CH 2 I - . The relative energies of the stationary points on the PES agree well with the new explicitly-correlated all-electron CCSD(T)-F12b/QZ-quality benchmark values. Quasiclassical trajectory computations on the PES show that the proton transfer becomes significant at high collision energies and double-inversion as well as front-side attack trajectories can occur. The computed broad angular distributions and hot internal energy distributions indicate the dominance of indirect mechanisms at lower collision energies, which is confirmed by analyzing the integration time and leaving group velocity distributions. Comparison with available crossed-beam experiments shows usually good agreement.
King, Kathryn S; Chen, Clara C; Alexopoulos, Dimitrios K; Whatley, Millie A; Reynolds, James C; Patronas, Nicholas; Ling, Alexander; Adams, Karen T; Xekouki, Paraskevi; Lando, Howard; Stratakis, Constantine A; Pacak, Karel
2011-09-01
Accurate diagnosis of head and neck paragangliomas is often complicated by biochemical silence and lack of catecholamine-associated symptoms, making accurate anatomical and functional imaging techniques essential to the diagnostic process. Ten patients (seven SDHD, three SDHB), with a total of 26 head and neck paragangliomas, were evaluated with anatomical and functional imaging. This study compares five different functional imaging techniques [(18)F-fluorodihydroxyphenylalanine ((18)F-FDOPA) positron emission tomography (PET), (18)F-fluorodopamine ((18)F-FDA) PET/computed tomography (CT), (18)F-fluoro-2-deoxy-D-glucose ((18)F-FDG) PET/CT, (123)I-metaiodobenzylguanidine ((123)I-MIBG) scintigraphy, and (111)In-pentetreotide scintigraphy] in the localization of head and neck paragangliomas. Prospectively (18)F-FDOPA PET localized 26 of 26 lesions in the 10 patients, CT/magnetic resonance imaging localized 21 of 26 lesions, (18)F-FDG PET/CT localized 20 of 26 lesions, (111)In-pentetreotide scintigraphy localized 16 of 25 lesions, (18)F-FDA PET/CT localized 12 of 26 lesions, and (123)I-MIBG scintigraphy localized eight of 26 lesions. Differences in imaging efficacy related to genetic phenotype, even in the present small sample size, included the negativity of (18)F-FDA PET/CT and (123)I-MIBG scintigraphy in patients with SDHB mutations and the accuracy of (18)F-FDG PET/CT in all patients with SDHD mutations, as compared with the accuracy of (18)F-FDG PET/CT in only one patient with an SDHB mutation. Overall, (18)F-FDOPA PET proved to be the most efficacious functional imaging modality in the localization of SDHx-related head and neck paragangliomas and may be a potential first-line functional imaging agent for the localization of these tumors.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Francescon, P.; Cora, S.; Satariano, N.
2011-12-15
Purpose: The scope of this study was to determine a complete set of correction factors for several detectors in static small photon fields for two linear accelerators (linacs) and for several detectors. Methods: Measurements for Monte Carlo (MC) commissioning were performed for two linacs, Siemens Primus and Elekta Synergy. After having determined the source parameters that best fit the measurements of field specific output factors, profiles, and tissue-phantom ratio, the generalized version of the classical beam quality correction factor for static small fields, k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}},more » were determined for several types of detectors by using the egs{sub c}hamber Monte Carlo user code which can accurately reproduce the geometry and the material composition of the detector. The influence of many parameters (energy and radial FWHM of the electron beam source, field dimensions, type of accelerator) on the value of k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} was evaluated. Moreover, a MC analysis of the parameters that influence the change of k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} as a function of field dimension was performed. A detailed analysis of uncertainties related to the measurements of the field specific output factor and to the Monte Carlo calculation of k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} was done. Results: The simulations demonstrated that the correction factor k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} can be considered independent from the quality beam factor Q in the range 0.68 {+-} 0.01 for all the detectors analyzed. The k{sub Q{sub c{sub l{sub i
Bianchi type-I universe in f(R, T) modified gravity with quark matter and Λ
NASA Astrophysics Data System (ADS)
Ćaǧlar, Halife; Aygün, Sezgin
2017-02-01
In this study, we investigate homogeneous and anisotropic Bianchi type I universe in the presence of quark matter source in f(R, T) gravity (Harko et al. in Phys. Rev. D 84:024020, 2011) with cosmological constant Λ (where R is the Ricci scalar and T is the trace of the energy momentum tensor). For this aim we have used the anisotropy feature of Bianchi type I universe and equation of states (EoS) of quark matter. We explore the exact solution f(R,T)=R+2f(T) model for Bianchi type I universe model. When t→∞, we get very small cosmological constant value, this result agrees with recent observations.
A Descriptive Study of Head Start Families: FACES Technical Report I.
ERIC Educational Resources Information Center
O'Brien, Robert W.; D'Elio, Mary Ann; Vaden-Kiernan, Michael; Magee, Candice; Younoszai, Tina; Keane, Michael J.; Connell, David C.; Hailey, Linda
Recognizing that families have played an essential role in the Head Start philosophy since the program's inception, the Head Start Family and Child Experiences Survey (FACES) is an effort to develop a descriptive profile of families participating in the Head Start program and services, as well as to develop, test, and refine Program Performance…
Method and apparatus for operating a self-starting air heating system
Heinrich, Charles E.
1983-12-06
A self-starting, fuel fired, air heating system including a fuel burner fired vapor generator, a turbine, and a condenser connected in a closed circuit such that the vapor output from the vapor generator is conducted to the turbine and then to the condenser where it is condensed for return to the vapor generator. The turbine drives an air blower which passes air over the condenser for cooling the condenser and heating the air. Also, a condensate pump is driven by the turbine. The disclosure is particularly concerned with a method and apparatus which on start-up prevents the vapor generator's vapor output from being conducted to the turbine until a predetermined pressure differential has been achieved. However, after the vapor flow is once permitted, it cannot again be prevented until after the fuel burner has been shut off and restarted.
Determination of the Cryolite Ratio of KF-NaF-AlF3 Electrolyte by Conductivity Method
NASA Astrophysics Data System (ADS)
Yan, Hengwei; Yang, Jianhong; Liu, Zhanwei; Wang, Chengzhi; Ma, Wenhui
2018-05-01
The cryolite ratio (CR) is an important parameter for the electrolyte in aluminum reduction cells. The measurement method for the CR of the KF-NaF-AlF3 system acid (CR < 3) electrolyte by means of electrical conductivity was initially developed, and the formula for calculating the CR was deduced. This method has the advantages of simple operation and high precision. In addition, the relative standard deviations (RSD) of the measurement are < 1.2 pct, and the analysis error of the NaF or KF content has little effect on the determination of the CR.
NASA Astrophysics Data System (ADS)
Aizawa, Hirohito; Kuroki, Kazuhiko; Yamada, Jun-ichi
2015-10-01
We perform a first-principles band calculation for quasi-two-dimensional organic superconductors β -(BDA -TTP) 2I3 and β -(BDA -TTP) 2SbF6. The first-principles band structures between the I3 and SbF6 salts are apparently different. We construct a tight-binding model for each material which accurately reproduces the first-principles band structure. The obtained transfer energies give the differences as follows: (i) larger dimerization in the I3 salt than the SbF6 salt, and (ii) different signs and directions of the interstacking transfer energies. To decompose the origin of the difference into the dimerization and the interstacking transfer energies, we adopt a simplified model by eliminating the dimerization effect and focus only on the difference caused by the interstacking transfer energies. From the analysis using the simplified model, we find that the difference of the band structure comes mainly from the strength of the dimerization. To compare the strength of the electron correlation having roots in the band structure, we calculate the physical properties originating from the effect of the electron correlation such as the spin susceptibility applying the two-particle self-consistent method. We find that the maximum value of the spin susceptibility for the I3 salt is larger than that of the SbF6 salt. Hypothetically decreasing the dimerization within the model of the I3 salt, the spin susceptibility takes almost the same value as that of the SbF6 salt for the same magnitude of the dimerization. We expect that the different ground state between the I3 and SbF6 salt mainly comes from the strength of the dimerization which is apparently masked in the band calculation along a particular k path.
Competing E2 and SN2 Mechanisms for the F- + CH3CH2I Reaction.
Yang, Li; Zhang, Jiaxu; Xie, Jing; Ma, Xinyou; Zhang, Linyao; Zhao, Chenyang; Hase, William L
2017-02-09
Anti-E2, syn-E2, inv-, and ret-S N 2 reaction channels for the gas-phase reaction of F - + CH 3 CH 2 I were characterized with a variety of electronic structure calculations. Geometrical analysis confirmed synchronous E2-type transition states for the elimination of the current reaction, instead of nonconcerted processes through E1cb-like and E1-like mechanisms. Importantly, the controversy concerning the reactant complex for anti-E2 and inv-S N 2 paths has been clarified in the present work. A positive barrier of +19.2 kcal/mol for ret-S N 2 shows the least feasibility to occur at room temperature. Negative activation energies (-16.9, -16.0, and -4.9 kcal/mol, respectively) for inv-S N 2, anti-E2, and syn-E2 indicate that inv-S N 2 and anti-E2 mechanisms significantly prevail over the eclipsed elimination. Varying the leaving group for a series of reactions F - + CH 3 CH 2 Y (Y = F, Cl, Br, and I) leads to monotonically decreasing barriers, which relates to the gradually looser TS structures following the order F > Cl > Br > I. The reactivity of each channel nearly holds unchanged except for the perturbation between anti-E2 and inv-S N 2. RRKM calculation reveals that the reaction of the fluorine ion with ethyl iodide occurs predominately via anti-E2 elimination, and the inv-S N 2 pathway is suppressed, although it is energetically favored. This phenomenon indicates that, in evaluating the competition between E2 and S N 2 processes, the kinetic or dynamical factors may play a significant role. By comparison with benchmark CCSD(T) energies, MP2, CAM-B3LYP, and M06 methods are recommended to perform dynamics simulations of the title reaction.
46 CFR 112.50-7 - Compressed air starting.
Code of Federal Regulations, 2013 CFR
2013-10-01
... 46 Shipping 4 2013-10-01 2013-10-01 false Compressed air starting. 112.50-7 Section 112.50-7... air starting. A compressed air starting system must meet the following: (a) The starting, charging... air compressors addressed in paragraph (c)(3)(i) of this section. (b) The compressed air starting...
46 CFR 112.50-7 - Compressed air starting.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 46 Shipping 4 2014-10-01 2014-10-01 false Compressed air starting. 112.50-7 Section 112.50-7... air starting. A compressed air starting system must meet the following: (a) The starting, charging... air compressors addressed in paragraph (c)(3)(i) of this section. (b) The compressed air starting...
Bandopadhyaya, G P; Kumar, Abhishek; Kumari, Jyotsana
2015-01-01
The aim of this retrospective study was to evaluate role of (18)F-DOPA PET/CT and (131)I-MIBG planar scintigraphy in patients with pheochromocytoma. The patients with diagnosis of pheochromocytoma based on radiological and biochemical markers were retrospectively selected for the study. These patients had undergone both (131)I-MIBG scintigraphy and (18)F-DOPA PET/CT. The imaging findings were compared to patient histopathology reports, biochemical markers and clinical follow up whenever available to establish the diagnosis. (131)I-MIBG showed a sensitivity of 68% and specificity of 100%. (18)F-DOPA PET/CT showed a sensitivity of 82% and specificity of 100%. (18)F-DOPA was better at localizing and finding more no of lesions as compared to (131)I-MIBG scintigraphy. (18)F-DOPA also is a better study in evaluation of paragangliomas. (18)F-DOPA PET/CT seems to be a better modality in comparison to (131)I-MIBG scintigraphy in the evaluation of pheochromocytoma/paraganglioma. At this point both these tracers seem to have mutually additive role in these patients and essential investigations with diagnosis and follow-up of this disease.
Method for starting operation of a resistance melter
Chapman, Christopher Charles
1977-01-01
A method for starting the operation of a resistance furnace, where heating occurs by passing a current through the charge between two furnace electrodes and the charge is a material which is essentially electrically nonconductive when in a solid physical state but which becomes more electrically conductive when in a molten physical state, by connecting electrical resistance heating wire between the furnace electrodes, placing the wire in contact with the charge material between the electrodes and passing a current through the wire to heat the wire to a temperature sufficient to melt the material between the furnace electrodes so that as the material melts, current begins to pass between the electrodes through the melted material, further heating and melting more material until all current between the electrodes passes through the charge material without the aid or presence of the resistance element.
Tanaka, Kanji; Watanabe, Katsumi
2016-02-01
The present study examined whether sequence learning led to more accurate and shorter performance time if people who are learning a sequence start over from the beginning when they make an error (i.e., practice the whole sequence) or only from the point of error (i.e., practice a part of the sequence). We used a visuomotor sequence learning paradigm with a trial-and-error procedure. In Experiment 1, we found fewer errors, and shorter performance time for those who restarted their performance from the beginning of the sequence as compared to those who restarted from the point at which an error occurred, indicating better learning of spatial and motor representations of the sequence. This might be because the learned elements were repeated when the next performance started over from the beginning. In subsequent experiments, we increased the occasions for the repetitions of learned elements by modulating the number of fresh start points in the sequence after errors. The results showed that fewer fresh start points were likely to lead to fewer errors and shorter performance time, indicating that the repetitions of learned elements enabled participants to develop stronger spatial and motor representations of the sequence. Thus, a single or two fresh start points in the sequence (i.e., starting over only from the beginning or from the beginning or midpoint of the sequence after errors) is likely to lead to more accurate and faster performance. Copyright © 2016 Elsevier B.V. All rights reserved.
2017-04-10
The Administrator of the Drug Enforcement Administration is issuing this temporary scheduling order to schedule six synthetic cannabinoids: methyl 2-(1-(5-fluoropentyl)-1H-indazole-3-carboxamido)-3,3-dimethylbutanoate [5F-ADB; 5F-MDMB-PINACA]; methyl 2-(1-(5-fluoropentyl)-1H-indazole-3-carboxamido)-3-methylbutanoate [5F-AMB]; N-(adamantan-1-yl)-1-(5-fluoropentyl)-1H-indazole-3-carboxamide [5F-APINACA, 5F-AKB48]; N-(1-amino-3,3-dimethyl-1-oxobutan-2-yl)-1-(4-fluorobenzyl)-1H-indazole-3-carboxamide [ADB-FUBINACA]; methyl 2-(1-(cyclohexylmethyl)-1H-indole-3-carboxamido)-3,3-dimethylbutanoate [MDMB-CHMICA, MMB-CHMINACA] and methyl 2-(1-(4-fluorobenzyl)-1H-indazole-3-carboxamido)-3,3-dimethylbutanoate [MDMB-FUBINACA], and their optical, positional, and geometric isomers, salts, and salts of isomers into schedule I pursuant to the temporary scheduling provisions of the Controlled Substances Act. This action is based on a finding by the Administrator that the placement of these synthetic cannabinoids into schedule I of the Controlled Substances Act is necessary to avoid an imminent hazard to the public safety. As a result of this order, the regulatory controls and administrative, civil, and criminal sanctions applicable to schedule I controlled substances will be imposed on persons who handle (manufacture, distribute, reverse distribute, import, export, engage in research, conduct instructional activities or chemical analysis, or possess), or propose to handle, 5F-ADB, 5F-AMB, 5F-APINACA, ADB-FUBINACA, MDMB-CHMICA or MDMB-FUBINACA.
NASA Astrophysics Data System (ADS)
Sattler, B.; Tilg, M.; Storrie-Lombardi, M.; Remias, D.; Psenner, R.
2012-04-01
Laser-induced fluorescence emission (L.I.F.E.) is an in situ laser scanning technique to detect photoautotrophic pigments such as phycoerythrin of an ice ecosystem such as supraglacial environments without contamination. The sensitivity of many psychrophiles to even moderate changes in temperature, and the logistical difficulties associated with either in situ analysis or sampling makes it difficult to study microbial metabolism in ice ecosystems in a high resolution. Surface communities of cold ecosystems are highly autotrophic and therefor ideal systems for L.I.F.E examinations. 532nm green lasers excite photopigments in cyanobacteria and produce multiple fluorescence signatures between 550nm and 750nm including carotenoids, phycobiliproteins which would enable a non-invasive in-situ measurement. The sensitivity of many psychrophiles to even moderate changes in temperature, and the logistical difficulties associated with either in situ analysis or sampling makes it difficult to study these cryosphere ecosystems. In general, the ice habitat has to be disrupted using techniques that usually include coring, sawing, and melting. Samples are also often chosen blindly, with little indication of probable biomass. The need for an in situ non-invasive, non-destructive technique to detect, localize, and sample cryosphere biomass in the field is therefore of considerable importance. L.I.F.E has already been tested in remote ecosystems like Antarctica (Lake Untersee, Lake Fryxell), supraglacial environments in the Kongsfjord region in the High Arctic and High Alpine glaciers but until now no calibration was set to convert the L.I.F.E. signal into pigment concentration. Here we describe the standardization for detection of Phycobiliproteins (Phycoerythrine) which are found in red algae, cyanobacteria, and cryptomonads. Similar methods are already used for detection of phytoplankton in liquid systems like oceans and lakes by NASÁs Airborne Oceanographic LIDAR since 1979. The
Abualrous, Esam T; Fritzsche, Susanne; Hein, Zeynep; Al-Balushi, Mohammed S; Reinink, Peter; Boyle, Louise H; Wellbrock, Ursula; Antoniou, Antony N; Springer, Sebastian
2015-04-01
The human MHC class I protein HLA-B*27:05 is statistically associated with ankylosing spondylitis, unlike HLA-B*27:09, which differs in a single amino acid in the F pocket of the peptide-binding groove. To understand how this unique amino acid difference leads to a different behavior of the proteins in the cell, we have investigated the conformational stability of both proteins using a combination of in silico and experimental approaches. Here, we show that the binding site of B*27:05 is conformationally disordered in the absence of peptide due to a charge repulsion at the bottom of the F pocket. In agreement with this, B*27:05 requires the chaperone protein tapasin to a greater extent than the conformationally stable B*27:09 in order to remain structured and to bind peptide. Taken together, our data demonstrate a method to predict tapasin dependence and physiological behavior from the sequence and crystal structure of a particular class I allotype. Also watch the Video Abstract. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
NASA Technical Reports Server (NTRS)
Fu, C.-C.; Yeh, N.-C.; Samoilov, A. V.; Vakili, K.; Li, Y.; Vasquez, R. P.
1999-01-01
The effect of spin-polarized quasiparticle currents on the critical current density (J-c) of cuprate superconductors is studied in perovskite F-I-S heterostructures as a function of insulator thickness and of underlying magnetic materials. A pulsed current technique is employed to minimize extraneous Joule heating on the superconductor. At temperatures near T-c, F-I-S samples with insulator thicknesses\\1e2nm show precipitous decrease in J_c as current injection (I_m) is increased. In contrast, J_c in a controlled sample with a substituted non-magnetic material (N-I-S) exhibit no dependence on I_m. Similarly, a F-I-S sample with a 10 mn insulating barrier also show little J_c effect versus I_m. At low temperatures with I_m = 0, significant suppression of J-c is observed only in the thin barrier F-I-S samples, although T_c and the normal-state resistivity of all samples are comparable. These phenomena can be attributed to the Cooper pair breaking induced by externally-injected and internally-reflected spin-polarized quasiparticle currents. We estimate an order of magnitude range for the spin diffusion length of 100 nm to 100\\ mum.
A novel facile method of labeling octreotide with (18)F-fluorine.
Laverman, Peter; McBride, William J; Sharkey, Robert M; Eek, Annemarie; Joosten, Lieke; Oyen, Wim J G; Goldenberg, David M; Boerman, Otto C
2010-03-01
Several methods have been developed to label peptides with (18)F. However, in general these are laborious and require a multistep synthesis. We present a facile method based on the chelation of (18)F-aluminum fluoride (Al(18)F) by 1,4,7-triazacyclononane-1,4,7-triacetic acid (NOTA). The method is characterized by the labeling of NOTA-octreotide (NOTA-d-Phe-cyclo[Cys-Phe-d-Trp-Lys-Thr-Cys]-Throl (MH(+) 1305) [IMP466]) with (18)F. Octreotide was conjugated with the NOTA chelate and labeled with (18)F in a 2-step, 1-pot method. The labeling procedure was optimized with regard to the labeling buffer, peptide, and aluminum concentration. Radiochemical yield, specific activity, in vitro stability, and receptor affinity were determined. Biodistribution of (18)F-IMP466 was studied in AR42J tumor-bearing mice and compared with that of (68)Ga-labeled IMP466. In addition, small-animal PET/CT images were acquired. IMP466 was labeled with Al(18)F in a single step with 50% yield. The labeled product was purified by high-performance liquid chromatography to remove unbound Al(18)F and unlabeled peptide. The radiolabeling, including purification, was performed in 45 min. The specific activity was 45,000 GBq/mmol, and the peptide was stable in serum for 4 h at 37 degrees C. Labeling was performed at pH 4.1 in sodium citrate, sodium acetate, 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid, and 2-(N-morpholino)ethanesulfonic acid buffer and was optimal in sodium acetate buffer. The apparent 50% inhibitory concentration of the (19)F-labeled IMP466 determined on AR42J cells was 3.6 nM. Biodistribution studies at 2 h after injection showed a high tumor uptake of (18)F-IMP466 (28.3 +/- 5.2 percentage injected dose per gram [%ID/g]; tumor-to-blood ratio, 300 +/- 90), which could be blocked by an excess of unlabeled peptide (8.6 +/- 0.7 %ID/g), indicating that the accumulation in the tumor was receptor-mediated. Biodistribution of (68)Ga-IMP466 was similar to that of (18)F-IMP466. (18)F
Assisted Workouts: Starting My Own Workout Program
ERIC Educational Resources Information Center
Cousminer, Douglas
2003-01-01
As an undergraduate student with cerebral palsy, I found it difficult to achieve my goal of starting a regular exercise program at my school, the University of Central Florida. However, when I started a program called Assisted Workouts in spring 2003. the struggle proved to be well worth it. The program is not only beneficial to me, but it has…
DOE Office of Scientific and Technical Information (OSTI.GOV)
Kuvychko, Igor V.; Whitaker, James B.; Larson, Bryon W.
2013-04-08
A series of seven structurally-similar compounds with different pairs of R{sub F} groups were prepared, characterized spectroscopically, and studied by electrochemical methods (cyclic and square-wave voltammetry), low-temperature anion photoelectron spectroscopy, and DFT calculations (five of the compounds are reported here for the first time). This is the first time that a set of seven R{sub F} groups have been compared with respect to their relative effects on E{sub 1/2}(0/-), electron affinity (EA), and the DFT-calculated LUMO energy. The compounds, 1,7-C{sub 60}(R{sub F}){sub 2} (R{sub F} = CF{sub 3}, C{sub 2}F{sub 5}, i-C{sub 3}F{sub 7}, n-C{sub 3}F{sub 7}, s-C{sub 4}F{sub 9},more » n-C{sub 4}F{sub 9} and n-C{sub 8}F{sub 21}), were found to have statistically different electron affinities (EA), at the {+-}10 meV level of uncertainty, but virtually identical first reduction potentials, at the {+-}10 mV level of uncertainty. The lack of a correlation between EA and E{sub 1/2}(0/-), and between E(LUMO) and E{sub 1/2}(0/-), for such similar compounds is unprecedented and suggests that explanations for differences in figures of merit for materials and/or devices that are based on equating easily measurable E{sub 1/2}(0/-) values with EAs or E(LUMO) values should be viewed with caution. The solubilities of the seven compounds in toluene varied by nearly a factor of six, but in an unpredictable way, with the C{sub 2}F{sub 5} and s-C{sub 4}F{sub 9} compounds being the most soluble and the i-C{sub 3}F{sub 7} compound being the least soluble. The effects of the different R{sub F} groups on EAs, E(LUMO) values, and solubilities should help fluorine chemists choose the right R{sub F} group to design new materials with improved morphological, electronic, optical, and/or magnetic properties.« less
f( R) gravity modifications: from the action to the data
NASA Astrophysics Data System (ADS)
Lazkoz, Ruth; Ortiz-Baños, María; Salzano, Vincenzo
2018-03-01
It is a very well established matter nowadays that many modified gravity models can offer a sound alternative to General Relativity for the description of the accelerated expansion of the universe. But it is also equally well known that no clear and sharp discrimination between any alternative theory and the classical one has been found so far. In this work, we attempt at formulating a different approach starting from the general class of f( R) theories as test probes: we try to reformulate f( R) Lagrangian terms as explicit functions of the redshift, i.e., as f( z). In this context, the f( R) setting to the consensus cosmological model, the Λ CDM model, can be written as a polynomial including just a constant and a third-order term. Starting from this result, we propose various different polynomial parameterizations f( z), including new terms which would allow for deviations from Λ CDM, and we thoroughly compare them with observational data. While on the one hand we have found no statistically preference for our proposals (even if some of them are as good as Λ CDM by using Bayesian Evidence comparison), we think that our novel approach could provide a different perspective for the development of new and observationally reliable alternative models of gravity.
NASA Astrophysics Data System (ADS)
Strom, C. S.; Bennema, P.
1997-03-01
A series of two articles discusses possible morphological evidence for oligomerization of growth units in the crystallization of tetragonal lysozyme, based on a rigorous graph-theoretic derivation of the F faces. In the first study (Part I), the growth layers are derived as valid networks satisfying the conditions of F slices in the context of the PBC theory using the graph-theoretic method implemented in program FFACE [C.S. Strom, Z. Krist. 172 (1985) 11]. The analysis is performed in monomeric and alternative tetrameric and octameric formulations of the unit cell, assuming tetramer formation according to the strongest bonds. F (flat) slices with thickness Rdhkl ( {1}/{2} < R ≤ 1 ) are predicted theoretically in the forms 1 1 0, 0 1 1, 1 1 1. The relevant energies are established in the broken bond model. The relation between possible oligomeric specifications of the unit cell and combinatorially feasible F slice compositions in these orientations is explored.
How Do I Start a Property Records System?
ERIC Educational Resources Information Center
Whyman, Wynne
2003-01-01
A property records system organizes data to be utilized by a camp's facilities department and integrated into other areas. Start by deciding what records to keep and allotting the time. Then develop consistent procedures, including organizing data, creating a catalog, making back-up copies, and integrating procedures. Use software tools. A good…
A phase II study of radioimmunotherapy with intraventricular 131 I-3F8 for medulloblastoma.
Kramer, Kim; Pandit-Taskar, Neeta; Humm, John L; Zanzonico, Pat B; Haque, Sofia; Dunkel, Ira J; Wolden, Suzanne L; Donzelli, Maria; Goldman, Debra A; Lewis, Jason S; Lyashchenko, Serge K; Khakoo, Yasmin; Carrasquillo, Jorge A; Souweidane, Mark M; Greenfield, Jeffrey P; Lyden, David; De Braganca, Kevin D; Gilheeney, Stephen W; Larson, Steven M; Cheung, Nai-Kong V
2018-01-01
High-risk and recurrent medulloblastoma (MB) is associated with significant mortality. The murine monoclonal antibody 3F8 targets the cell-surface disialoganglioside GD2 on MB. We tested the efficacy, toxicity, and dosimetry of compartmental radioimmunotherapy (cRIT) with intraventricular 131 I-labeled 3F8 in patients with MB on a phase II clinical trial. Patients with histopathologically confirmed high-risk or recurrent MB were eligible for cRIT. After determining adequate cerebrospinal fluid (CSF) flow, patients received 2 mCi (where Ci is Curie) 124 I-3F8 or 131 I-3F8 with nuclear imaging for dosimetry, followed by up to four therapeutic (10 mCi/dose) 131 I-3F8 injections. Dosimetry estimates were based on serial CSF and blood samplings over 48 hr plus region-of-interest analyses on serial imaging scans. Disease evaluation included pre- and posttherapy brain/spine magnetic resonance imaging approximately every 3 months for the first year after treatment, and every 6-12 months thereafter. Forty-three patients received a total of 167 injections; 42 patients were evaluable for outcome. No treatment-related deaths occurred. Toxicities related to drug administration included acute bradycardia with somnolence, headache, fatigue, and CSF pleocytosis consistent with chemical meningitis and dystonic reaction. Total CSF absorbed dose was 1,453 cGy (where Gy is Gray; 350.0-2,784). Median overall survival from first dose of cRIT was 24.9 months (95% confidence interval [CI]:16.3-55.8). Patients treated in radiographic and cytologic remission were at a lower risk of death compared to patients with radiographically measurable disease (hazard ratio: 0.40, 95% CI: 0.18-0.88, P = 0.024). cRIT with 131 I-3F8 is safe, has favorable dosimetry to CSF, and when added to salvage therapy using conventional modalities, may have clinical utility in maintaining remission in high-risk or recurrent MB. © 2017 Wiley Periodicals, Inc.
Thermodynamic assessment of the LiF-ThF4-PuF3-UF4 system
NASA Astrophysics Data System (ADS)
Capelli, E.; Beneš, O.; Konings, R. J. M.
2015-07-01
The LiF-ThF4-PuF3-UF4 system is the reference salt mixture considered for the Molten Salt Fast Reactor (MSFR) concept started with PuF3. In order to obtain the complete thermodynamic description of this quaternary system, two binary systems (ThF4-PuF3 and UF4-PuF3) and two ternary systems (LiF-ThF4-PuF3 and LiF-UF4-PuF3) have been assessed for the first time. The similarities between CeF3/PuF3 and ThF4/UF4 compounds have been taken into account for the presented optimization as well as in the experimental measurements performed, which have confirmed the temperatures predicted by the model. Moreover, the experimental results and the thermodynamic database developed have been used to identify potential compositions for the MSFR fuel and to evaluate the influence of partial substitution of ThF4 by UF4 in the salt.
Method of forming and starting a sodium sulfur battery
Paquette, David G.
1981-01-01
A method of forming a sodium sulfur battery and of starting the reactive capability of that battery when heated to a temperature suitable for battery operation is disclosed. An anodic reaction zone is constructed in a manner that sodium is hermetically sealed therein, part of the hermetic seal including fusible material which closes up openings through the container of the anodic reaction zone. The hermetically sealed anodic reaction zone is assembled under normal atmospheric conditions with a suitable cathodic reaction zone and a cation-permeable barrier. When the entire battery is heated to an operational temperature, the fusible material of the hermetically sealed anodic reaction zone is fused, thereby allowing molten sodium to flow from the anodic reaction zone into reactive engagement with the cation-permeable barrier.
Where Do I Start? A School Library Handbook
ERIC Educational Resources Information Center
Linworth, 2001
2001-01-01
Whether you are a new school library media specialist just starting in the profession, or a more experienced librarian who may not have the time to research and gather the information you need, this comprehensive guide provides an excellent overview of numerous topics related to school libraries. Written in easy-to-understand language, this…
Fluoride glass starting materials - Characterization and effects of thermal treatment
NASA Technical Reports Server (NTRS)
Chen, William; Dunn, Bruce; Shlichta, Paul; Neilson, George F.; Weinberg, Michael C.
1987-01-01
The production of heavy metal fluoride (HMF) glasses, and the effects of thermal treatments on the HMF glasses are investigated. ZrF4, BaF2, AlF3, LaF3, and NaF were utilized in the synthesis of zirconium-barium-lanthanum-aluminum-sodium fluoride glass. The purity of these starting materials, in particular ZrF4, is evaluated using XRD analysis. The data reveal that low temperature heating of ZrF4-H2O is effective in removing the water of hydration, but causes the production of ZrF4 and oxyfluorides; however, dehydration followed by sublimation results in the production of monoclinic ZrFe without water or oxyfluoride contaminants.
On the oxidation of the three-dimensional aromatics [B(12)X(12)](2-) (X=F, Cl, Br, I).
Boeré, René T; Derendorf, Janis; Jenne, Carsten; Kacprzak, Sylwia; Kessler, Mathias; Riebau, Rainer; Riedel, Sebastian; Roemmele, Tracey L; Rühle, Monika; Scherer, Harald; Vent-Schmidt, Thomas; Warneke, Jonas; Weber, Stefan
2014-04-07
The perhalogenated closo-dodecaborate dianions [B12 X12 ](2-) (X=H, F, Cl, Br, I) are three-dimensional counterparts to the two-dimensional aromatics C6 X6 (X=H, F, Cl, Br, I). Whereas oxidation of the parent compounds [B12 H12 ](2-) and benzene does not lead to isolable radicals, the perhalogenated analogues can be oxidized by chemical or electrochemical methods to give stable radicals. The chemical oxidation of the closo-dodecaborate dianions [B12 X12 ](2-) with the strong oxidizer AsF5 in liquid sulfur dioxide (lSO2 ) yielded the corresponding radical anions [B12 X12 ](⋅-) (X=F, Cl, Br). The presence of radical ions was proven by EPR and UV/Vis spectroscopy and supported by quantum chemical calculations. Use of an excess amount of the oxidizing agent allowed the synthesis of the neutral perhalogenated hypercloso-boranes B12 X12 (X=Cl, Br). These compounds were characterized by single-crystal X-ray diffraction of dark blue B12 Cl12 and [Na(SO2 )6 ][B12 Br12 ]⋅B12 Br12 . Sublimation of the crude reaction products that contained B12 X12 (X=Cl, Br) resulted in pure dark blue B12 Cl12 or decomposition to red B9 Br9 , respectively. The energetics of the oxidation processes in the gas phase were calculated by DFT methods at the PBE0/def2-TZVPP level of theory. They revealed the trend of increasing ionization potentials of the [B12 X12 ](2-) dianions by going from fluorine to bromine as halogen substituent. The oxidation of all [B12 X12 ](2-) dianions was also studied in the gas phase by mass spectrometry in an ion trap. The electrochemical oxidation of the closo-dodecaborate dianions [B12 X12 ](2-) (X=F, Cl, Br, I) by cyclic and Osteryoung square-wave voltammetry in liquid sulfur dioxide or acetonitrile showed very good agreement with quantum chemical calculations in the gas phase. For [B12 X12 ](2-) (X=F, Cl, Br) the first and second oxidation processes are detected. Whereas the first process is quasi-reversible (with oxidation potentials in the range between +1
Oral desensitization to milk: how to choose the starting dose!
Mori, Francesca; Pucci, Neri; Rossi, Maria Elisabetta; de Martino, Maurizio; Azzari, Chiara; Novembre, Elio
2010-01-01
Mori F, Pucci N, Rossi ME, de Martino M, Azzari C, Novembre E. Oral desensitization to milk: how to choose the starting dose! Pediatr Allergy Immunol 2010: 21: e450–e453. © 2009 John Wiley & Sons A/S A renewed interest in oral desensitization as treatment for food allergy has been observed in the last few years. We studied a novel method based on the end point skin prick test procedure to establish the starting dose for oral desensitization in a group of 30 children higly allergic to milk. The results (in terms of reactions to the first dose administered) were compared with a group of 20 children allergic to milk as well. Such control group started to swallow the same dose of 0.015 mg/ml of milk. None reacted to the first dose when administered according to the end point skin prick test. On the other side, ten out of 20 children (50%) from the control group showed mild allergic reactions to the first dose of milk. In conclusion the end point skin prick test procedure results safe and easy to be performed in each single child in order to find out the starting dose for oral desensitization to milk, also by taking into account the individual variability. PMID:19624618
Flight Problems, Problems in Starting Service,
1977-01-03
h i l e a t the same time preserving hi gh f l i g h t r egu la r i t~ l e a d s to t h e fa c t t h a t the t e c h n i cal s t a r t i n g... assembl ies and pa r t s of the a i r c r a f t d~ein the previous flight (R R ), the p r o b a b i l i t y of4pr esence in the landing airport of an...of the assemblies , sets and blocks /P.- can be exchange d in a single hour in case of defects. Furthermore , in the newly constructed L-lOll
Making a Simple Self-Starting Electric Motor
ERIC Educational Resources Information Center
Hong, Seok-In; Choi, Jung-In; Hong, Seok-Cheol
2009-01-01
A simple electric motor has a problem in that the current applied to the motor per se can rarely trigger its rotation. Usually such motors begin to rotate after the rotor is slightly turned by hand (i.e., manual starting). In a "self-starting" motor, the rotor starts to rotate spontaneously as soon as the current is applied. This paper describes…
7 CFR 15f.11 - Where must I file a hearing request and what happens to it?
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Where must I file a hearing request and what happens to it? 15f.11 Section 15f.11 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER... must I file a hearing request and what happens to it? If you desire a hearing, you must file a request...
PLUMEX I: Coincident Radar and Rocket Observations of Equatorial Spread-F.
1980-03-17
SCLmS1RESTOw, VA. 2n"g fIC? ArTN PIm KIM L10I@ICY ATN W14~ PAT C~aSIc ? A T T N C O D E A k io J A MCS A T. O sI w a C LA R K wATNOS .JISU NL# ICY...AG CY SICY ATTN OYC CAPT J. MARY PT. NqtD~ulr.J 07703 SICY ATTN DoC JOH A. 9Aq SICY ATTN OCCUENT CONTROL SICY ATTN OTT CAT HAM A. PRY SICY ATTN DES IAJ...CA 9550 OC T ATTN A. B. IAZZARI 0iCr ATTN OX: CON POP TEO IW OEPT OICY ATTN DOC CON POP L-309 R. OTT EADQUARTERS ICY A"T DOC CON FO L-51 I
Analysis of task-evoked systemic interference in fNIRS measurements: insights from fMRI.
Erdoğan, Sinem B; Yücel, Meryem A; Akın, Ata
2014-02-15
Functional near infrared spectroscopy (fNIRS) is a promising method for monitoring cerebral hemodynamics with a wide range of clinical applications. fNIRS signals are contaminated with systemic physiological interferences from both the brain and superficial tissues, resulting in a poor estimation of the task related neuronal activation. In this study, we use the anatomical resolution of functional magnetic resonance imaging (fMRI) to extract scalp and brain vascular signals separately and construct an optically weighted spatial average of the fMRI blood oxygen level-dependent (BOLD) signal for characterizing the scalp signal contribution to fNIRS measurements. We introduce an extended superficial signal regression (ESSR) method for canceling physiology-based systemic interference where the effects of cerebral and superficial systemic interference are treated separately. We apply and validate our method on the optically weighted BOLD signals, which are obtained by projecting the fMRI image onto optical measurement space by use of the optical forward problem. The performance of ESSR method in removing physiological artifacts is compared to i) a global signal regression (GSR) method and ii) a superficial signal regression (SSR) method. The retrieved signals from each method are compared with the neural signals that represent the 'ground truth' brain activation cleaned from cerebral systemic fluctuations. We report significant improvements in the recovery of task induced neural activation with the ESSR method when compared to the other two methods as reflected in the Pearson R(2) coefficient and mean square error (MSE) metrics (two tailed paired t-tests, p<0.05). The signal quality is enhanced most when ESSR method is applied with higher spatial localization, lower inter-trial variability, a clear canonical waveform and higher contrast-to-noise (CNR) improvement (60%). Our findings suggest that, during a cognitive task i) superficial scalp signal contribution to f
LRS Bianchi Type-I Bulk Viscous Cosmological Models in f( R, T) Gravity
NASA Astrophysics Data System (ADS)
Sahoo, P.; Reddy, R.
2018-03-01
We have studied the locally rotationally symmetric (LRS) Bianchi type-I cosmological model in f ( R, T) gravity (R is the Ricci scalar and T is the trace of the stress energy tensor) with bulk viscous fluid as matter content. The model is constructed for the linear form f ( R, T) = R + 2 f ( T). The exact solution of the field equations is obtained by using a time varying deceleration parameter q for a suitable choice of the function f ( T). In this case, the bulk viscous pressure \\overline{p} is found to be negative and the energy density ρ is found to be positive. The obtained model is anisotropic, accelerating, and compatible with the results of astronomical observations. Also, some important features of physical parameters of this model have been discussed.
Federal Register 2010, 2011, 2012, 2013, 2014
2013-06-10
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Prospective Grant of Start-up Exclusive Evaluation License: Portable Device and Method for Detecting Hematomas AGENCY: National... device and method for detecting hematomas based on near infrared light emitted perpendicularly into a...
ERIC Educational Resources Information Center
Zahnd, Whitney E.; Smith, Tracey; Ryherd, Susan J.; Cleer, Melissa; Rogers, Valerie; Steward, David E.
2017-01-01
Background: Schools may be an effective avenue for interventions that prevent childhood obesity. "I am Moving I am Learning/Choosy Kids"© (IMIL/CK) is a curriculum recommended by Head Start (HS) for education in nutrition, physical activity, and healthy lifestyle habits. Methods: We formed an academic-community partnership (ACP), the…
Li, Jihong; Evans, Daniel R; Freedman, John C; McClane, Bruce A
2017-09-01
Clostridium perfringens can produce up to three different sialidases, including NanI, its major exosialidase. The current study first showed that human intestinal strains of C. perfringens can grow by utilizing either glucose or sialic acids, such as N -acetylneuraminic acid (Neu5Ac), which are the end products of sialidase activity. For the human enteropathogenic strain F4969, it was then determined that culture supernatant sialidase activity and expression of exosialidase genes, particularly nanI , are influenced by the presence of Neu5Ac or glucose. Low Neu5Ac concentrations increased culture supernatant sialidase activity, largely by stimulating nanI transcription. In contrast, low glucose concentrations did not affect exosialidase activity or nanI transcription. However, either high Neu5Ac or high glucose concentrations repressed F4969 culture supernatant sialidase activity and nanI transcription levels. Furthermore, high glucose levels repressed F4969 culture sialidase activity and nanI expression even in the presence of low Neu5AC concentrations. To begin to evaluate the mechanistic basis for nanI expression, a nanR null mutant was used to demonstrate that NanR, a member of the RpiR family of regulatory proteins, decreases exosialidase activity and nanI transcription in the absence of sialic acid. The ability of C. perfringens to regulate its exosialidase activity, largely by controlling nanI expression, may affect intestinal pathogenesis by affecting the production of NanI, which may affect C. perfringens growth, adhesion, and toxin binding in vivo . Copyright © 2017 American Society for Microbiology.
Federal Register 2010, 2011, 2012, 2013, 2014
2013-07-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Prospective Grant of Start-Up Exclusive Evaluation Option License: Methods of Treating Giardiasis Using Available Compounds.../2013 filed April 22, 2013 (E-211- 2010/2-IN-05); each entitled ``Methods of Treating Giardiasis'' by...
Assessment of the PCDD/F fate from MSWI residue used in road construction in France.
Badreddine, R; François, D
2009-01-01
MSWI fly ash is susceptible to contain high amount of polychlorinated dibenzo-dioxins and polychlorinated dibenzo-furans. However, the use of MSWI residue for road construction started in France at a period when MSWI Bottom Ash and MSWI fly ash were not separated. From four old road sites, MSWI residue, road soils, reference soils and geo-textiles were sampled and their PCDD/F contents were analyzed. MSWI residue show a great heterogeneity but also high amounts of PCDD/F (14-2960 ng I-TEQ kg(-1)dm). Soils underlying the road show less heterogeneity and PCDD/F contents between 0.57 and 7.23 ng I-TEQ kg(-1)dm, lower than ordinary soils. Moreover, the specific analysis of the 17 toxic PCDD/F congeners (notably the 2,3,7,8-TetraCDD) indicates the very low harmfulness of road soils. The study also allows to assert the relation between the MSWI residue particle size and the PCDD/F content.
Double-inversion mechanisms of the X⁻ + CH₃Y [X,Y = F, Cl, Br, I] SN2 reactions.
Szabó, István; Czakó, Gábor
2015-03-26
The double-inversion and front-side attack transition states as well as the proton-abstraction channels of the X(-) + CH3Y [X,Y = F, Cl, Br, I] reactions are characterized by the explicitly correlated CCSD(T)-F12b/aug-cc-pVTZ(-PP) level of theory using small-core relativistic effective core potentials and the corresponding aug-cc-pVTZ-PP bases for Br and I. In the X = F case the double-inversion classical(adiabatic) barrier heights are 28.7(25.6), 15.8(13.4), 13.2(11.0), and 8.6(6.6) kcal mol(-1) for Y = F, Cl, Br, and I, respectively, whereas the barrier heights are in the 40-90 kcal mol(-1) range for the other 12 reactions. The abstraction channels are always above the double-inversion saddle points. For X = F, the front-side attack classical(adiabatic) barrier heights, 45.8(44.8), 31.0(30.3), 24.7(24.2), and 19.5(19.3) kcal mol(-1) for Y = F, Cl, Br, and I, respectively, are higher than the corresponding double-inversion ones, whereas for the other systems the front-side attack saddle points are in the 35-70 kcal mol(-1) range. The double-inversion transition states have XH···CH2Y(-) structures with Cs point-group symmetry, and the front-side attack saddle points have either Cs (X = F or X = Y) or C1 symmetry with XCY angles in the 78-88° range. On the basis of the previous reaction dynamics simulations and the minimum energy path computations along the inversion coordinate of selected XH···CH2Y(-) systems, we suggest that the double inversion may be a general mechanism for SN2 reactions.
10. Photographed 19131914 by L. M. Leisenring, F.A.I.A. Presented by ...
10. Photographed 1913-1914 by L. M. Leisenring, F.A.I.A. Presented by Mr. Leisenring 1959 - Dr. David Ross House, Annapolis Road (moved to Preservation Hill, Western Run Road, Cockeysville), Bladensburg, Prince George's County, MD
11. Photographed 19131914 by L. M. Leisenring, F.A.I.A. Presented by ...
11. Photographed 1913-1914 by L. M. Leisenring, F.A.I.A. Presented by Mr. Leisenring 1959 - Dr. David Ross House, Annapolis Road (moved to Preservation Hill, Western Run Road, Cockeysville), Bladensburg, Prince George's County, MD
'I left the NHS to start a business'.
Shaw, Sally
2016-05-18
It was December 2011. As I walked through the snow towards the hospital I'd worked at since I was 19, a feeling of despair came over me. I heard myself say out loud: 'I will not be doing this, this time next year.' It took me by surprise - it was not a question, it was a fact.
Gülfen, Mustafa; Özdemir, Abdil; Lin, Jung-Lee; Chen, Chung-Hsuan
2017-10-01
In this study, the dissociation and formation equilibrium constants of Na(I)-insulin and K(I)-insulin complexes have been calculated after the quantifying them on ESI mass spectrometer. The ESI-MS spectra of the complexes were measured by using the solvents as 50% MeOH in water and 100% water. The effect of pH on the Na(I)-insulin and K(I)-insulin complex formation were examined. Serial binding of Na(I) and K(I) ions to the insulin molecule were observed in the ESI-MS measurements. The first formation equilibrium constants were calculated as K f1 : 5.48×10 3 1/M for Na(I)-insulin complex and K f1 : 4.87×10 3 1/M for K(I)-insulin in water. The binding capability of Na(I) ions to insulin molecule is higher than the capability of K(I) ions. In case of a comparison together with Ca(II)-insulin and Mg(II)-insulin, the formation equilibrium constants (K f1 ) are in order of Ca(II)-insulin>Mg(II)-insulin>Na(I)-insulin>K(I)-insulin in water. The results showed that Na(I) and K(I) ions are involved in the formation of the non-covalent complexes with insulin molecule, since high extracellular and intracellular concentrations of them in the body. Copyright © 2017 Elsevier B.V. All rights reserved.
2003-03-01
was appreciated and their expertise was invaluable. I would also like to thank laboratory technician, Mr. Eric Taylor, whose assistance, skill...Sagdeev, “Detecting Nuclear Warheads,” in Reversing the Arms Race: How to Achieve and Verify Deep Reductions in the Nuclear Arsenals. Ed. F. von ... Hippel and R.Z. Sagdeev. New York: Gordon and Breach Science Publishers, 1990 7) Brigman, Charles J. Introduction To The Physics of Nuclear Weapon
Hassan, Hishar; Abu Bakar, Suharzelim; Halim, Khairul Najah Che A; Idris, Jaleezah; Nordin, Abdul Jalil
2016-01-01
. Using our parameters, (capillary column: DB-200, 30 m x 0.53 mm x 1 um) and oven temperature of 35°C (isothermal), all compounds were well resolved and eluted within 3 minutes. Level of ethanol and acetonitrile in 18F-Fluorocholine were detected below threshold limit; less than 5 mg/ml and 0.41 mg/ml respectively. Meanwhile, dimethylethanolamine and dibromomethane were undetectable. A convenient, efficient and reliable quality control analysis work-up procedure for 18FFluorocholine has been established and validated to comply all the release criteria. The convenient method of quality control analysis may provide a guideline to local GMP radiopharmaceutical laboratories to start producing 18F-Fluorocholine as a tracer for prostate cancer imaging.
Hyperfine structure of atomic fluorine (F I)
NASA Astrophysics Data System (ADS)
Huo, Xiaoxue; Deng, Lunhua; Windholz, L.; Mu, Xiuli; Wang, Hailing
2018-01-01
A high resolution absorption spectrum of neutral fluorine(F I) was observed around 800 nm using concentration modulation absorption spectroscopy with a tunable Ti : Sapphire laser. The fluorine atoms were produced by discharging the mixed gases of helium and sulfur hexafluoride (SF6) in a glass tube. Thirty four hyperfine structure (hfs) resolved transitions were analyzed to obtain 23 magnetic dipole hfs constants A for 2p4(3P)3s, 2p4(3P)3p and 2p4(3P)3d configurations. The hfs constants in 2p4(3P)3s and 2p4(3P)3p configurations were compared with those obtained from experiments and calculations. Fifteen constants in 2p4(3P)3d configuration were reported - to our knowledge - for the first time.
Disturbance dynamo effects over low-latitude F region: A study by network of VHF spaced receivers
NASA Astrophysics Data System (ADS)
Kakad, B.; Surve, G.; Tiwari, P.; Yadav, V.; Bhattacharyya, A.
2017-05-01
Generation of equatorial spread F (ESF) irregularities resulting from magnetic disturbance is known for past few decades. However, better prediction models for this phenomenon are still lacking. Magnetic storms also affects the F region plasma drifts. In this work we examined variability in (i) occurrence of such freshly generated ESF and (ii) low-latitude F region zonal plasma drifts over Indian longitude. For this purpose simultaneous observations of amplitude scintillations on 251 MHz signal, recorded by a network of spaced receivers located at low-latitude stations, are utilized. Observational stations are situated such that it longitudinally (latitudinally) covers an area of 5.6° (13°). Here effect of disturbance dynamo (DD) electric field at low-latitude F region and its variability are studied for three magnetic storms occurring in 2011. These magnetic storms are having nearly similar type characteristics except their start time. We find that as time difference (i.e., ΔT) between local sunset and start of magnetic activity decreases, the DD effects seen at low-latitude F region zonal irregularity drift around midnight becomes stronger. For a given magnetic storm the DD effect on F region zonal irregularity drifts is found to be only marginally stronger at dip equator in comparison to off-equatorial stations. Although effect of DD on F region zonal irregularity drifts are felt simultaneously, generation of fresh ESF is variable within a smaller longitudinal belt of 5.6°. It is attributed to the presence of LSWS at the bottomside of F region, as initiation of ESF is highly likely (unlikely) in the vicinity of crest (trough) of such LSWS.
Baldo, Guilherme; Mayer, Fabiana Q; Martinelli, Bárbara Z; de Carvalho, Talita G; Meyer, Fabiola S; de Oliveira, Patrícia G; Meurer, Luise; Tavares, Angela; Matte, Ursula; Giugliani, Roberto
2013-05-01
Since we previously observed that in patients with mucopolysaccharidosis (MPS) the storage of undegraded glycosaminoglycans (GAG) occurs from birth, in the present study we aimed to compare normal, untreated MPS I mice (knockout for alpha-l-iduronidase-IDUA), and MPS I mice treated with enzyme replacement therapy (ERT, Laronidase, 1.2mg/kg every 2 weeks) started from birth (ERT-neo) or from 2 months of age (ERT-ad). All mice were sacrificed at 6 months. Both treatments were equally effective in normalizing GAG levels in the viscera but had no detectable effect on the joint. Heart function was also improved with both treatments. On the other hand, mice treated from birth presented better outcomes in the difficult-to-treat aortas and heart valves. Surprisingly, both groups had improvements in behavior tests, and normalization of GAG levels in the brain and IDUA injection resulted in detectable levels of enzyme in the brain tissue 1h after administration. ERT-ad mice developed significantly more anti-IDUA-IgG antibodies, and mice that didn't develop antibodies had better performances in behavior tests, indicating that development of antibodies may reduce enzyme bioavailability. Our results suggest that ERT started from birth leads to better outcomes in the aorta and heart valves, as well as a reduction in antibody levels. Some poor vascularized organs, such as the joints, had partial or no benefit and ancillary therapies might be needed for patients. The results presented here support the idea that ERT started from birth leads to better treatment outcomes and should be considered whenever possible, a observation that gains relevance as newborn screening programs are being considered for MPS and other treatable lysosomal storage disorders. Copyright © 2013 Elsevier Inc. All rights reserved.
Way, Jenilee Dawn; Wuest, Frank
2014-02-01
4-[18F]Fluoroiodobenzene ([18F]FIB) is a versatile building block in 18F radiochemistry used in various transition metal-mediated C-C and C-N cross-coupling reactions and [18F]fluoroarylation reactions. Various synthesis routes have been described for the preparation of [18F]FIB. However, to date, no automated synthesis of [18F]FIB has been reported to allow access to larger amounts of [18F]FIB in high radiochemical and chemical purity. Herein, we describe an automated synthesis of no-carrier-added [18F]FIB on a GE TRACERlab™ FX automated synthesis unit starting from commercially available(4-iodophenyl)diphenylsulfonium triflate as the labelling precursor. [18F]FIB was prepared in high radiochemical yields of 89 ± 10% (decay-corrected, n = 7) within 60 min, including HPLC purification. The radiochemical purity exceeded 95%, and specific activity was greater than 40 GBq/μmol. Typically, from an experiment, 6.4 GBq of [18F]FIB could be obtained starting from 10.4 GBq of [18F]fluoride.
HPLC and TLC methods for analysis of [18F]FDG and its metabolites from biological samples.
Rokka, Johanna; Grönroos, Tove J; Viljanen, Tapio; Solin, Olof; Haaparanta-Solin, Merja
2017-03-24
The most used positron emission tomography (PET) tracer, 2-[ 18 F]fluoro-2-deoxy-d-glucose ([ 18 F]FDG), is a glucose analogue that is used to measure tissue glucose consumption. Traditionally, the Sokoloff model is the basis for [ 18 F]FDG modeling. According to this model, [ 18 F]FDG is expected to be trapped in a cell in the form of [ 18 F]FDG-6-phosphate ([ 18 F]FDG-6-P). However, several studies have shown that in tissues, [ 18 F]FDG metabolism goes beyond [ 18 F]FDG-6-P. Our aim was to develop radioHPLC and radioTLC methods for analysis of [ 18 F]FDG metabolites from tissue samples. The radioHPLC method uses a sensitive on-line scintillation detector to detect radioactivity, and the radioTLC method employs digital autoradiography to detect the radioactivity distribution on a TLC plate. The HPLC and TLC methods were developed using enzymatically in vitro-produced metabolites of [ 18 F]FDG as reference standards. For this purpose, three [ 18 F]FDG metabolites were synthesized: [ 18 F]FDG-6-P, [ 18 F]FD-PGL, and [ 18 F]FDG-1,6-P2. The two methods were evaluated by analyzing the [ 18 F]FDG metabolic profile from rodent ex vivo tissue homogenates. The HPLC method with an on-line scintillation detector had a wide linearity in a range of 5Bq-5kBq (LOD 46Bq, LOQ 139Bq) and a good resolution (Rs ≥1.9), and separated [ 18 F]FDG and its metabolites clearly. The TLC method combined with digital autoradiography had a high sensitivity in a wide range of radioactivity (0.1Bq-2kBq, LOD 0.24Bq, LOQ 0.31Bq), and multiple samples could be analyzed simultaneously. As our test and the method validation with ex vivo samples showed, both methods are useful, and at best they complement each other in analysis of [ 18 F]FDG and its radioactive metabolites from biological samples. Copyright © 2017 Elsevier B.V. All rights reserved.
Bundhun, Ashwini; Abdallah, Hassan H; Ramasami, Ponnadurai; Schaefer, Henry F
2010-12-23
A systematic investigation of the X-Ge-CY(3) (X = H, F, Cl, Br, and I; Y = F, Cl, Br, and I) species is carried out using density functional theory. The basis sets used for all atoms (except iodine) in this work are of double-ζ plus polarization quality with additional s- and p-type diffuse functions, and denoted DZP++. Vibrational frequency analyses are performed to evaluate zero-point energy corrections and to determine the nature of the stationary points located. Predicted are four different forms of neutral-anion separations: adiabatic electron affinity (EA(ad)), zero-point vibrational energy corrected EA(ad(ZPVE)), vertical electron affinity (EA(vert)), and vertical detachment energy (VDE). The electronegativity (χ) reactivity descriptor for the halogens (X = F, Cl, Br, and I) is used as a tool to assess the interrelated properties of these germylenes. The topological position of the halogen atom bound to the divalent germanium center is well correlated with the trend in the electron affinities and singlet-triplet gaps. For the expected XGeCY(3) structures (X = H, F, Cl, Br, and I; Y = F and Cl), the predicted trend in the electron affinities is well correlated with simpler germylene derivatives (J. Phys. Chem. A 2009, 113, 8080). The predicted EA(ad(ZPVE)) values with the BHLYP functional range from 1.66 eV (FGeCCl(3)) to 2.20 eV (IGeCF(3)), while the singlet-triplet splittings range from 1.28 eV (HGeCF(3)) to 2.22 eV (FGeCCl(3)). The XGeCY(3) (Y = Br and I) species are most often characterized by three-membered cyclic systems involving the divalent germanium atom, the carbon atom, and a halogen atom.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pantelis, E.; Moutsatsos, A.; Zourari, K.
Purpose: To measure the output factors (OFs) of the small fields formed by the variable aperture collimator system (iris) of a CyberKnife (CK) robotic radiosurgery system, and determine the k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} correction factors for a microchamber and four diode detectors. Methods: OF measurements were performed using a PTW PinPoint 31014 microchamber, four diode detectors (PTW-60017, -60012, -60008, and the SunNuclear EDGE detector), TLD-100 microcubes, alanine dosimeters, EBT films, and polymer gels for the 5 mm, 7.5 mm, 10 mm, 12.5 mm, and 15 mm irismore » collimators at 650 mm, 800 mm, and 1000 mm source to detector distance (SDD). The alanine OF measurements were corrected for volume averaging effects using the 3D dose distributions registered in polymer gel dosimeters. k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} correction factors for the PinPoint microchamber and the diode dosimeters were calculated through comparison against corresponding polymer gel, EBT, alanine, and TLD results. Results: Experimental OF results are presented for the array of dosimetric systems used. The PinPoint microchamber was found to underestimate small field OFs, and a k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} correction factor ranging from 1.127 {+-} 0.022 (for the 5 mm iris collimator) to 1.004 {+-} 0.010 (for the 15 mm iris collimator) was determined at the reference SDD of 800 mm. The PinPoint k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} correction factor was also found to increase with decreasing SDD; k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} values equal to 1.220 {+-} 0.028 and 1
Castro-Chavez, Fernando
2012-01-01
Background Three binary representations of the genetic code according to the ancient I Ching of Fu-Xi will be presented, depending on their defragging capabilities by pairing based on three biochemical properties of the nucleic acids: H-bonds, Purine/Pyrimidine rings, and the Keto-enol/Amino-imino tautomerism, yielding the last pair a 32/32 single-strand self-annealed genetic code and I Ching tables. Methods Our working tool is the ancient binary I Ching's resulting genetic code chromosomes defragged by vertical and by horizontal pairing, reverse engineered into non-binaries of 2D rotating 4×4×4 circles and 8×8 squares and into one 3D 100% symmetrical 16×4 tetrahedron coupled to a functional tetrahedron with apical signaling and central hydrophobicity (codon formula: 4[1(1)+1(3)+1(4)+4(2)]; 5:5, 6:6 in man) forming a stella octangula, and compared to Nirenberg's 16×4 codon table (1965) pairing the first two nucleotides of the 64 codons in axis y. Results One horizontal and one vertical defragging had the start Met at the center. Two, both horizontal and vertical pairings produced two pairs of 2×8×4 genetic code chromosomes naturally arranged (M and I), rearranged by semi-introversion of central purines or pyrimidines (M' and I') and by clustering hydrophobic amino acids; their quasi-identity was disrupted by amino acids with odd codons (Met and Tyr pairing to Ile and TGA Stop); in all instances, the 64-grid 90° rotational ability was restored. Conclusions We defragged three I Ching representations of the genetic code while emphasizing Nirenberg's historical finding. The synthetic genetic code chromosomes obtained reflect the protective strategy of enzymes with a similar function, having both humans and mammals a biased G-C dominance of three H-bonds in the third nucleotide of their most used codons per amino acid, as seen in one chromosome of the i, M and M' genetic codes, while a two H-bond A-T dominance was found in their complementary chromosome, as seen
Paixão, Paulo; Gouveia, Luís F; Silva, Nuno; Morais, José A G
2017-03-01
A simulation study is presented, evaluating the performance of the f 2 , the model-independent multivariate statistical distance and the f 2 bootstrap methods in the ability to conclude similarity between two dissolution profiles. Different dissolution profiles, based on the Noyes-Whitney equation and ranging from theoretical f 2 values between 100 and 40, were simulated. Variability was introduced in the dissolution model parameters in an increasing order, ranging from a situation complying with the European guidelines requirements for the use of the f 2 metric to several situations where the f 2 metric could not be used anymore. Results have shown that the f 2 is an acceptable metric when used according to the regulatory requirements, but loses its applicability when variability increases. The multivariate statistical distance presented contradictory results in several of the simulation scenarios, which makes it an unreliable metric for dissolution profile comparisons. The bootstrap f 2 , although conservative in its conclusions is an alternative suitable method. Overall, as variability increases, all of the discussed methods reveal problems that can only be solved by increasing the number of dosage form units used in the comparison, which is usually not practical or feasible. Additionally, experimental corrective measures may be undertaken in order to reduce the overall variability, particularly when it is shown that it is mainly due to the dissolution assessment instead of being intrinsic to the dosage form. Copyright © 2016. Published by Elsevier B.V.
Groen, C P; Oskam, A; Kovács, A
2000-12-25
The structure, bonding and vibrational properties of the mixed LiLnX4 (Ln = La, Dy; X = F, Cl, Br, I) rare earth/alkali halide complexes were studied using various quantum chemical methods (HF, MP2 and the Becke3-Lee-Yang-Parr exchange-correlation density functional) in conjunction with polarized triple-zeta valence basis sets and quasi-relativistic effective core potentials for the heavy atoms. Our comparative study indicated the superiority of MP2 theory while the HF and B3-LYP methods as well as less sophisticated basis sets failed for the correct energetic relations. In particular, f polarization functions on Li and X proved to be important for the Li...X interaction in the complexes. From the three characteristic structures of such complexes, possessing 1-(C3v), 2-(C2v), or 3-fold coordination (C3v) between the alkali metal and the bridging halide atoms, the bi- and tridentate forms are located considerably lower on the potential energy surface then the monodentate isomer. Therefore only the bi- and tridentate isomers have chemical relevance. The monodentate isomer is only a high-lying local minimum in the case of X = F. For X = Cl, Br, and I this structure is found to be a second-order saddle point. The bidentate structure was found to be the global minimum for the systems with X = F, Cl, and Br. However, the relative stability with respect to the tridentate structure is very small (1-5 kJ/mol) for the heavier halide derivatives and the relative order is reversed in the case of the iodides. The energy difference between the three structures and the dissociation energy decrease in the row F to I. The ionic bonding in the complexes was characterized by natural charges and a topological analysis of the electron density distribution according to Bader's theorem. Variation of the geometrical and bonding characteristics between the lanthanum and dysprosium complexes reflects the effect of "lanthanide contraction". The calculated vibrational data indicate that
Comparison of microstickies measurement methods. Part I, sample preparation and measurement methods
Mahendra R. Doshi; Angeles Blanco; Carlos Negro; Gilles M. Dorris; Carlos C. Castro; Axel Hamann; R. Daniel Haynes; Carl Houtman; Karen Scallon; Hans-Joachim Putz; Hans Johansson; R.A. Venditti; K. Copeland; H.-M. Chang
2003-01-01
Recently, we completed a project on the comparison of macrostickies measurement methods. Based on the success of the project, we decided to embark on this new project on comparison of microstickies measurement methods. When we started this project, there were some concerns and doubts principally due to the lack of an accepted definition of microstickies. However, we...
Physics of Tokamak Plasma Start-up
NASA Astrophysics Data System (ADS)
Mueller, Dennis
2012-10-01
This tutorial describes and reviews the state-of-art in tokamak plasma start-up and its importance to next step devices such as ITER, a Fusion Nuclear Science Facility and a Tokamak/ST demo. Tokamak plasma start-up includes breakdown of the initial gas, ramp-up of the plasma current to its final value and the control of plasma parameters during those phases. Tokamaks rely on an inductive component, typically a central solenoid, which has enabled attainment of high performance levels that has enabled the construction of the ITER device. Optimizing the inductive start-up phase continues to be an area of active research, especially in regards to achieving ITER scenarios. A new generation of superconducting tokamaks, EAST and KSTAR, experiments on DIII-D and operation with JET's ITER-like wall are contributing towards this effort. Inductive start-up relies on transformer action to generate a toroidal loop voltage and successful start-up is determined by gas breakdown, avalanche physics and plasma-wall interaction. The goal of achieving steady-sate tokamak operation has motivated interest in other methods for start-up that do not rely on the central solenoid. These include Coaxial Helicity Injection, outer poloidal field coil start-up, and point source helicity injection, which have achieved 200, 150 and 100 kA respectively of toroidal current on closed flux surfaces. Other methods including merging reconnection startup and Electron Bernstein Wave (EBW) plasma start-up are being studied on various devices. EBW start-up generates a directed electron channel due to wave particle interaction physics while the other methods mentioned rely on magnetic helicity injection and magnetic reconnection which are being modeled and understood using NIMROD code simulations.
Gil, Tae Young; Lee, Do Kyung; Lee, Jung Min; Yoo, Eun Sun; Ryu, Kyung-Ha
2014-06-01
To evaluate the potential utility of (123)I-metaiodobenzylguanine ((123)I-MIBG) scintigraphy and (18)F-fluorodeoxyglucose ((18)F-FDG) positron emission tomography (PET) for the detection of primary and metastatic lesions in pediatric neuroblastoma (NBL) patients, and to determine whether (18)F-FDG PET is as beneficial as (123)I-MIBG imaging. We selected 8 NBL patients with significant residual mass after operation and who had paired (123)I-MIBG and (18)F-FDG PET images that were obtained during the follow-up. We retrospectively reviewed the clinical charts and the findings of 45 paired scans. Both scans correlated relatively well with the disease status as determined by standard imaging modalities during follow-up; the overall concordance rates were 32/45 (71.1%) for primary tumor sites and 33/45 (73.3%) for bone-bone marrow (BM) metastatic sites. In detecting primary tumor sites, (123)I-MIBG might be superior to (18)F-FDG PET. The sensitivity of (123)I-MIBG and (18)F-FDG PET were 96.7% and 70.9%, respectively, and their specificity were 85.7% and 92.8%, respectively. (18)F-FDG PET failed to detect 9 true NBL lesions in 45 follow-up scans (false negative rate, 29%) with positive (123)I-MIBG. For bone-BM metastatic sites, the sensitivity of (123)I-MIBG and (18)F-FDG PET were 72.7% and 81.8%, respectively, and the specificity were 79.1% and 100%, respectively. (123)I-MIBG scan showed higher false positivity (20.8%) than (18)F-FDG PET (0%). (123)I-MIBG is superior for delineating primary tumor sites, and (18)F-FDG PET could aid in discriminating inconclusive findings on bony metastatic NBL. Both scans can be complementarily used to clearly determine discrepancies or inconclusive findings on primary or bone-BM metastatic NBL during follow-up.
Bulgarelli, Chiara; Blasi, Anna; Arridge, Simon; Powell, Samuel; de Klerk, Carina C J M; Southgate, Victoria; Brigadoi, Sabrina; Penny, William; Tak, Sungho; Hamilton, Antonia
2018-04-12
Tracking the connectivity of the developing brain from infancy through childhood is an area of increasing research interest, and fNIRS provides an ideal method for studying the infant brain as it is compact, safe and robust to motion. However, data analysis methods for fNIRS are still underdeveloped compared to those available for fMRI. Dynamic causal modelling (DCM) is an advanced connectivity technique developed for fMRI data, that aims to estimate the coupling between brain regions and how this might be modulated by changes in experimental conditions. DCM has recently been applied to adult fNIRS, but not to infants. The present paper provides a proof-of-principle for the application of this method to infant fNIRS data and a demonstration of the robustness of this method using a simultaneously recorded fMRI-fNIRS single case study, thereby allowing the use of this technique in future infant studies. fMRI and fNIRS were simultaneously recorded from a 6-month-old sleeping infant, who was presented with auditory stimuli in a block design. Both fMRI and fNIRS data were preprocessed using SPM, and analysed using a general linear model approach. The main challenges that adapting DCM for fNIRS infant data posed included: (i) the import of the structural image of the participant for spatial pre-processing, (ii) the spatial registration of the optodes on the structural image of the infant, (iii) calculation of an accurate 3-layer segmentation of the structural image, (iv) creation of a high-density mesh as well as (v) the estimation of the NIRS optical sensitivity functions. To assess our results, we compared the values obtained for variational Free Energy (F), Bayesian Model Selection (BMS) and Bayesian Model Average (BMA) with the same set of possible models applied to both the fMRI and fNIRS datasets. We found high correspondence in F, BMS, and BMA between fMRI and fNIRS data, therefore showing for the first time high reliability of DCM applied to infant fNIRS data
Lai, L P; Su, M J; Lin, J L; Tsai, C H; Lin, F Y; Chen, Y S; Hwang, J J; Huang, S K; Tseng, Y Z; Lien, W P
1999-07-01
The funny current (I(f)) contributes to phase IV spontaneous depolarization in cardiac pacemaker tissue. Enhanced I(f) activity in myocardial tissue may lead to increased automaticity and therefore tachyarrhythmia. We measured the amount of I(f) activity in the messenger ribonucleic acid (mRNA) in human atrial tissue and correlated the mRNA amount to left atrial filling pressure and atrial fibrillation (AF). A total of 34 patients undergoing open heart surgery were included (15 men and 19 women, aged 55+/-10 years). Atrial tissue was obtained from the right atrial free wall, the right atrial appendage, the left atrial free wall, and the left atrial appendage, respectively. The mRNA amount of the I(f) channel was measured by reverse transcription polymerase chain reaction and was normalized to the mRNA levels of glyceraldehyde 3-phosphate dehydrogenase. We found that the I(f) channel mRNA was present at all the atrial sampling sites. A higher left atrial filling pressure, an indicator of congestive heart failure, was associated with a higher I(f) mRNA level (r2 = 0.446, P < 0.01 by linear regression). We also found that the mRNA amount was significantly higher in patients with AF than in patients without AF (1.68+/-0.49 vs 1.27+/-0.43; P < 0.05). Age, sex, right atrial filling pressure, left atrial dimension, and left ventricular ejection fraction had no significant effect on the mRNA level. The mRNA of the I(f) channel is present in the free-wall area and appendage area from both atria. Increased left atrial filling pressure and clinical AF are associated with increased I(f) mRNA level.
In situ genetic correction of F8 intron 22 inversion in hemophilia A patient-specific iPSCs
Wu, Yong; Hu, Zhiqing; Li, Zhuo; Pang, Jialun; Feng, Mai; Hu, Xuyun; Wang, Xiaolin; Lin-Peng, Siyuan; Liu, Bo; Chen, Fangping; Wu, Lingqian; Liang, Desheng
2016-01-01
Nearly half of severe Hemophilia A (HA) cases are caused by F8 intron 22 inversion (Inv22). This 0.6-Mb inversion splits the 186-kb F8 into two parts with opposite transcription directions. The inverted 5′ part (141 kb) preserves the first 22 exons that are driven by the intrinsic F8 promoter, leading to a truncated F8 transcript due to the lack of the last 627 bp coding sequence of exons 23–26. Here we describe an in situ genetic correction of Inv22 in patient-specific induced pluripotent stem cells (iPSCs). By using TALENs, the 627 bp sequence plus a polyA signal was precisely targeted at the junction of exon 22 and intron 22 via homologous recombination (HR) with high targeting efficiencies of 62.5% and 52.9%. The gene-corrected iPSCs retained a normal karyotype following removal of drug selection cassette using a Cre-LoxP system. Importantly, both F8 transcription and FVIII secretion were rescued in the candidate cell types for HA gene therapy including endothelial cells (ECs) and mesenchymal stem cells (MSCs) derived from the gene-corrected iPSCs. This is the first report of an efficient in situ genetic correction of the large inversion mutation using a strategy of targeted gene addition. PMID:26743572
In situ genetic correction of F8 intron 22 inversion in hemophilia A patient-specific iPSCs.
Wu, Yong; Hu, Zhiqing; Li, Zhuo; Pang, Jialun; Feng, Mai; Hu, Xuyun; Wang, Xiaolin; Lin-Peng, Siyuan; Liu, Bo; Chen, Fangping; Wu, Lingqian; Liang, Desheng
2016-01-08
Nearly half of severe Hemophilia A (HA) cases are caused by F8 intron 22 inversion (Inv22). This 0.6-Mb inversion splits the 186-kb F8 into two parts with opposite transcription directions. The inverted 5' part (141 kb) preserves the first 22 exons that are driven by the intrinsic F8 promoter, leading to a truncated F8 transcript due to the lack of the last 627 bp coding sequence of exons 23-26. Here we describe an in situ genetic correction of Inv22 in patient-specific induced pluripotent stem cells (iPSCs). By using TALENs, the 627 bp sequence plus a polyA signal was precisely targeted at the junction of exon 22 and intron 22 via homologous recombination (HR) with high targeting efficiencies of 62.5% and 52.9%. The gene-corrected iPSCs retained a normal karyotype following removal of drug selection cassette using a Cre-LoxP system. Importantly, both F8 transcription and FVIII secretion were rescued in the candidate cell types for HA gene therapy including endothelial cells (ECs) and mesenchymal stem cells (MSCs) derived from the gene-corrected iPSCs. This is the first report of an efficient in situ genetic correction of the large inversion mutation using a strategy of targeted gene addition.
Ecto-F1-ATPase: A moonlighting protein complex and an unexpected apoA-I receptor
Vantourout, Pierre; Radojkovic, Claudia; Lichtenstein, Laeticia; Pons, Véronique; Champagne, Eric; Martinez, Laurent O
2010-01-01
Mitochondrial ATP synthase has been recently detected at the surface of different cell types, where it is a high affinity receptor for apoA-I, the major protein component in high density lipoproteins (HDL). Cell surface ATP synthase (namely ecto-F1-ATPase) expression is related to different biological effects, such as regulation of HDL uptake by hepatocytes, endothelial cell proliferation or antitumor activity of Vγ9/Vδ2 T lymphocytes. This paper reviews the recently discovered functions and regulations of ecto-F1-ATPase. Particularly, the role of the F1-ATPase pathway(s) in HDL-cholesterol uptake and apoA-I-mediated endothelial protection suggests its potential importance in reverse cholesterol transport and its regulation might represent a potential therapeutic target for HDL-related therapy for cardiovascular diseases. Therefore, it is timely for us to better understand how this ecto-enzyme and downstream pathways are regulated and to develop pharmacologic interventions. PMID:21157968
A hybrid method for classifying cognitive states from fMRI data.
Parida, S; Dehuri, S; Cho, S-B; Cacha, L A; Poznanski, R R
2015-09-01
Functional magnetic resonance imaging (fMRI) makes it possible to detect brain activities in order to elucidate cognitive-states. The complex nature of fMRI data requires under-standing of the analyses applied to produce possible avenues for developing models of cognitive state classification and improving brain activity prediction. While many models of classification task of fMRI data analysis have been developed, in this paper, we present a novel hybrid technique through combining the best attributes of genetic algorithms (GAs) and ensemble decision tree technique that consistently outperforms all other methods which are being used for cognitive-state classification. Specifically, this paper illustrates the combined effort of decision-trees ensemble and GAs for feature selection through an extensive simulation study and discusses the classification performance with respect to fMRI data. We have shown that our proposed method exhibits significant reduction of the number of features with clear edge classification accuracy over ensemble of decision-trees.
Disordered Nd:LuYSiO5 crystal lasers operating on the 4F3/2 → 4I11/2 and 4F3/2 → 4I13/2 transitions
NASA Astrophysics Data System (ADS)
Guan, Xiaofeng; Zhou, Zhiyong; Huang, Xiaoxu; Xu, Bin; Xu, Huiying; Cai, Zhiping; Xu, Xiaodong; Xu, Jun
2017-11-01
We report on diode-pumped disordered Nd:LuYSiO5 (Nd:LYSO) crystal lasers operating on the 4F3/2 → 4I11/2 and 4F3/2 → 4I 13/2 transitions. Simultaneous laser operation at 1074 and 1078 nm is achieved with maximum output power of 4.46 W and slope efficiency of 39.6%. Single wavelength laser at 1358 nm with maximum output power of 1.15 W and slope efficiency of 11.8% is also obtained. Moreover, four single-wavelength lasers at 1058, 1107, 1330 and 1386 nm with relatively low gains are achieved with maximum output powers of 2.72, 1.22, 0.52 and 0.42 W, respectively, for the first time to our knowledge. Lasing at non-traditional emission lines was obtained by using output couplers with dielectric coatings for specific wavelength ranges.
11 CFR 300.72 - Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)).
Code of Federal Regulations, 2014 CFR
2014-01-01
....72 Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)). The requirements of section 11 CFR 300.71 shall not apply if the public communication is in connection with an election for... communications (2 U.S.C. 441i(f)(2)). 300.72 Section 300.72 Federal Elections FEDERAL ELECTION COMMISSION...
11 CFR 300.72 - Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)).
Code of Federal Regulations, 2013 CFR
2013-01-01
....72 Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)). The requirements of section 11 CFR 300.71 shall not apply if the public communication is in connection with an election for... communications (2 U.S.C. 441i(f)(2)). 300.72 Section 300.72 Federal Elections FEDERAL ELECTION COMMISSION...
11 CFR 300.72 - Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)).
Code of Federal Regulations, 2010 CFR
2010-01-01
....72 Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)). The requirements of section 11 CFR 300.71 shall not apply if the public communication is in connection with an election for... communications (2 U.S.C. 441i(f)(2)). 300.72 Section 300.72 Federal Elections FEDERAL ELECTION COMMISSION...
11 CFR 300.72 - Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)).
Code of Federal Regulations, 2011 CFR
2011-01-01
....72 Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)). The requirements of section 11 CFR 300.71 shall not apply if the public communication is in connection with an election for... communications (2 U.S.C. 441i(f)(2)). 300.72 Section 300.72 Federal Elections FEDERAL ELECTION COMMISSION...
11 CFR 300.72 - Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)).
Code of Federal Regulations, 2012 CFR
2012-01-01
....72 Federal funds not required for certain communications (2 U.S.C. 441i(f)(2)). The requirements of section 11 CFR 300.71 shall not apply if the public communication is in connection with an election for... communications (2 U.S.C. 441i(f)(2)). 300.72 Section 300.72 Federal Elections FEDERAL ELECTION COMMISSION...
Code of Federal Regulations, 2012 CFR
2012-04-01
... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) I Appendix I to Subpart F of... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) The following procedures apply to... ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES OF PUBLIC CONVENIENCE AND...
Code of Federal Regulations, 2010 CFR
2010-04-01
... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) I Appendix I to Subpart F of... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) The following procedures apply to... ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES OF PUBLIC CONVENIENCE AND...
Code of Federal Regulations, 2011 CFR
2011-04-01
... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) I Appendix I to Subpart F of... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) The following procedures apply to... ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES OF PUBLIC CONVENIENCE AND...
Code of Federal Regulations, 2013 CFR
2013-04-01
... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) I Appendix I to Subpart F of... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) The following procedures apply to... ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES OF PUBLIC CONVENIENCE AND...
Code of Federal Regulations, 2014 CFR
2014-04-01
... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) I Appendix I to Subpart F of... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) The following procedures apply to... ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES OF PUBLIC CONVENIENCE AND...
Smart, Otis; Burrell, Lauren
2014-01-01
Pattern classification for intracranial electroencephalogram (iEEG) and functional magnetic resonance imaging (fMRI) signals has furthered epilepsy research toward understanding the origin of epileptic seizures and localizing dysfunctional brain tissue for treatment. Prior research has demonstrated that implicitly selecting features with a genetic programming (GP) algorithm more effectively determined the proper features to discern biomarker and non-biomarker interictal iEEG and fMRI activity than conventional feature selection approaches. However for each the iEEG and fMRI modalities, it is still uncertain whether the stochastic properties of indirect feature selection with a GP yield (a) consistent results within a patient data set and (b) features that are specific or universal across multiple patient data sets. We examined the reproducibility of implicitly selecting features to classify interictal activity using a GP algorithm by performing several selection trials and subsequent frequent itemset mining (FIM) for separate iEEG and fMRI epilepsy patient data. We observed within-subject consistency and across-subject variability with some small similarity for selected features, indicating a clear need for patient-specific features and possible need for patient-specific feature selection or/and classification. For the fMRI, using nearest-neighbor classification and 30 GP generations, we obtained over 60% median sensitivity and over 60% median selectivity. For the iEEG, using nearest-neighbor classification and 30 GP generations, we obtained over 65% median sensitivity and over 65% median selectivity except one patient. PMID:25580059
A SVM-based quantitative fMRI method for resting-state functional network detection.
Song, Xiaomu; Chen, Nan-kuei
2014-09-01
Resting-state functional magnetic resonance imaging (fMRI) aims to measure baseline neuronal connectivity independent of specific functional tasks and to capture changes in the connectivity due to neurological diseases. Most existing network detection methods rely on a fixed threshold to identify functionally connected voxels under the resting state. Due to fMRI non-stationarity, the threshold cannot adapt to variation of data characteristics across sessions and subjects, and generates unreliable mapping results. In this study, a new method is presented for resting-state fMRI data analysis. Specifically, the resting-state network mapping is formulated as an outlier detection process that is implemented using one-class support vector machine (SVM). The results are refined by using a spatial-feature domain prototype selection method and two-class SVM reclassification. The final decision on each voxel is made by comparing its probabilities of functionally connected and unconnected instead of a threshold. Multiple features for resting-state analysis were extracted and examined using an SVM-based feature selection method, and the most representative features were identified. The proposed method was evaluated using synthetic and experimental fMRI data. A comparison study was also performed with independent component analysis (ICA) and correlation analysis. The experimental results show that the proposed method can provide comparable or better network detection performance than ICA and correlation analysis. The method is potentially applicable to various resting-state quantitative fMRI studies. Copyright © 2014 Elsevier Inc. All rights reserved.
Electronic Structure Theory Study of the Microsolvated F(-)(H2O) + CH3I SN2 Reaction.
Zhang, Jiaxu; Yang, Li; Sheng, Li
2016-05-26
The potential energy profile of microhydrated fluorine ion reaction with methyl iodine has been characterized by extensive electronic structure calculations. Both hydrogen-bonded F(-)(H2O)---HCH2I and ion-dipole F(-)(H2O)---CH3I complexes are formed for the reaction entrance and the PES in vicinity of these complexes is very flat, which may have important implications for the reaction dynamics. The water molecule remains on the fluorine side until the reactive system goes to the SN2 saddle point. It can easily move to the iodine side with little barrier, but in a nonsynchronous reaction path after the dynamical bottleneck to the reaction, which supports the previous prediction for microsolvated SN2 systems. The influence of solvating water molecule on the reaction mechanism is probed by comparing with the influence of the nonsolvated analogue and other microsolvated SN2 systems. Taking the CCSD(T) single-point calculations based on MP2-optimized geometries as benchmark, the DFT functionals B97-1 and B3LYP are found to better characterize the potential energy profile for the title reaction and are recommended as the preferred methods for the direct dynamics simulations to uncover the dynamic behaviors.
LADOTD 24-Hour rainfall frequency maps and I-D-F curves : summary report.
DOT National Transportation Integrated Search
1991-08-01
Maximum annual 24-hour maps and Intensity-Duration-Frequency (I-D-F) curves for return periods of 2, 5, 10, 25, 50 and 100 years were developed using hourly precipitation data. Data from 92 rain gauges for the period of 1948 to 1987 were compiled and...
NASA Astrophysics Data System (ADS)
Wang, Zhaoxu; Liu, Yi; Zheng, Baishu; Zhou, Fengxiang; Jiao, Yinchun; Liu, Yuan; Ding, XunLei; Lu, Tian
2018-05-01
Intermolecular interaction of XH2P...MY (X = H, CH3, F, CN, NO2; M = Cu, Ag, Au; Y = F, Cl, Br, I) complexes was investigated by means of an ab initio method. The molecular interaction energies are in the order Ag < Cu < Au and increased with the decrease of RP...M. Interaction energies are strengthened when electron-donating substituents X connected to XH2P, while electron-withdrawing substituents produce the opposite effect. The strongest P...M bond was found in CH3H2P...AuF with -70.95 kcal/mol, while the weakest one was found in NO2H2P...AgI with -20.45 kcal/mol. The three-center/four-electron (3c/4e) resonance-type of P:-M-:Y hyperbond was recognized by the natural resonance theory and the natural bond orbital analysis. The competition of P:M-Y ↔ P-M:Y resonance structures mainly arises from hyperconjugation interactions; the bond order of bP-M and bM-Y is in line with the conservation of the idealized relationship bP-M + bM-Y ≈ 1. In all MF-containing complexes, P-M:F resonance accounted for a larger proportion which leads to the covalent characters for partial ionicity of MF. The interaction energies of these Cu/Ag/Au complexes are basically above the characteristic values of the halogen-bond complexes and close to the observed strong hydrogen bonds in ionic hydrogen-bonded species.
Sewer pipe, wire, epoxy, and finger tapping: The start of fMRI at the Medical College of Wisconsin
Bandettini, Peter A.
2011-01-01
In 1991, the Biophysics Research Institute at the Medical College of Wisconsin was among the first groups to develop functional Magnetic Resonance Imaging (fMRI). Our story is unique on a few levels: We didn’t have knowledge of the ability to image human brain activation with MRI using blood oxygenation dependent (BOLD) contrast until early August of 1991 when we attended the Society for Magnetic Resonance in Medicine (SMRM) meeting in San Francisco, yet we produced our first BOLD-based maps of motor cortex activation about a month later. The effort started with two graduate students, Eric Wong and myself. Only a few days prior to that extremely important SMRM meeting, we had developed human echo planar imaging (EPI) capability in-house. Wong designed, built, and interfaced a head gradient coil made out of sewer pipe, wire, and epoxy to a standard GE 1.5 T MRI scanner. Also, a few months prior to building this human head gradient coil he developed the EPI pulse sequences and image reconstruction. All of these efforts were towards a different goal – for demonstration of Wong’s novel approach to perfusion imaging in the human brain. Following SMRM, where a plenary lecture by Tom Brady from MGH opened our eyes to human brain activation imaging using BOLD contrast, and where we learned that EPI was extremely helpful if not critical to its success, we worked quickly to achieve our first results on September 14, 1991. The story is also unique in that Jim Hyde had set up the Biophysics Research Institute to be optimal for just this type of rapidly advancing basic technology research. It was well equipped for hardware development, had open and dynamic collaborative relationships with other departments, hospitals on campus, and GE, and had a relatively flat hierarchy and relaxed, flexible, collegial atmosphere internally. Since these first brain activation results, MCW Biophysics has continued to be at the forefront of functional MRI innovation, having helped to
7 CFR 15f.5 - How do I request that USDA consider my complaint under these procedures?
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false How do I request that USDA consider my complaint under... UNDER SECTION 741 I Filed a Complaint With USDA Prior to July 1, 1997, How Do I Request That USDA Consider My Complaint Using These Procedures? § 15f.5 How do I request that USDA consider my complaint...
7 CFR 15f.5 - How do I request that USDA consider my complaint under these procedures?
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 1 2011-01-01 2011-01-01 false How do I request that USDA consider my complaint under... UNDER SECTION 741 I Filed a Complaint With USDA Prior to July 1, 1997, How Do I Request That USDA Consider My Complaint Using These Procedures? § 15f.5 How do I request that USDA consider my complaint...
7 CFR 15f.5 - How do I request that USDA consider my complaint under these procedures?
Code of Federal Regulations, 2012 CFR
2012-01-01
... 7 Agriculture 1 2012-01-01 2012-01-01 false How do I request that USDA consider my complaint under... UNDER SECTION 741 I Filed a Complaint With USDA Prior to July 1, 1997, How Do I Request That USDA Consider My Complaint Using These Procedures? § 15f.5 How do I request that USDA consider my complaint...
7 CFR 15f.5 - How do I request that USDA consider my complaint under these procedures?
Code of Federal Regulations, 2014 CFR
2014-01-01
... 7 Agriculture 1 2014-01-01 2014-01-01 false How do I request that USDA consider my complaint under... UNDER SECTION 741 I Filed a Complaint With USDA Prior to July 1, 1997, How Do I Request That USDA Consider My Complaint Using These Procedures? § 15f.5 How do I request that USDA consider my complaint...
7 CFR 15f.5 - How do I request that USDA consider my complaint under these procedures?
Code of Federal Regulations, 2013 CFR
2013-01-01
... 7 Agriculture 1 2013-01-01 2013-01-01 false How do I request that USDA consider my complaint under... UNDER SECTION 741 I Filed a Complaint With USDA Prior to July 1, 1997, How Do I Request That USDA Consider My Complaint Using These Procedures? § 15f.5 How do I request that USDA consider my complaint...
Blood-C.S.F. barriers dysfunction in the chronic organic brain syndrome; a R.I.A. study.
Vardi, Y; Czerniak, P; Rabey, Y; Flechter, S; Boruchowsky, S; Streifler, M
1978-01-01
C.S.F. samples of 35 patients, who suffered from verified chronic, non-tumorous organic brain syndrome, were radioimmunoassayed for T4 and T.S.H., and were compared to C.S.F.-R.I.A. samples from a control group of patients who underwent myelography because of lumbar disc. In addition T4 and T.S.H. plasma levels were evaluated in the O.B.S. patients. C.S.F. T4 and T.S.H. levels were significantly higher in 65% of the O.B.S. group of patients than those of the control group. The average determinations for T4 were: 0.77 muh/100 ml in O.B.S. group as against 0--0.4 micrograms/100 ml in the C.S.F.'s of the control group. P greater than 0,001 T.S.H. C.S.F. levels were 1.33 microU/ml in the O.B.S. group, and 0--0.6 microU/ml in the control group (P greater than 0.005). It is suggested that the elevated R.I.A. values of these hormones in the C.S.F. of the O.B.S. patients reflect a disruption of blood-C.S.F. barriers. Therefore in the organic brain syndrome there seems to exist a pathophysiological dysfunction of brain barriers in addition of the neural damage.
Poulin, Éric; Lebel, Réjean; Croteau, Étienne; Blanchette, Marie; Tremblay, Luc; Lecomte, Roger; Bentourkia, M'hamed; Lepage, Martin
2015-02-01
The combination of MRI and positron emission tomography (PET) offers new possibilities for the development of novel methodologies. In pharmacokinetic image analysis, the blood concentration of the imaging compound as a function of time, [i.e., the arterial input function (AIF)] is required for MRI and PET. In this study, we tested whether an AIF extracted from a reference region (RR) in MRI can be used as a surrogate for the manually sampled (18) F-FDG AIF for pharmacokinetic modeling. An MRI contrast agent, gadolinium-diethylenetriaminepentaacetic acid (Gd-DTPA) and a radiotracer, (18) F-fluorodeoxyglucose ((18) F-FDG), were simultaneously injected in a F98 glioblastoma rat model. A correction to the RR AIF for Gd-DTPA is proposed to adequately represent the manually sampled AIF. A previously published conversion method was applied to convert this AIF into a (18) F-FDG AIF. The tumor metabolic rate of glucose (TMRGlc) calculated with the manually sampled (18) F-FDG AIF, the (18) F-FDG AIF converted from the RR AIF and the (18) F-FDG AIF converted from the corrected RR AIF were found not statistically different (P>0.05). An AIF derived from an RR in MRI can be accurately converted into a (18) F-FDG AIF and used in PET pharmacokinetic modeling. © 2014 Wiley Periodicals, Inc.
Evaluating the Social Validity of the Early Start Denver Model: A Convergent Mixed Methods Study
ERIC Educational Resources Information Center
Ogilvie, Emily; McCrudden, Matthew T.
2017-01-01
An intervention has social validity to the extent that it is socially acceptable to participants and stakeholders. This pilot convergent mixed methods study evaluated parents' perceptions of the social validity of the Early Start Denver Model (ESDM), a naturalistic behavioral intervention for children with autism. It focused on whether the parents…
Bluestein, Blake M; Morrish, Fionnuala; Graham, Daniel J; Guenthoer, Jamie; Hockenbery, David; Porter, Peggy L; Gamble, Lara J
2016-03-21
Imaging time-of-flight secondary ion mass spectrometry (ToF-SIMS) and principal component analysis (PCA) were used to investigate two sets of pre- and post-chemotherapy human breast tumor tissue sections to characterize lipids associated with tumor metabolic flexibility and response to treatment. The micron spatial resolution imaging capability of ToF-SIMS provides a powerful approach to attain spatially-resolved molecular and cellular data from cancerous tissues not available with conventional imaging techniques. Three ca. 1 mm(2) areas per tissue section were analyzed by stitching together 200 μm × 200 μm raster area scans. A method to isolate and analyze specific tissue regions of interest by utilizing PCA of ToF-SIMS images is presented, which allowed separation of cellularized areas from stromal areas. These PCA-generated regions of interest were then used as masks to reconstruct representative spectra from specifically stromal or cellular regions. The advantage of this unsupervised selection method is a reduction in scatter in the spectral PCA results when compared to analyzing all tissue areas or analyzing areas highlighted by a pathologist. Utilizing this method, stromal and cellular regions of breast tissue biopsies taken pre- versus post-chemotherapy demonstrate chemical separation using negatively-charged ion species. In this sample set, the cellular regions were predominantly all cancer cells. Fatty acids (i.e. palmitic, oleic, and stearic), monoacylglycerols, diacylglycerols and vitamin E profiles were distinctively different between the pre- and post-therapy tissues. These results validate a new unsupervised method to isolate and interpret biochemically distinct regions in cancer tissues using imaging ToF-SIMS data. In addition, the method developed here can provide a framework to compare a variety of tissue samples using imaging ToF-SIMS, especially where there is section-to-section variability that makes it difficult to use a serial hematoxylin
Femtosecond Visible Transient Absorption Spectroscopy of Chlorophyll f-Containing Photosystem I.
Kaucikas, Marius; Nürnberg, Dennis; Dorlhiac, Gabriel; Rutherford, A William; van Thor, Jasper J
2017-01-24
Photosystem I (PSI) from Chroococcidiopsis thermalis PCC 7203 grown under far-red light (FRL; >725 nm) contains both chlorophyll a and a small proportion of chlorophyll f. Here, we investigated excitation energy transfer and charge separation using this FRL-grown form of PSI (FRL-PSI). We compared femtosecond transient visible absorption changes of normal, white-light (WL)-grown PSI (WL-PSI) with those of FRL-PSI using excitation at 670 nm, 700 nm, and (in the case of FRL-PSI) 740 nm. The possibility that chlorophyll f participates in energy transfer or charge separation is discussed on the basis of spectral assignments. With selective pumping of chlorophyll f at 740 nm, we observe a final ∼150 ps decay assigned to trapping by charge separation, and the amplitude of the resulting P700 +• A 1 -• charge-separated state indicates that the yield is directly comparable to that of WL-PSI. The kinetics shows a rapid 2 ps time constant for almost complete transfer to chlorophyll f if chlorophyll a is pumped with a wavelength of 670 nm or 700 nm. Although the physical role of chlorophyll f is best supported as a low-energy radiative trap, the physical location should be close to or potentially within the charge-separating pigments to allow efficient transfer for charge separation on the 150 ps timescale. Target models can be developed that include a branching in the formation of the charge separation for either WL-PSI or FRL-PSI. Copyright © 2017 Biophysical Society. Published by Elsevier Inc. All rights reserved.
Inter- and intraconfigurational luminescence of Er3+ ions in BaY2F8 under VUV excitation
NASA Astrophysics Data System (ADS)
Kirm, M.; Lichtenberg, H.; Makhov, V. N.; Negodin, E.; Ouvarova, T. V.; Suljoti, E.; True, M.; Zimmerer, G.
Using energy- and time-resolved spectroscopy the luminescence properties of Er3+ doped BaY2F8 crystals were investigated at 10 K under VUV synchrotron radiation excitation. Radiative intraconfigurational f - f and interconfigurational d - f transitions in Er3+ ions were observed under f - d excitation. Whereas the onset of S-4(3/2) population via f - d excitation starts at 59 900 cm(-1) , efficient excitation of emissions arising from the P-2(3/2) state begins only above 67 000 cm(-1) in VUV region. Such behaviour can be explained by a cross-relaxation process of the type (F-2(2)(5/2) , I-4(15/2))-->(P-2(3/2) , P-2(3/2)) taking place within f -states of Er3+ ions finally populating the emitting P-2(3/2) state.
Esposito, Fabrizio; Singer, Neomi; Podlipsky, Ilana; Fried, Itzhak; Hendler, Talma; Goebel, Rainer
2013-02-01
Linking regional metabolic changes with fluctuations in the local electromagnetic fields directly on the surface of the human cerebral cortex is of tremendous importance for a better understanding of detailed brain processes. Functional magnetic resonance imaging (fMRI) and intra-cranial electro-encephalography (iEEG) measure two technically unrelated but spatially and temporally complementary sets of functional descriptions of human brain activity. In order to allow fine-grained spatio-temporal human brain mapping at the population-level, an effective comparative framework for the cortex-based inter-subject analysis of iEEG and fMRI data sets is needed. We combined fMRI and iEEG recordings of the same patients with epilepsy during alternated intervals of passive movie viewing and music listening to explore the degree of local spatial correspondence and temporal coupling between blood oxygen level dependent (BOLD) fMRI changes and iEEG spectral power modulations across the cortical surface after cortex-based inter-subject alignment. To this purpose, we applied a simple model of the iEEG activity spread around each electrode location and the cortex-based inter-subject alignment procedure to transform discrete iEEG measurements into cortically distributed group patterns by establishing a fine anatomic correspondence of many iEEG cortical sites across multiple subjects. Our results demonstrate the feasibility of a multi-modal inter-subject cortex-based distributed analysis for combining iEEG and fMRI data sets acquired from multiple subjects with the same experimental paradigm but with different iEEG electrode coverage. The proposed iEEG-fMRI framework allows for improved group statistics in a common anatomical space and preserves the dynamic link between the temporal features of the two modalities. Copyright © 2012 Elsevier Inc. All rights reserved.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pasch, James Jay
A method of resolving a balanced condition that generates control parameters for start-up and steady state operating points and various component and cycle performances for a closed split flow recompression cycle system. The method provides for improved control of a Brayton cycle thermal to electrical power conversion system. The method may also be used for system design, operational simulation and/or parameter prediction.
Quantification of 18F-Fluoride Kinetics: Evaluation of Simplified Methods.
Raijmakers, Pieter; Temmerman, Olivier P P; Saridin, Carrol P; Heyligers, Ide C; Becking, Alfred G; van Lingen, Arthur; Lammertsma, Adriaan A
2014-07-01
(18)F-fluoride PET is a promising noninvasive method for measuring bone metabolism and bone blood flow. The purpose of this study was to assess the performance of various clinically useful simplified methods by comparing them with full kinetic analysis. In addition, the validity of deriving bone blood flow from K1 of (18)F-fluoride was investigated using (15)O-H2O as a reference. Twenty-two adults (mean age ± SD, 44.8 ± 25.2 y), including 16 patients scheduled for bone surgery and 6 healthy volunteers, were studied. All patients underwent dynamic (15)O-H2O and (18)F-fluoride scans before surgery. Ten of these patients had serial PET measurements before and at 2 time points after local bone surgery. During all PET scans, arterial blood was monitored continuously. (18)F-fluoride data were analyzed using nonlinear regression (NLR) and several simplified methods (Patlak and standardized uptake value [SUV]). SUV was evaluated for different time intervals after injection and after normalizing to body weight, lean body mass, and body surface area, and simplified measurements were compared with NLR results. In addition, changes in SUV and Patlak-derived fluoride influx rate (Ki) after surgery were compared with corresponding changes in NLR-derived Ki. Finally, (18)F-fluoride K1 was compared with bone blood flow derived from (15)O-H2O data, using the standard single-tissue-compartment model. K1 of (18)F-fluoride correlated with measured blood flow, but the correlation coefficient was relatively low (r = 0.35, P < 0.001). NLR resulted in a mean Ki of 0.0160 ± 0.0122, whereas Patlak analysis, for the interval 10-60 min after injection, resulted in an almost-identical mean Ki of 0.0161 ± 0.0117. The Patlak-derived Ki, for 10-60 min after injection, showed a high correlation with the NLR-derived Ki (r = 0.976). The highest correlation between Ki and lean body mass-normalized SUV was found for the interval 50-60 min (r = 0.958). Finally, changes in SUV correlated
Scalar field and time varying cosmological constant in f(R,T) gravity for Bianchi type-I universe
NASA Astrophysics Data System (ADS)
Singh, G. P.; Bishi, Binaya K.; Sahoo, P. K.
2016-04-01
In this article, we have analysed the behaviour of scalar field and cosmological constant in $f(R,T)$ theory of gravity. Here, we have considered the simplest form of $f(R,T)$ i.e. $f(R,T)=R+2f(T)$, where $R$ is the Ricci scalar and $T$ is the trace of the energy momentum tensor and explored the spatially homogeneous and anisotropic Locally Rotationally Symmetric (LRS) Bianchi type-I cosmological model. It is assumed that the Universe is filled with two non-interacting matter sources namely scalar field (normal or phantom) with scalar potential and matter contribution due to $f(R,T)$ action. We have discussed two cosmological models according to power law and exponential law of the volume expansion along with constant and exponential scalar potential as sub models. Power law models are compatible with normal (quintessence) and phantom scalar field whereas exponential volume expansion models are compatible with only normal (quintessence) scalar field. The values of cosmological constant in our models are in agreement with the observational results. Finally, we have discussed some physical and kinematical properties of both the models.
Determination of intrinsic mobility of a bilayer oxide thin-film transistor by pulsed I-V method
NASA Astrophysics Data System (ADS)
Woo, Hyunsuk; Kim, Taeho; Hur, Jihyun; Jeon, Sanghun
2017-04-01
Amorphous oxide semiconductor thin-film transistors (TFT) have been considered as outstanding switch devices owing to their high mobility. However, because of their amorphous channel material with a certain level of density of states, a fast transient charging effect in an oxide TFT occurs, leading to an underestimation of the mobility value. In this paper, the effects of the fast charging of high-performance bilayer oxide semiconductor TFTs on mobility are examined in order to determine an accurate mobility extraction method. In addition, an approach based on a pulse I D -V G measurement method is proposed to determine the intrinsic mobility value. Even with the short pulse I D -V G measurement, a certain level of fast transient charge trapping cannot be avoided as long as the charge-trap start time is shorter than the pulse rising time. Using a pulse-amplitude-dependent threshold voltage characterization method, we estimated a correction factor for the apparent mobility, thus allowing us to determine the intrinsic mobility.
Resting Heart Rate Variability Among Professional Baseball Starting Pitchers.
Cornell, David J; Paxson, Jeffrey L; Caplinger, Roger A; Seligman, Joshua R; Davis, Nicholas A; Ebersole, Kyle T
2017-03-01
Cornell, DJ, Paxson, JL, Caplinger, RA, Seligman, JR, Davis, NA, and Ebersole, KT. Resting heart rate variability among professional baseball starting pitchers. J Strength Cond Res 31(3): 575-581, 2017-The purpose of this study was to examine the changes in resting heart rate variability (HRV) across a 5-day pitching rotation schedule among professional baseball starting pitchers. The HRV data were collected daily among 8 Single-A level professional baseball starting pitchers (mean ± SD, age = 21.9 ± 1.3 years; height = 185.4 ± 3.6 cm; weight = 85.2 ± 7.5 kg) throughout the entire baseball season with the participant quietly lying supine for 10 minutes. The HRV was quantified by calculating the natural log of the square root of the mean sum of the squared differences (lnRMSSD) during the middle 5 minutes of each R-R series data file. A split-plot repeated-measures analysis of variance was used to examine the influence of pitching rotation day on resting lnRMSSD. A statistically significant main effect of rotation day was identified (F4,706 = 3.139, p = 0.029). Follow-up pairwise analyses indicated that resting lnRMSSD on day 2 was significantly (p ≤ 0.05) lower than all other rotation days. In addition, a statistically significant main effect of pitcher was also identified (F7,706 = 83.388, p < 0.001). These results suggest that professional baseball starting pitchers display altered autonomic nervous system function 1 day after completing a normally scheduled start, as day 2 resting HRV was significantly lower than all other rotation days. In addition, the season average resting lnRMSSD varied among participants, implying that single-subject analysis of resting measures of HRV may be more appropriate when monitoring cumulative workload among this cohort population of athletes.
Head Start, 4 years After Completing the Program
ERIC Educational Resources Information Center
Kim, Young-Joo
2013-01-01
This paper studies the effect of the Head Start program on children's achievements in reading and math tests during their first 4 years of schooling after completing the program. Using nationally representative data from the Early Childhood Longitudinal Study, I found large measurement error in the parental reports of Head Start attendance, which…
Code of Federal Regulations, 2012 CFR
2012-01-01
... 7 Agriculture 1 2012-01-01 2012-01-01 false When is something considered âfiledâ as required by these rules and to whom do I need to give copies of what I file? 15f.27 Section 15f.27 Agriculture... of Deadlines and What Happens if I Miss a Deadline in These Rules? § 15f.27 When is something...
Code of Federal Regulations, 2014 CFR
2014-01-01
... 7 Agriculture 1 2014-01-01 2014-01-01 false When is something considered âfiledâ as required by these rules and to whom do I need to give copies of what I file? 15f.27 Section 15f.27 Agriculture... of Deadlines and What Happens if I Miss a Deadline in These Rules? § 15f.27 When is something...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false When is something considered âfiledâ as required by these rules and to whom do I need to give copies of what I file? 15f.27 Section 15f.27 Agriculture... of Deadlines and What Happens if I Miss a Deadline in These Rules? § 15f.27 When is something...
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 1 2011-01-01 2011-01-01 false When is something considered âfiledâ as required by these rules and to whom do I need to give copies of what I file? 15f.27 Section 15f.27 Agriculture... of Deadlines and What Happens if I Miss a Deadline in These Rules? § 15f.27 When is something...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 7 Agriculture 1 2013-01-01 2013-01-01 false When is something considered âfiledâ as required by these rules and to whom do I need to give copies of what I file? 15f.27 Section 15f.27 Agriculture... of Deadlines and What Happens if I Miss a Deadline in These Rules? § 15f.27 When is something...
NASA Astrophysics Data System (ADS)
Galván, Jorge E.; Gil, Diego M.; Lanús, Hernán E.; Altabef, Aida Ben
2015-02-01
The fourth member of the series of compounds of the type POX3 with X = I was synthesized and characterized by infrared spectroscopy. The geometrical parameters and vibrational properties of POX3 (X = F, Cl, Br, I) molecules were investigated theoretically by means DFT and ab initio methods. Available geometrical and vibrational data were used together with theoretical calculations in order to obtain a set of scaled force constants. The observed trends in geometrical parameters are analyzed and compared with those obtained in a previous work for the VOX3 (X = F, Cl, Br, I) series of compounds. NBO analysis was performed in order to know the hyper-conjugative interactions that favor one structure over another. The molecular properties such as ionization potential, electron affinity, electronegativity, chemical potential, chemical hardness, softness and global electrophilicity index have been deduced from HOMO-LUMO analysis.
7 CFR 15f.14 - What happens after I file a request for a hearing?
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 1 2011-01-01 2011-01-01 false What happens after I file a request for a hearing? 15f... after I file a request for a hearing? Within 20 days after you have filed your request for a hearing, ALJ shall file with the Docketing Clerk a notice stating the time, place, and manner of the hearing...
Airstart performance of a digital electronic engine control system on an F100 engine
NASA Technical Reports Server (NTRS)
Burcham, F. W., Jr.
1984-01-01
The digital electronic engine control (DEEC) system installed on an F100 engine in an F-15 aircraft was tested. The DEEC system incorporates a closed-loop air start feature in which the fuel flow is modulated to achieve the desired rate of compressor acceleration. With this logic the DEEC equipped F100 engine can achieve air starts over a larger envelope. The DEEC air start logic, the test program conducted on the F-15, and its results are described.
Procedure Training Aid for the SH-3D/H Normal Start Checklist.
1982-02-01
1 Engine .... START Pupoe: To make a Normal Start of No. 1 engine. :4 14. Action Pilot/Copilot verify lite -off by noting rapid rise in T5 and Nq and...Nf increasinq 15. Note Normal starts are characterized by 7 0-75D0 T5 in I seconds after lite -off 16. If T5 is incrasinn too rapidlyv or appears to...Pumps 206 NORMAL START CHECKLIST ITEM NO. 23. No. I Ergine ... TART 14. Action Pilot/Copilot verify lite -off by noting ra ’pid rise in and Ng and Nf
PATHS - Providing Appropriate Training in Head Start: A Grantee Guide.
ERIC Educational Resources Information Center
Riley, Mary Tom; And Others
Designed for Head Start grantees, this book provides training guidelines for improving Head Start staff competency. Chapter I offers a rationale for staff training activities, while chapter II characterizes the Head Start trainee. Chapter III addresses assessment of training needs on program and staff levels. The development of a training plan is…
Rocketdyne - F-1 Saturn V First Stage Engine. Chapter 1, Appendix C
NASA Technical Reports Server (NTRS)
Biggs, Robert
2009-01-01
Before I go into the history of F-1, I want to discuss the F-1 engine s role in putting man on the moon. The F-1 engine was used in a cluster of five on the first stage, and that was the only power during the first stage. It took the Apollo launch vehicle, which was 363 feet tall and weighed six million pounds, and threw it downrange fifty miles, threw it up to forty miles of altitude, at Mach 7. It took two and one-half minutes to do that and, in the process, burned four and one-half million pounds of propellant, a pretty sizable task. (See Slide 2, Appendix C) My history goes back to the same year I started working at Rocketdyne. That s where the F-1 had its beginning, back early in 1957. In 1957, there was no space program. Rocketdyne was busy working overtime and extra days designing, developing, and producing rocket engines for weapons of mass destruction, not for scientific reasons. The Air Force contracted Rocketdyne to study how to make a rocket engine that had a million pounds of thrust. The highest thing going at the time had 150,000 pounds of thrust. Rocketdyne s thought was the new engine might be needed for a ballistic missile, not that it was going to go on a moon shot.
Start-up and control method and apparatus for resonant free piston Stirling engine
Walsh, Michael M.
1984-01-01
A resonant free-piston Stirling engine having a new and improved start-up and control method and system. A displacer linear electrodynamic machine is provided having an armature secured to and movable with the displacer and having a stator supported by the Stirling engine housing in juxtaposition to the armature. A control excitation circuit is provided for electrically exciting the displacer linear electrodynamic machine with electrical excitation signals having substantially the same frequency as the desired frequency of operation of the Stirling engine. The excitation control circuit is designed so that it selectively and controllably causes the displacer electrodynamic machine to function either as a generator load to extract power from the displacer or the control circuit selectively can be operated to cause the displacer electrodynamic machine to operate as an electric drive motor to apply additional input power to the displacer in addition to the thermodynamic power feedback to the displacer whereby the displacer linear electrodynamic machine also is used in the electric drive motor mode as a means for initially starting the resonant free-piston Stirling engine.
ERIC Educational Resources Information Center
Fosburg, Linda B.; And Others
In 1977, a longitudinal study was initiated to assess the effectiveness of health services provided by Head Start. The study provided for 10 domains: pediatric health examinations, health history recordings, dental evaluation, anthropometric assessment, diet and nutrition assessment, and hematology evaluations, as well as for developmental,…
DOE Office of Scientific and Technical Information (OSTI.GOV)
Li, Wan-Lu; Li, Yong; Xu, Congqiao
2015-12-07
Systematic theoretical and experimental investigations have been performed to understand the periodicity and electronic structures of trivalent-gold halides using gold tetrahalides [AuX4]⁻ anions (X = F, Cl, Br, I, At, Uus). The [AuX4]⁻ (X = Cl, Br, I) anions were produced in gas phase and their negative-ion photoelectron spectra were obtained, which exhibited rich and well-resolved spectral peaks. We calculated the adiabatic as well as vertical electron detachment energies using density functional methods with scalar and spin-orbit coupling relativistic effects. The simulated photoelectron spectra based on these calculations are in good agreement with the experimental spectra. Our results show thatmore » the trivalent Au(III) oxidation state becomes progressively less stable while Au(I) is preferred when the halides become heavier along the Period Table. This trend reveals that the oxidation state of metals in complexes can be manipulated through ligand design« less
fMRI capture of auditory hallucinations: Validation of the two-steps method.
Leroy, Arnaud; Foucher, Jack R; Pins, Delphine; Delmaire, Christine; Thomas, Pierre; Roser, Mathilde M; Lefebvre, Stéphanie; Amad, Ali; Fovet, Thomas; Jaafari, Nemat; Jardri, Renaud
2017-10-01
Our purpose was to validate a reliable method to capture brain activity concomitant with hallucinatory events, which constitute frequent and disabling experiences in schizophrenia. Capturing hallucinations using functional magnetic resonance imaging (fMRI) remains very challenging. We previously developed a method based on a two-steps strategy including (1) multivariate data-driven analysis of per-hallucinatory fMRI recording and (2) selection of the components of interest based on a post-fMRI interview. However, two tests still need to be conducted to rule out critical pitfalls of conventional fMRI capture methods before this two-steps strategy can be adopted in hallucination research: replication of these findings on an independent sample and assessment of the reliability of the hallucination-related patterns at the subject level. To do so, we recruited a sample of 45 schizophrenia patients suffering from frequent hallucinations, 20 schizophrenia patients without hallucinations and 20 matched healthy volunteers; all participants underwent four different experiments. The main findings are (1) high accuracy in reporting unexpected sensory stimuli in an MRI setting; (2) good detection concordance between hypothesis-driven and data-driven analysis methods (as used in the two-steps strategy) when controlled unexpected sensory stimuli are presented; (3) good agreement of the two-steps method with the online button-press approach to capture hallucinatory events; (4) high spatial consistency of hallucinatory-related networks detected using the two-steps method on two independent samples. By validating the two-steps method, we advance toward the possible transfer of such technology to new image-based therapies for hallucinations. Hum Brain Mapp 38:4966-4979, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
What Is Happening at Spectral Type F5 in Hyades F Stars?
NASA Technical Reports Server (NTRS)
Boehm-Vitense, Erika; Robinson, Richard; Carpenter, Kenneth; Mena-Werth, Jose
2002-01-01
Aiming at a better understanding of the mechanisms heating the chromospheres, transition regions, and coronae of cool stars, we study ultraviolet, low-resolution Hubble Space Telescope/Space Telescope Imaging Spectrograph spectra of Hyades main-sequence F stars. We study the B-V dependence(s) of the chromospheric and transition layer emission line fluxes and their dependences on rotational velocities. We find that the transition layer emission line fluxes and also those of strong chromospheric lines decrease steeply between B-V = 0.42 and 0.45, i.e., at spectral type F5, for which the rotational velocities also decrease steeply. The magnitude of the line-flux decrease increases for lines of ions with increasing degree of ionization. This shows that the line-flux decrease is not due to a change in the surface filling factor but rather due to a change of the relative importance of different heating mechanisms. For early F stars with B-V < 0.42 we find for the transition layer emission lines increasing fluxes for increasing v sin i, indicating magnetohydrodynamic heating. The v sin i dependence is strongest for the high-ionization lines. On the other hand, the low chromospheric lines show no dependence on v sin i, indicating acoustic shock heating for these layers. This also contributes to the heating of the transition layers. The Mg II and Ca II lines show decreasing fluxes for increasing v sin i, as long as v sin i is less than approx. 40 km/s. The coronal X-ray emission also decreases for increasing v sin i, except for v sin i larger than approx. 100 km/s. We have at present no explanation for this behavior. For late F stars the chromospheric lines show v sin i dependences similar to those observed for early F stars, again indicating acoustic heating for these layers. We were unable to determine the v sin i dependence of the transition layer lines because of too few single star targets. The decrease of emission line fluxes at the spectral type F5, with steeply
First experience with early dynamic (18)F-NaF-PET/CT in patients with chronic osteomyelitis.
Freesmeyer, Martin; Stecker, Franz F; Schierz, Jan-Henning; Hofmann, Gunther O; Winkens, Thomas
2014-05-01
This study investigates whether early dynamic positron emission tomography/computed tomography (edPET/CT) using (18)F-sodium fluoride-((18)F-NaF) is feasible in depicting early phases of radiotracer distribution in patients with chronic osteomyelitis (COM). A total of 12 ed(18)F-NaF-PET/CT examinations were performed on 11 consecutive patients (2 female, 9 male; age 53 ± 12 years) in list mode over 5 min starting with radiopharmaceutical injection before standard late (18)F-NaF-PET/CT. Eight consecutive time intervals (frames) were reconstructed for each patient: four 15 s, then four 60 s. Several volumes of interest (VOI) were selected, representing the affected area as well as different reference areas within the bone and soft tissue. Maximum and mean ed standardized uptake values (edSUVmax, edSUVmean, respectively) were calculated in each VOI during each frame to measure early fluoride influx and accumulation. Results were compared between affected and non-affected (contralateral) bones. Starting in the 31-45 s frame, the affected bone area showed significantly higher edSUVmax and edSUVmean compared to the healthy contralateral region. The affected bone areas also significantly differed from non-affected contralateral regions in conventional late (18)F-NaF-PET/CT. This pilot study suggests that, in patients with COM, ed(18)F-NaF -PET offers additional information about early radiotracer distribution to standard (18)F-NaF -PET/CT, similar to a three-phase bone scan. The results should be validated in larger trials which directly compare ed(18)F-NaF-PET to a three-phase bone scan.
New Laboratory Methods for Characterizing the Immersion Factors for Irradiance
NASA Technical Reports Server (NTRS)
Hooker, Stanford B. (Editor); Firestone, Elaine R. (Editor); Zibordi, Giuseppe; DAlimonte, Davide; vaderLinde, Dirk; Brown, James W.
2003-01-01
The experimental determination of the immersion factor, I(sub f)(lambda), of irradiance collectors is a requirement of any in-water radiometer. The eighth SeaWiFS Intercalibration Round-Robin Experiment (SIRREX-8) showed different implementations, at different laboratories, of the same I(sub f)(lambda) measurement protocol. The different implementations make use of different setups, volumes, and water types. Consequently, they exhibit different accuracies and require different execution times for characterizing an irradiance sensor. In view of standardizing the characterization of I(sub f)(lambda) values for in-water radiometers, together with an increase in the accuracy of methods and a decrease in the execution time, alternative methods are presented, and assessed versus the traditional method. The proposed new laboratory methods include: a) the continuous method, in which optical measurements taken with discrete water depths are substituted by continuous profiles created by removing the water from the water vessel at a constant flow rate (which significantly reduces the time required for the characterization of a single radiometer); and b) the Compact Portable Advanced Characterization Tank (ComPACT) method, in which the commonly used large tanks are replaced by a small water vessel, thereby allowing the determination of I(sub f)(lambda) values with a small water volume, and more importantly, permitting I(sub f)(lambda) characterizations with pure water. Intercomparisons between the continuous and the traditional method showed results within the variance of I(sub f) (lambda) determinations. The use of the continuous method, however, showed a much shorter realization time. Intercomparisons between the ComPACT and the traditional method showed generally higher I(sub f)(lambda) values for the former. This is in agreement with the generalized expectations of a reduction in scattering effects, because of the use of pure water with the ComPACT method versus the use of
Theoretical characterization of the F(2)O(3) molecule by coupled-cluster methods.
Huang, Ming-Ju; Watts, John D
2010-09-23
Coupled-cluster calculations with extended basis sets that include noniterative connected triple excitations (CCSD(T)) have been used to study the FOOOF isomer of F(2)O(3). Second-order Moller-Plessett perturbation theory (MP2) and density-functional theory (B3LYP functional) calculations have also been performed for comparison. Two local minima of similar energy, namely, conformers of C(2) and C(s) symmetry have been located. Structures, harmonic vibrational frequencies, and standard enthalpies and free energies of formation have been calculated. The calculated bond lengths of F(2)O(3) are more characteristic of those in F(2)O and a "normal" peroxide than the unusual bond lengths in F(2)O(2). Both conformers have equal F-O and O-O bond lengths, contrary to a recent suggestion of an unsymmetrical structure. The harmonic vibrational frequencies can aid possible identification of gaseous F(2)O(3). The calculated Δ(f)H° and Δ(f)G° are 110 and 173 kJ mol(-1), respectively. These values are based on extrapolation of CCSD(T) results with augmented triple- and quadruple-ζ basis sets and are expected to be within chemical accuracy (i.e., 1 kcal mol(-1) or 4 kJ mol(-1)). F(2)O(3) is calculated to be stable to decomposition to either FO + FOO or F(2) + O(3), but unstable to decomposition to its elements, to F(2)O(2) + (1)/(2)O(2), and to F(2)O + O(2).
SU-F-J-06: Optimized Patient Inclusion for NaF PET Response-Based Biopsies
DOE Office of Scientific and Technical Information (OSTI.GOV)
Roth, A; Harmon, S; Perk, T
Purpose: A method to guide mid-treatment biopsies using quantitative [F-18]NaF PET/CT response is being investigated in a clinical trial. This study aims to develop methodology to identify patients amenable to mid-treatment biopsy based on pre-treatment imaging characteristics. Methods: 35 metastatic prostate cancer patients had NaF PET/CT scans taken prior to the start of treatment and 9–12 weeks into treatment. For mid-treatment biopsy targeting, lesions must be at least 1.5 cm{sup 3} and located in a clinically feasible region (lumbar/sacral spine, pelvis, humerus, or femur). Three methods were developed based on number of lesions present prior to treatment: a feasibility-restricted method,more » a location-restricted method, and an unrestricted method. The feasibility restricted method only utilizes information from lesions meeting biopsy requirements in the pre-treatment scan. The unrestricted method accounts for all lesions present in the pre-treatment scan. For each method, optimized classification cutoffs for candidate patients were determined. Results: 13 of the 35 patients had enough lesions at the mid-treatment for biopsy candidacy. Of 1749 lesions identified in all 35 patients at mid-treatment, only 9.8% were amenable to biopsy. Optimizing the feasibility-restricted method required 4 lesions at pre-treatment meeting volume and region requirements for biopsy, resulting patient identification sensitivity of 0.8 and specificity of 0.7. Of 6 false positive patients, only one patient lacked lesions for biopsy. Restricting for location alone showed poor results (sensitivity 0.2 and specificity 0.3). The optimized unrestricted method required patients have at least 37 lesions in pretreatment scan, resulting in a sensitivity of 0.8 and specificity of 0.8. There were 5 false positives, only one lacked lesions for biopsy. Conclusion: Incorporating the overall pre-treatment number of NaF PET/CT identified lesions provided best prediction for identifying
Interpretation of F-106B in-flight lightning signatures
NASA Technical Reports Server (NTRS)
Trost, T. F.; Grothaus, M. G.; Wen, C. T.
1985-01-01
Various characteristics of the electromagnetic data obtained on a NASA F-106B aircraft during direct lightning strikes are presented. Time scales of interest range from 10 ns to 400 microsecond. The following topics are discussed: (1) Lightning current, I, measured directly versus I obtained from computer integration of measured I-dot; (2) A method of compensation for the low frequency cutoff of the current transformer used to measure I; (3) Properties of fast pulses observed in the lightning time-derivative waveforms; (4) The characteristic D-dot signature of the F-106B aircraft; (5) An RC-discharge interpretation for some lightning waveforms; (6) A method for inferring the locations of lightning channel attachment points on the aircraft by using B-dot data; (7) Simple, approximate relationships between D-dot and I-dot and between B and I; and (8) Estimates of energy, charge, voltage, and resistance for a particular lightning event.
Equations of state of anhydrous AlF3 and AlI3: Modeling of extreme condition halide chemistry
NASA Astrophysics Data System (ADS)
Stavrou, Elissaios; Zaug, Joseph M.; Bastea, Sorin; Crowhurst, Jonathan C.; Goncharov, Alexander F.; Radousky, Harry B.; Armstrong, Michael R.; Roberts, Sarah K.; Plaue, Jonathan W.
2015-06-01
Pressure dependent angle-dispersive x-ray powder diffraction measurements of alpha-phase aluminum trifluoride (α-AlF3) and separately, aluminum triiodide (AlI3) were conducted using a diamond-anvil cell. Results at 295 K extend to 50 GPa. The equations of state of AlF3 and AlI3 were determined through refinements of collected x-ray diffraction patterns. The respective bulk moduli and corresponding pressure derivatives are reported for multiple orders of the Birch-Murnaghan (B-M), finite-strain (F-f), and higher pressure finite-strain (G-g) EOS analysis models. Aluminum trifluoride exhibits an apparent isostructural phase transition at approximately 12 GPa. Aluminum triiodide also undergoes a second-order atomic rearrangement: applied stress transformed a monoclinically distorted face centered cubic (fcc) structure into a standard fcc structural arrangement of iodine atoms. Results from semi-empirical thermochemical computations of energetic materials formulated with fluorine containing reactants were obtained with the aim of predicting the yield of halogenated products.
Woo, Sang-Keun; Moon, Byung Seok; Kim, Bom Sahn; Kim, Min Hwan; Lee, Yong Jin; Jung, Jae Ho; Lee, Kyo Chul; Seo, Youngho; Kim, Wook; Lim, Sang Moo; Lee, Byung Chul; Kim, Sang Eun
2018-05-03
Global and regional sympathetic activity in the heart can be evaluated using [ 123 I]meta-iodobenzylguanidine ([ 123 I]mIBG) imaging. However, [ 123 I]mIBG is associated with low image spatial resolution and sensitivity in cardiac imaging. We investigated the capability of an F-18-labeled mIBG derivative, meta-(3-[ 18 F]fluoropropyl)benzylguanidine ([ 18 F]mFPBG), for identifying ischemic and viable myocardium in a rat model of myocardial infarction. The ex vivo biodistribution and in vivo metabolic stability of [ 18 F]mFPBG were investigated in Sprague-Dawley rats. Selective cardiac adrenergic activation was confirmed via a blocking experiment involving pretreatment with desipramine (2 mg kg -1 ), followed by the administration of [ 18 F]mFPBG. Imaging properties of [ 18 F]mFPBG were compared with those of traditional cardiac imaging radiotracers ([ 123 I]mIBG and [ 99m Tc]MIBI) in a rat model of myocardial infarction. Non-invasive image-based measurements of infarct sizes were then compared with histological findings by using Bland-Altman analysis. The differences in infarct sizes determined using histological analysis and [ 18 F]mFPBG PET were -2.55 ± 4.99% (range: -12.33 to 7.22), -2.35 ± 3.32% (range: -8.87 to 4.16), and -3.15 ± 6.16% (range: -15.24 to 8.93) at 5, 20, and 40 min, respectively. Furthermore, [ 18 F]mFPBG PET was superior to traditional imaging methods in assessing the degree of ischemia in areas of myocardial infarction, as well as the actual infarct size. Compared to [ 123 I]mIBG, [ 18 F]mFPBG showed improved spatial resolution and sensitivity in a rat model of myocardial infarction. This result suggested that [ 18 F]mFPBG is a promising cardiac PET imaging agent for potential diagnostic application in PET cardiology. Copyright © 2018 Elsevier Inc. All rights reserved.
Ab initio study of the diatomic fluorides FeF, CoF, NiF, and CuF.
Koukounas, Constantine; Mavridis, Aristides
2008-11-06
The late-3d transition-metal diatomic fluorides MF = FeF, CoF, NiF, and CuF have been studied using variational multireference (MRCI) and coupled-cluster [RCCSD(T)] methods, combined with large to very large basis sets. We examined a total of 35 (2S+1)|Lambda| states, constructing as well 29 full potential energy curves through the MRCI method. All examined states are ionic, diabatically correlating to M(+)+F(-)((1)S). Notwithstanding the "eccentric" character of the 3d transition metals and the difficulties to accurately be described with all-electron ab initio methods, our results are, in general, in very good agreement with available experimental numbers.
ERIC Educational Resources Information Center
Brogden, Lace Marie
2010-01-01
Expanding upon previous theorizing of Art[middle dot]I/f/act[middle dot]ology published in "Qualitative Inquiry" in 2008, this article offers autoethnographic re:collections of a performance/paper presented at the international "Academic Identities in Crisis?" conference at the University of Central Lancashire, held in…
DOE Office of Scientific and Technical Information (OSTI.GOV)
Peeters, Sarah G.J.A., E-mail: sarah.peeters@maastrichtuniversity.nl; Zegers, Catharina M.L.; Lieuwes, Natasja G.
Purpose: Several individual clinical and preclinical studies have shown the possibility of evaluating tumor hypoxia by using noninvasive positron emission tomography (PET). The current study compared 3 hypoxia PET tracers frequently used in the clinic, [{sup 18}F]FMISO, [{sup 18}F]FAZA, and [{sup 18}F]HX4, in a preclinical tumor model. Tracer uptake was evaluated for the optimal time point for imaging, tumor-to-blood ratios (TBR), spatial reproducibility, and sensitivity to oxygen modification. Methods and Materials: PET/computed tomography (CT) images of rhabdomyosarcoma R1-bearing WAG/Rij rats were acquired at multiple time points post injection (p.i.) with one of the hypoxia tracers. TBR values were calculated, andmore » reproducibility was investigated by voxel-to-voxel analysis, represented as correlation coefficients (R) or Dice similarity coefficient of the high-uptake volume. Tumor oxygen modifications were induced by exposure to either carbogen/nicotinamide treatment or 7% oxygen breathing. Results: TBR was stabilized and maximal at 2 hours p.i. for [{sup 18}F]FAZA (4.0 ± 0.5) and at 3 hours p.i. for [{sup 18}F]HX4 (7.2 ± 0.7), whereas [{sup 18}F]FMISO showed a constant increasing TBR (9.0 ± 0.8 at 6 hours p.i.). High spatial reproducibility was observed by voxel-to-voxel comparisons and Dice similarity coefficient calculations on the 30% highest uptake volume for both [{sup 18}F]FMISO (R = 0.86; Dice coefficient = 0.76) and [{sup 18}F]HX4 (R = 0.76; Dice coefficient = 0.70), whereas [{sup 18}F]FAZA was less reproducible (R = 0.52; Dice coefficient = 0.49). Modifying the hypoxic fraction resulted in enhanced mean standardized uptake values for both [{sup 18}F]HX4 and [{sup 18}F]FAZA upon 7% oxygen breathing. Only [{sup 18}F]FMISO uptake was found to be reversible upon exposure to nicotinamide and carbogen. Conclusions: This study indicates that each tracer has its own strengths and, depending on the question to be answered, a different tracer can be
Code of Federal Regulations, 2012 CFR
2012-10-01
... 43 Public Lands: Interior 2 2012-10-01 2012-10-01 false What do I need to start preparing a site and building and testing a utilization facility on Federal land leased for geothermal resources? 3271.10 Section 3271.10 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE INTERIOR...
Code of Federal Regulations, 2014 CFR
2014-10-01
... 43 Public Lands: Interior 2 2014-10-01 2014-10-01 false What do I need to start preparing a site and building and testing a utilization facility on Federal land leased for geothermal resources? 3271.10 Section 3271.10 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE INTERIOR...
Code of Federal Regulations, 2013 CFR
2013-10-01
... 43 Public Lands: Interior 2 2013-10-01 2013-10-01 false What do I need to start preparing a site and building and testing a utilization facility on Federal land leased for geothermal resources? 3271.10 Section 3271.10 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE INTERIOR...
Code of Federal Regulations, 2011 CFR
2011-10-01
... 43 Public Lands: Interior 2 2011-10-01 2011-10-01 false What do I need to start preparing a site and building and testing a utilization facility on Federal land leased for geothermal resources? 3271.10 Section 3271.10 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE INTERIOR...
40 CFR 86.536-78 - Engine starting and restarting.
Code of Federal Regulations, 2010 CFR
2010-07-01
... PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM NEW AND IN-USE HIGHWAY VEHICLES AND ENGINES Emission... initial 20 second idle period shall begin when the engine starts. (2) Choke operation. (i) Vehicles... transmission shall be placed in gear 15 seconds after the engine is started. If necessary, braking may be...
An Automated Method for Identifying Artifact in Independent Component Analysis of Resting-State fMRI
Bhaganagarapu, Kaushik; Jackson, Graeme D.; Abbott, David F.
2013-01-01
An enduring issue with data-driven analysis and filtering methods is the interpretation of results. To assist, we present an automatic method for identification of artifact in independent components (ICs) derived from functional MRI (fMRI). The method was designed with the following features: does not require temporal information about an fMRI paradigm; does not require the user to train the algorithm; requires only the fMRI images (additional acquisition of anatomical imaging not required); is able to identify a high proportion of artifact-related ICs without removing components that are likely to be of neuronal origin; can be applied to resting-state fMRI; is automated, requiring minimal or no human intervention. We applied the method to a MELODIC probabilistic ICA of resting-state functional connectivity data acquired in 50 healthy control subjects, and compared the results to a blinded expert manual classification. The method identified between 26 and 72% of the components as artifact (mean 55%). About 0.3% of components identified as artifact were discordant with the manual classification; retrospective examination of these ICs suggested the automated method had correctly identified these as artifact. We have developed an effective automated method which removes a substantial number of unwanted noisy components in ICA analyses of resting-state fMRI data. Source code of our implementation of the method is available. PMID:23847511
Drerup, Christian; Ermert, Johannes; Coenen, Heinz H
2016-09-01
Nitric oxide (NO), an important multifunctional signaling molecule, is produced by three isoforms of NO-synthase (NOS) and has been associated with neurodegenerative disorders. Selective inhibitors of the subtypes iNOS (inducible) or nNOS (neuronal) are of great interest for decoding neurodestructive key factors, and (18)F-labelled analogues would allow investigating the NOS-function by molecular imaging with positron emission tomography. Especially, the highly selective nNOS inhibitor 6-((3-((3-fluorophenethylamino)methyl)phenoxy)methyl)-4-methylpyridin-2-amine (10) lends itself as suitable compound to be (18)F-labelled in no-carrier-added (n.c.a.) form. For preparation of the (18)F-labelled nNOS-Inhibitor [(18)F]10 a "build-up" radiosynthesis was developed based on a corresponding iodonium ylide as labelling precursor. The such activated phenethyl group of the compound was efficiently and regioselectively labelled with n.c.a. [(18)F]fluoride in 79% radiochemical yield (RCY). After conversion by reductive amination and microwave assisted displacement of the protecting groups, the desired nNOS-inhibitor was obtained in about 15% total RCY. Alternatively, for a simplified "late-stage" (18)F-labelling procedure a corresponding boronic ester precursor was synthesized and successfully used in a newer, copper(II) mediated n.c.a. (18)F-fluoro-deboroniation reaction, achieving the same total RCY. Thus, both methods proved comparatively suited to provide the highly selective NOS-inhibitor [(18)F]10 as probe for preclinical in vivo studies.
Karademir, Aykan; Korucu, M Kemal
2013-07-01
A study was conducted to observe the changes in polychlorinated dibenzo-p-dioxins and polychlorinated dibenzofurans (PCDD/F) levels and congener profiles in the flue gas of a hazardous waste incinerator during two start-up periods. Flue gas samplings were performed simultaneously through Air Pollution Control Devices (APCDs) (including boiler outlet, electrostatic precipitator (ESP) outlet, wet scrubbers (WS) outlet, and activated carbon (AC) filter outlet) in different combustion temperatures during a planned cold (long) start-up and an unplanned warm (short) start-up. The results showed that PCDD/F concentrations could be elevated during the start-up periods up to levels 3-4 times higher than those observed in the normal operation. Especially lower combustion temperatures in the short start-ups may cause high PCDD/F concentrations in the raw flue gas. Assessment of combustion temperatures and Furans/Dioxins values indicated that surface-catalyzed de novo synthesis was the dominant pathway in the formation of PCDD/Fs in the combustion units. PCDD/F removal efficiencies of Air Pollution Control Devices suggested that formation by de novo synthesis existed in ESP also when in operation, leading to increase of gaseous phase PCDD/Fs in ESP Particle-bound PCDD/Fs were removed mainly by ESP and WS, while gaseous phase PCDD/Fs were removed by WS, and more efficiently by AC filter. This paper evaluates PCDD/F emissions and removal performances of APCDs (ESP, wet scrubbers, and activated carbon) during two start-up periods in an incinerator. The main implications are the following: (1) start-up periods increase PCDD/F emissions up to 2-3 times in the incinerator; (2) low combustion temperatures in start-ups cause high PCDD/F emissions in raw gas; (3) formation of PCDD/Fs by de novo synthesis occurs in ESP; (4) AC is efficient in removing gaseous PCDD/Fs, but may increase particle-bound ones; and (5) scrubbers remove both gaseous and particle-bound PCDD/Fs efficiently.
Valls, Joan; Castellà, Gerard; Dyba, Tadeusz; Clèries, Ramon
2015-06-01
Predicting the future burden of cancer is a key issue for health services planning, where a method for selecting the predictive model and the prediction base is a challenge. A method, named here Goodness-of-Fit optimal (GoF-optimal), is presented to determine the minimum prediction base of historical data to perform 5-year predictions of the number of new cancer cases or deaths. An empirical ex-post evaluation exercise for cancer mortality data in Spain and cancer incidence in Finland using simple linear and log-linear Poisson models was performed. Prediction bases were considered within the time periods 1951-2006 in Spain and 1975-2007 in Finland, and then predictions were made for 37 and 33 single years in these periods, respectively. The performance of three fixed different prediction bases (last 5, 10, and 20 years of historical data) was compared to that of the prediction base determined by the GoF-optimal method. The coverage (COV) of the 95% prediction interval and the discrepancy ratio (DR) were calculated to assess the success of the prediction. The results showed that (i) models using the prediction base selected through GoF-optimal method reached the highest COV and the lowest DR and (ii) the best alternative strategy to GoF-optimal was the one using the base of prediction of 5-years. The GoF-optimal approach can be used as a selection criterion in order to find an adequate base of prediction. Copyright © 2015 Elsevier Ltd. All rights reserved.
ERIC Educational Resources Information Center
Minnesota State Dept. of Education, St. Paul. Div. of Vocational and Technical Education.
THIS MODULE OF A 30-MODULE COURSE IS DESIGNED TO DEVELOP AN UNDERSTANDING OF THE CONSTRUCTION AND OPERATION OF DIESEL ENGINE STARTING ENGINES AND BRAKE SYSTEMS USED ON DIESEL POWERED VEHICLES. TOPICS ARE (1) GENERAL DESCRIPTION, (2) OPERATION, (3) COMBUSTION SPACE AND VALVE ARRANGEMENT (STARTING ENGINES), (4) TYPES OF BRAKES, AND (5) DOUBLE…
NASA Astrophysics Data System (ADS)
Medcraft, Chris; Mullaney, John C.; Walker, Nicholas R.; Legon, Anthony C.
2017-05-01
A complex of argon with silver iodide (Ar⋯Agsbnd I) has been formed in the gas phase by laser ablation of a silver iodide rod in the presence of a pulse of argon gas and its ground-state rotational spectrum has been detected by means of a chirped-pulse, F-T microwave instrument. Ar⋯Agsbnd I was characterised both by experimental properties determined from its rotational spectrum and by ab initio calculations carried out at the CCSD(T)(F12c)/cc-pVTZ-F12 explicitly correlated level of theory. The molecule was shown to be linear in the ground state, with atoms in the order shown. The Ar⋯Ag and Agsbnd I bond lengths r0(Ar⋯Ag) = 2.6759 Å and r0(Agsbnd I) = 2.5356 Å, the dissociation energy De = 16.7 kJ mol-1 for the process Ar⋯Agsbnd I = Ar + Agsbnd I, the intermolecular quadratic stretching force constant FAr⋯Ag = F22 = 20.2(8) N m-1 and the increase 0.033 in the ionicity ic of Agsbnd I when it enters the complex are reported. The opportunity has been taken to compare the way in which these properties vary along the series Ar⋯Agsbnd X (X = F, Cl, Br and I).
NASA Astrophysics Data System (ADS)
Ulanov, V. A.; Zhiteitcev, E. R.; Varlamov, A. G.
2007-07-01
By means of EPR method the associative [TiF 4F 4F int] 6-(C 4v) and [NiF 4F 4F int] 7-(C 4v) centers were revealed in the fluorite type SrF 2:Ti and SrF 2:Ni crystals grown by Bridgman method in helium atmosphere containing some amount of a fluorine gas. It was found that at low temperatures the local structures of these associative centers were exposed to a static rhombic distortion. The reasons of such distortions were accounted for by the assumption that the E ⊗ ( b1 + b2) vibronic interaction became effective due to that the ground orbital states of the [TiF 4F 4F int] 6-(C 4v) and [NiF 4F 4F int] 7-(C 4v) centers occurred to be doubly degenerated.
Smith, Aaron L.; Freeman, Sara M.; Stehouwer, Jeffery S.; Inoue, Kiyoshi; Voll, Ronald J.; Young, Larry J.; Goodman, Mark M.
2013-01-01
Compounds 1–4 were synthesized and investigated for selectivity and potency for the oxytocin receptor (OTR) to determine their viability as radioactive ligands. Binding assays determined 1–4 to have high binding affinity for both the human and rodent OTR and also have high selectivity for the human OTR over human vasopressin V1a receptors (V1aR). Inadequate selectivity for OTR over V1aR was found for rodent receptors in all four compounds. The radioactive (C-11, F-18, and I-125) derivatives of 1–4 were synthesized and investigated for use as autoradiography and positron emission tomography (PET) ligands. Receptor autoradiography performed with [125I]1 and [125I]2 on rodent brain slices provided the first small molecule radioligand images of the OTR and V1aR. Biodistribution studies determined [125I]1 and [125I]2 were adequate for in vivo peripheral investigations, but not for central investigations due to low uptake within the brain. A biodistribution study with [18F]3 suggested brain uptake occurred slowly over time. PET imaging studies with [18F]3 and [11C]4 using a rat model provided insufficient uptake in the brain over a 90 and 45 min scan times respectively to merit further investigations in non-human primates. PMID:22425346
40 CFR Appendix I to Part 75... - [Reserved
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 17 2012-07-01 2012-07-01 false [Reserved] I Appendix I to Part 75-Optional F-Factor/Fuel Flow Method Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Flow Method [Reserved] ...
40 CFR Appendix I to Part 75... - [Reserved
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 17 2013-07-01 2013-07-01 false [Reserved] I Appendix I to Part 75-Optional F-Factor/Fuel Flow Method Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Flow Method [Reserved] ...
40 CFR Appendix I to Part 75... - [Reserved
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 17 2014-07-01 2014-07-01 false [Reserved] I Appendix I to Part 75-Optional F-Factor/Fuel Flow Method Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Flow Method [Reserved] ...
40 CFR Appendix I to Part 75... - [Reserved
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 16 2011-07-01 2011-07-01 false [Reserved] I Appendix I to Part 75-Optional F-Factor/Fuel Flow Method Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Flow Method [Reserved] ...
40 CFR Appendix I to Part 75... - [Reserved
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false [Reserved] I Appendix I to Part 75-Optional F-Factor/Fuel Flow Method Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Flow Method [Reserved] ...
NASA Astrophysics Data System (ADS)
Gao, Jian; Liang, Li; Chen, Qingqing; Zhang, Ling; Huang, Tonghui
2018-02-01
Acetyl-coenzyme A carboxylases (ACCs) is the first committed enzyme of fatty acid synthesis pathway. The inhibition of ACC is thought to be beneficial not only for diseases related to metabolism, such as type-2 diabetes, but also for infectious disease like bacterial infection disease. Soraphen A, a potent allosteric inhibitor of BC domain of yeast ACC, exhibit lower binding affinities to several yeast ACC mutants and the corresponding drug resistance mechanisms are still unknown. We report here a theoretical study of binding of soraphen A to wild type and yeast ACC mutants (including F510I, N485G, I69E, E477R, and K73R) via molecular dynamic simulation and molecular mechanics/generalized Born surface area free energy calculations methods. The calculated binding free energies of soraphen A to yeast ACC mutants are weaker than to wild type, which is highly consistent with the experimental results. The mutant F510I weakens the binding affinity of soraphen A to yeast ACC mainly by decreasing the van der Waals contributions, while the weaker binding affinities of Soraphen A to other yeast ACC mutants including N485G, I69E, E477R, and K73R are largely attributed to the decreased net electrostatic (ΔE ele + ΔG GB) interactions. Our simulation results could provide important insights for the development of more potent ACC inhibitors.
An improved 3D MoF method based on analytical partial derivatives
NASA Astrophysics Data System (ADS)
Chen, Xiang; Zhang, Xiong
2016-12-01
MoF (Moment of Fluid) method is one of the most accurate approaches among various surface reconstruction algorithms. As other second order methods, MoF method needs to solve an implicit optimization problem to obtain the optimal approximate surface. Therefore, the partial derivatives of the objective function have to be involved during the iteration for efficiency and accuracy. However, to the best of our knowledge, the derivatives are currently estimated numerically by finite difference approximation because it is very difficult to obtain the analytical derivatives of the object function for an implicit optimization problem. Employing numerical derivatives in an iteration not only increase the computational cost, but also deteriorate the convergence rate and robustness of the iteration due to their numerical error. In this paper, the analytical first order partial derivatives of the objective function are deduced for 3D problems. The analytical derivatives can be calculated accurately, so they are incorporated into the MoF method to improve its accuracy, efficiency and robustness. Numerical studies show that by using the analytical derivatives the iterations are converged in all mixed cells with the efficiency improvement of 3 to 4 times.
ERIC Educational Resources Information Center
Neugebauer, Roger
2010-01-01
The creation of the Head Start program occurred at break-neck speed with many dramatic turns and many colorful players. No one tells the story better than Edward Zigler in "Head Start: The Inside Story of America's Most Successful Educational Experiment"--a detailed and personal, behind the scenes look at the program's inception. From this…
Ackermann, Uwe; Lewis, Jason S; Young, Kenneth; Morris, Michael J; Weickhardt, Andrew; Davis, Ian D; Scott, Andrew M
2016-08-01
Imaging of androgen receptor expression in prostate cancer using F-18 FDHT is becoming increasingly popular. With the radiolabelling precursor now commercially available, developing a fully automated synthesis of [(18) F] FDHT is important. We have fully automated the synthesis of F-18 FDHT using the iPhase FlexLab module using only commercially available components. Total synthesis time was 90 min, radiochemical yields were 25-33% (n = 11). Radiochemical purity of the final formulation was > 99% and specific activity was > 18.5 GBq/µmol for all batches. This method can be up-scaled as desired, thus making it possible to study multiple patients in a day. Furthermore, our procedure uses 4 mg of precursor only and is therefore cost-effective. The synthesis has now been validated at Austin Health and is currently used for [(18) F]FDHT studies in patients. We believe that this method can easily adapted by other modules to further widen the availability of [(18) F]FDHT. Copyright © 2016 John Wiley & Sons, Ltd.
REPORT OF THE EFFECTIVENESS OF PROJECT HEAD START, LUBBOCK, TEXAS. PARTS I, II, AND APPENDICES.
ERIC Educational Resources Information Center
CARTWRIGHT, WALTER J.; STEGLICH, W.G.
WITH THE COMPLETION OF THE FIRST GRADE BY THE FIRST HEAD START CLASS IN LUBBOCK, TEXAS, THIS STUDY WAS UNDERTAKEN TO PRESENT DATA ON THE EFFECTIVENESS OF THE HEAD START PROGRAM IN IMPROVING DISADVANTAGED CHILDREN'S CHANCES FOR SCHOOL SUCCESS. TWO HUNDRED AND NINETY-FIVE URBAN AREA HEAD START CHILDREN FROM NEGRO, ANGLO-AMERICAN, AND…
Investigation of luminescent properties of LaF3:Nd3+ nanoparticles
NASA Astrophysics Data System (ADS)
Wyrwas, Marek; Miluski, Piotr; Zmojda, Jacek; Kochanowicz, Marcin; Jelen, Piotr; Sitarz, Maciej; Dorosz, Dominik
2015-09-01
Lanthanum fluoride nanoparticles doped with Nd3+ ions obtained via solvothermal method have been presented. Doped nanoparticles were prepared in two-step method. Firstly rare-earth chlorides were synthesized from oxides and then they were used to prepare LaF3 particles. The luminescence spectra shows typical for crystalline materials Stark splitting at 880 nm corresponding 4F3/2 to 4I9/2 level transition and 1060 nm matching 4F3/2 to 4I11/2 level transition. The highest luminescence intensity was achieved for sample doped with 0.75% wt. of Nd3+, and the longest decay time for sample doped with 0.5% wt. which reached 328 μs. The XRD pattern analysis confirmed that obtained material consists of crystalline LaF3, the grain size was estimated from Sherrer's formula and equaled about 25nm.
NASA Technical Reports Server (NTRS)
Ladanyi, Dezso J; Sloop, John L; Humphrey, Jack C; Morrell, Gerald
1950-01-01
Experiments were conducted at sea level and pressure altitude of about 55,000 feet at various temperatures to determine starting characteristics of a commercial rocket engine using crude monoethylaniline and other fuels with mixed acid. With crude monoethylaniline, ignition difficulties were encountered at temperatures below about 20 degrees F. With mixed butyl mercaptans, water-white turpentine, and x-pinene, no starting difficulties were experienced at temperatures as low as minus 74 degrees F. Turpentine and x-pinene, however, sometimes left deposits on the injector face. With blends containing furfuryl alcohol and with other blends, difficulties were experienced either from appreciable deposits or from starting.
Abelian gauge symmetries in F-theory and dual theories
NASA Astrophysics Data System (ADS)
Song, Peng
constructing general F-theory compactifications with U(1) x U(1) x U(1) abelian gauge symmetry. In chapter 1 of this dissertation, I proved finiteness of a region of the string landscape in Type IIB compactifications. String compactifications give rise to a collection of effective low energy theories, known as the string landscape. In chapter 3 of this dissertation, I study abelian gauge symmetries in the duality between F-theory and E8 x E8 heterotic string theory. However, how abelian gauge symmetries can arise in the dual heterotic string theory has never been studied. The main goal of this chapter is to study exactly this. We start with F-theory compactifications with abelian gauge symmetry. With the help of a mathematical lemma as well as a computer code that I came up with, I was able to construct a rich list of specialized examples with specific abelian and nonabelian gauge groups on the F-theory side. (Abstract shortened by ProQuest.).
Guo, Jinxia; Guo, Ning; Lang, Lixin; Kiesewetter, Dale O.; Xie, Qingguo; Li, Quanzheng; Eden, Henry S.; Niu, Gang; Chen, Xiaoyuan
2014-01-01
A single dynamic PET acquisition using multiple tracers administered closely in time could provide valuable complementary information about a tumor’s status under quasi-constant conditions. This study aims to investigate the utility of dual-tracer dynamic PET imaging with 18F-Alfatide II (18F-AlF-NOTA-E[PEG4-c(RGDfk)]2) and 18F-FDG for parametric monitoring of tumor responses to therapy. Methods We administered doxorubicin to one group of athymic nude mice with U87MG tumors and Abraxane to another group of mice with MDA-MB-435 tumors. To monitor therapeutic responses, we performed dual-tracer dynamic imaging, in sessions that lasted 90 min, starting by injecting the mice via tail vein catheters with 18F-Alfatide II, followed 40 minutes later by 18F-FDG. To achieve signal separation of the two tracers, we fit a three-compartment reversible model to the time activity curve (TAC) of 18F-Alfatide II for the 40 min prior to 18F-FDG injection, and then extrapolated to 90 min. The 18F-FDG tumor TAC was isolated from the 90 min dual tracer tumor TAC by subtracting the fitted 18F-Alfatide II tumor TAC. With separated tumor TACs, the 18F-Alfatide II binding potential (Bp=k3/k4) and volume of distribution (VD), and 18F-FDG influx rate ((K1×k3)/(k2 + k3)) based on the Patlak method were calculated to validate the signal recovery in a comparison with 60-min single tracer imaging and to monitor therapeutic response. Results The transport and binding rate parameters K1-k3 of 18F-Alfatide II, calculated from the first 40 min of dual tracer dynamic scan, as well as Bp and VD, correlated well with the parameters from the 60 min single tracer scan (R2 > 0.95). Compared with the results of single tracer PET imaging, FDG tumor uptake and influx were recovered well from dual tracer imaging. Upon doxorubicin treatment, while no significant changes in static tracer uptake values of 18F-Alfatide II or 18F-FDG were observed, both 18F-Alfatide II Bp and 18F-FDG influx from kinetic
Equations of state of anhydrous AlF 3 and AlI 3 : Modeling of extreme condition halide chemistry
Stavrou, Elissaios; Zaug, Joseph M.; Bastea, Sorin; ...
2015-06-04
Pressure dependent angle-dispersive x-ray powder diffraction measurements of alpha-phase aluminum trifluoride (α-AlF 3) and separately, aluminum triiodide (AlI 3) were conducted using a diamond-anvil cell. Results at 295 K extend to 50 GPa. The equations of state of AlF 3 and AlI 3 were determined through refinements of collected x-ray diffraction patterns. The respective bulk moduli and corresponding pressure derivatives are reported for multiple orders of the Birch-Murnaghan (B-M), finite-strain (F-f), and higher pressure finite-strain (G-g) EOS analysis models. Aluminum trifluoride exhibits an apparent isostructural phase transition at approximately 12 GPa. Aluminum triiodide also undergoes a second-order atomic rearrangement: appliedmore » stress transformed a monoclinically distorted face centered cubic (fcc) structure into a standard fcc structural arrangement of iodine atoms. In conclusion, results from semi-empirical thermochemical computations of energetic materials formulated with fluorine containing reactants were obtained with the aim of predicting the yield of halogenated products.« less
Equations of state of anhydrous AlF 3 and AlI 3 : Modeling of extreme condition halide chemistry
DOE Office of Scientific and Technical Information (OSTI.GOV)
Stavrou, Elissaios; Zaug, Joseph M.; Bastea, Sorin
Pressure dependent angle-dispersive x-ray powder diffraction measurements of alpha-phase aluminum trifluoride (α-AlF 3) and separately, aluminum triiodide (AlI 3) were conducted using a diamond-anvil cell. Results at 295 K extend to 50 GPa. The equations of state of AlF 3 and AlI 3 were determined through refinements of collected x-ray diffraction patterns. The respective bulk moduli and corresponding pressure derivatives are reported for multiple orders of the Birch-Murnaghan (B-M), finite-strain (F-f), and higher pressure finite-strain (G-g) EOS analysis models. Aluminum trifluoride exhibits an apparent isostructural phase transition at approximately 12 GPa. Aluminum triiodide also undergoes a second-order atomic rearrangement: appliedmore » stress transformed a monoclinically distorted face centered cubic (fcc) structure into a standard fcc structural arrangement of iodine atoms. In conclusion, results from semi-empirical thermochemical computations of energetic materials formulated with fluorine containing reactants were obtained with the aim of predicting the yield of halogenated products.« less
Lagor, William R; Fields, David W; Bauer, Robert C; Crawford, Alison; Abt, Michael C; Artis, David; Wherry, E John; Rader, Daniel J
2014-03-01
Apolipoprotein F (ApoF) is a sialoglycoprotein that is a component of the HDL and LDL fractions of human serum. We sought to test the hypothesis that ApoF plays an important role in atherosclerosis in mice by modulating lipoprotein function. Atherosclerosis was assessed in male low density lipoprotein receptor knockout (Ldlr KO) and ApoF/Ldlr double knockout (DKO) mice fed a Western diet for 16 weeks. ApoF/Ldlr DKO mice showed a 39% reduction in lesional area by en face analysis of aortas (p < 0.05), despite no significant differences in plasma lipid parameters. ApoF KO mice had reduced expression of Interferon alpha (IFNα) responsive genes in liver and spleen, as well as impaired macrophage activation. Interferon alpha induced gene 27 like 2a (Ifi27l2a), Oligoadenylate synthetases 2 and 3 (Oas2 and Oas3) were significantly reduced in the ApoF KO mice relative to wild type controls. These effects were attributable to hypomorphic expression of Stat2 in the ApoF KO mice, a critical gene in the Type I IFN pathway that is situated just 425 base pairs downstream of ApoF. These studies implicate STAT2 as a potentially important player in atherosclerosis, and support the growing evidence that the Type I IFN pathway may contribute to this complex disease. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
A Floating Potential Method for Determining Ion Density
NASA Astrophysics Data System (ADS)
Evans, John D.; Chen, Francis F.
2001-10-01
The density n in partially ionized discharges is often found from the saturation ion current Ii of a cylindrical Langmuir probe. Collisionless probe theories, however, disagree with measured I - V curves probably because of collisions^1. We use a heuristic method that yields n from probe data agreeing with microwave interferometry. Probe current I is raised to the 4/3 power and fitted to a straight line on an I^4/3-V plot. The line is extrapolated to the floating potential V_f, thus approximating I_i(V_f). The sheath thickness d_sh for V = Vf is calculated from the Child-Langmuir (CL) law, and applying the Bohm sheath criterion to the surface at r_sh = Rp + d_sh yields n when Ii = I_i(V_f). This method works, but it cannot be justified by theory. Neglected are (a) cylindrical convergence of the ion charge, (b) finite ion energy at r = r_sh, (c) ions orbiting the probe, and (d) escape of ions axially. The Allen-Boyd-Reynolds theory, which treats (a) and (b) and neglects (c) and (d), gives too low n's. Apparently the errors self-cancel, and the simple Vf method gives the right result. ^1 F.F. Chen, Phys. Plasmas 8, 3029 (2001).
Pinti, Paola; Merla, Arcangelo; Aichelburg, Clarisse; Lind, Frida; Power, Sarah; Swingler, Elizabeth; Hamilton, Antonia; Gilbert, Sam; Burgess, Paul W; Tachtsidis, Ilias
2017-07-15
Recent technological advances have allowed the development of portable functional Near-Infrared Spectroscopy (fNIRS) devices that can be used to perform neuroimaging in the real-world. However, as real-world experiments are designed to mimic everyday life situations, the identification of event onsets can be extremely challenging and time-consuming. Here, we present a novel analysis method based on the general linear model (GLM) least square fit analysis for the Automatic IDentification of functional Events (or AIDE) directly from real-world fNIRS neuroimaging data. In order to investigate the accuracy and feasibility of this method, as a proof-of-principle we applied the algorithm to (i) synthetic fNIRS data simulating both block-, event-related and mixed-design experiments and (ii) experimental fNIRS data recorded during a conventional lab-based task (involving maths). AIDE was able to recover functional events from simulated fNIRS data with an accuracy of 89%, 97% and 91% for the simulated block-, event-related and mixed-design experiments respectively. For the lab-based experiment, AIDE recovered more than the 66.7% of the functional events from the fNIRS experimental measured data. To illustrate the strength of this method, we then applied AIDE to fNIRS data recorded by a wearable system on one participant during a complex real-world prospective memory experiment conducted outside the lab. As part of the experiment, there were four and six events (actions where participants had to interact with a target) for the two different conditions respectively (condition 1: social-interact with a person; condition 2: non-social-interact with an object). AIDE managed to recover 3/4 events and 3/6 events for conditions 1 and 2 respectively. The identified functional events were then corresponded to behavioural data from the video recordings of the movements and actions of the participant. Our results suggest that "brain-first" rather than "behaviour-first" analysis is
Starting time for induction of labor and the risk for night-time delivery.
Thorsell, M; Lyrenäs, S; Andolf, E; Kaijser, M
2011-08-01
To analyze if starting time for labor induction affected the risk of night-time delivery, and to evaluate to what extent the risk was influenced by Bishop score at start of induction, mode of induction, and parity. A retrospective cohort study of women who delivered at Danderyd Hospital, Stockholm, Sweden, 2002-2006, comprising 1940 women induced by Dinoprostone (PGE(2)) or transcervical balloon catheter (BARD). Risks for night-time delivery were calculated as absolute risk and Odds Ratios by unconditional logistic regression using induction of labor in the morning as reference. For nulliparae with Bishop score 0-3 induced by BARD, odds ratios for night-time delivery were 0.42 (95% C.I. 0.19-0.93) and 0.09 (95% C.I. 0.02-0.47) when inductions started in the afternoon and evening, respectively, compared to inductions starting in the morning For multiparae, however, the risk of night-time delivery was highest if induction started in the evening. Compared to inductions started in the morning, odds ratios for night-time delivery were 3.53 (95% C.I. 2.57-4.83) and 8.49 (95% C.I. 4.45-16.19) for induction starting in the afternoon and evening, respectively. Starting time of labor induction affects the risk of giving birth at night. For nulliparae induced by BARD, starting the induction in the evening instead of during the day may reduce the number of night-time deliveries substantially. For multiparae, however, our data suggest that induction of labor should take place in the morning. Copyright © 2011 Elsevier B.V. All rights reserved.
1983-09-01
34 2nd. Ed. McGraw Hill , New York, 1976, p. 419. [32] Odom, E. M. and Adams, D. E.,"A Study of Polymer Matrix Fatigue Proper- ties," NADC-TR-83053-60...Compression," Ph.D. Thesis, Drexel University, Phila- delphia, PA. 1984 . [34] Crossman, F. W., Warren, W. J . and Wang, A. S. D.,"Influence of Ply...II :2 3____ 4’ F-i7-E-i- 4S-57F* II 0. 1____ 10 ’ G , - I I ’ ’ " 2!___ I ! I I I I 1tILL II I hILL J l 0. 1 1 10 G, (in-lb/in ) Figure 18. Mixed
Webster, J.D.
1990-01-01
Fluid/melt distribution coefficients for F have been determined in experiments conducted with peraluminous topaz rhyolite melts and fluids consisting of H2O and H2O+CO2 at pressures of 0.5 to 5 kbar, temperatures of 775??-1000??C, and concentrations of F in the melt ranging from 0.5 to 6.9 wt%. The major element, F, and Cl concentrations of the starting material and run product glasses were determined by electron microprobe, and the concentration of F in the fluid was calculated by mass balance. The H2O concentrations of some run product glasses were determined by ion microprobe (SIMS). The solubility of melt in the fluid phase increases with increasing F in the system; the solubility of H2O in the melt is independent of the F concentration of the system with up to 6.3 wt% F in the melt. No evidence of immiscible silica- and fluoriderich liquids was detected in the hydrous but water-undersaturated starting material glasses (???8.5 wt% F in melt) or in the water-saturated run product glasses. F concentrates in topaz rhyolite melts relative to coexisting fluids at most conditions studied; however, DF (wt% F in fluid/wt% F in melt) increases strongly with increasing F in the system. Maximum values of DF in this study are significantly larger than those previously reported in the literature. Linear extrapolation of the data suggests that DF is greater than one for water-saturated, peraluminous granitic melts containing ???8 wt% F at 800?? C and 2 kbar. DF increases as temperature and as (H2O/H2O+CO2) of the fluid increase. For topaz rhyolite melts containing ???1 wt% F and with H2O-rich fluids, DF is independent of changes in pressure from 2 to 5 kbar at 800?? C; for melts containing ???1 wt% F and in equilibrium with CO2-bearing fluids the concentrations of F in fluid increases with increasing pressure. F-and lithophile element-enriched granites may evolve to compositions containing extreme concentrations of F during the final stages of crystallization. If F in the
Epitaxial growth of lithium fluoride on the (1 1 1) surface of CaF 2
NASA Astrophysics Data System (ADS)
Klumpp, St; Dabringhaus, H.
1999-08-01
Growth of lithium fluoride by molecular beam epitaxy on the (1 1 1) surface of calcium fluoride crystals was studied by TEM and LEED for crystal temperatures from 400 to 773 K and impinging lithium fluoride fluxes from 3×10 11 to 3×10 14 cm -2 s -1. Growth starts, usually, at the <1 1 0> steps on the (1 1 1) surface of CaF 2. For larger step distances and at later growth stages also growth on the terraces between the steps is found. Preferably, longish, roof-like crystallites are formed, which can be interpreted by growth of LiF(2 0 1¯)[0 1 0] parallel to CaF 2(1 1 1)[ 1¯ 0 1]. To a lesser extent square crystallites, i.e. growth with LiF(0 0 1), and, rarely, three-folded pyramidal crystallites, i.e. growth with LiF(1 1 1) parallel to CaF 2(1 1 1), are observed. While the pyramidal crystallites show strict epitaxial orientation with LiF[ 1¯ 0 1]‖CaF 2[ 1¯ 0 1] and LiF[ 1¯ 0 1]‖CaF 2[1 2¯ 1], only about 80% of the square crystallites exhibit an epitaxial alignment, where LiF[1 0 0]‖CaF 2[ 1¯ 0 1] is preferred to LiF[1 1 0]‖CaF 2[ 1¯ 0 1]. The epitaxial relationships are discussed on the basis of theoretically calculated adsorption positions of the lithium fluoride monomer and dimer on the terrace and at the steps of the CaF 2(1 1 1) surface.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Mints, S.; Rafal'skii, V.
1961-09-01
The current-intensity curves of non-electrolyzed salts and the curves of time-intensity and current-intensity in electrolyzed salts were plotted for molten ThF/sub 4/ and ThF /sub 4/CaF/sub 2/. The intensity of salt disintegration was determined, and electric conductivity in electrolyte was observed. (trauth)
Integrating EEG and fMRI in epilepsy.
Formaggio, Emanuela; Storti, Silvia Francesca; Bertoldo, Alessandra; Manganotti, Paolo; Fiaschi, Antonio; Toffolo, Gianna Maria
2011-02-14
Integrating electroencephalography (EEG) and functional magnetic resonance imaging (fMRI) studies enables to non-invasively investigate human brain function and to find the direct correlation of these two important measures of brain activity. Presurgical evaluation of patients with epilepsy is one of the areas where EEG and fMRI integration has considerable clinical relevance for localizing the brain regions generating interictal epileptiform activity. The conventional analysis of EEG-fMRI data is based on the visual identification of the interictal epileptiform discharges (IEDs) on scalp EEG. The convolution of these EEG events, represented as stick functions, with a model of the fMRI response, i.e. the hemodynamic response function, provides the regressor for general linear model (GLM) analysis of fMRI data. However, the conventional analysis is not automatic and suffers of some subjectivity in IEDs classification. Here, we present an easy-to-use and automatic approach for combined EEG-fMRI analysis able to improve IEDs identification based on Independent Component Analysis and wavelet analysis. EEG signal due to IED is reconstructed and its wavelet power is used as a regressor in GLM. The method was validated on simulated data and then applied on real data set consisting of 2 normal subjects and 5 patients with partial epilepsy. In all continuous EEG-fMRI recording sessions a good quality EEG was obtained allowing the detection of spontaneous IEDs and the analysis of the related BOLD activation. The main clinical finding in EEG-fMRI studies of patients with partial epilepsy is that focal interictal slow-wave activity was invariably associated with increased focal BOLD responses in a spatially related brain area. Our study extends current knowledge on epileptic foci localization and confirms previous reports suggesting that BOLD activation associated with slow activity might have a role in localizing the epileptogenic region even in the absence of clear
On dynamical systems approaches and methods in f ( R ) cosmology
DOE Office of Scientific and Technical Information (OSTI.GOV)
Alho, Artur; Carloni, Sante; Uggla, Claes, E-mail: aalho@math.ist.utl.pt, E-mail: sante.carloni@tecnico.ulisboa.pt, E-mail: claes.uggla@kau.se
We discuss dynamical systems approaches and methods applied to flat Robertson-Walker models in f ( R )-gravity. We argue that a complete description of the solution space of a model requires a global state space analysis that motivates globally covering state space adapted variables. This is shown explicitly by an illustrative example, f ( R ) = R + α R {sup 2}, α > 0, for which we introduce new regular dynamical systems on global compactly extended state spaces for the Jordan and Einstein frames. This example also allows us to illustrate several local and global dynamical systems techniquesmore » involving, e.g., blow ups of nilpotent fixed points, center manifold analysis, averaging, and use of monotone functions. As a result of applying dynamical systems methods to globally state space adapted dynamical systems formulations, we obtain pictures of the entire solution spaces in both the Jordan and the Einstein frames. This shows, e.g., that due to the domain of the conformal transformation between the Jordan and Einstein frames, not all the solutions in the Jordan frame are completely contained in the Einstein frame. We also make comparisons with previous dynamical systems approaches to f ( R ) cosmology and discuss their advantages and disadvantages.« less
Environmental Chemistry Methods (ECM) Index - I
Laboratories use testing methods to identify pesticides in water and soil. Environmental chemistry methods test soil and water samples to determine the fate of pesticides in the environment. Find methods for chemicals with I as the first character.
Sure start: voices of the 'hard-to-reach'.
Coe, C; Gibson, A; Spencer, N; Stuttaford, M
2008-07-01
This research aimed to look in depth at the factors affecting the ability of four Sure Start local programmes, based in a multicultural Midlands city, to engage with 'hard-to-reach' populations. A variety of research strategies and methods were employed. Geographical information systems, participatory research methods and interviews were used in order to understand the extent of the challenge, and hear first hand, why parents may not get involved with Sure Start. The mapping exercise involved collation and mapping of postcode data with respect to boundaries and potential and actual users of Sure Start services. This made possible the identification of any geographical patterning in the distribution of service users and non-users. Participatory research methods were used with parents, enabling them to conduct short interviews within their own communities and make sense of the data collected. Interviews were also conducted with 70 parents across the city, recruited through local schools. The results indicate that parental decisions regarding Sure Start are the product of a complex interaction between numerous factors which may act as either barriers or facilitators to service utilization. The results suggest that a multi-method approach to data collection is useful and appropriate in gaining access to those parents who are non-users of the Sure Start services and enabling their voices to be heard. These findings offer some explanations and insight into the apparent ambivalent attitudes of some families toward Sure Start services. Implications for future practice are discussed.
Fernández-Ortuño, Dolores; Waalwijk, Cees; Van der Lee, Theo; Fan, Jieru; Atkins, Sarah; West, Jonathan S; Fraaije, Bart A
2013-08-16
Due to the repeated discovery of new members of the Fusarium graminearum species complex (FGSC), some of the F. graminearum sensu stricto (s.s.)-specific qPCR assays developed to date have since been shown to be non-specific. In this study, a probe-based qPCR method was developed, targeting a sterol 14-alpha demethylase (CYP51) paralogue, CYP51C unique to the genus Fusarium, for the simultaneous detection of F. asiaticum, F. ussurianum and F. vorosii. Specificity of the assay was demonstrated for a wide range of Fusarium species, including all tested FGSC members (n=6), originating from different hosts and geographic regions. Alongside a previously published assay for detection of F. graminearum, we were able to show that members of the Asian clade of the FGSC (i.e. F. asiaticum, F. ussurianum and F. vorosii) were the primary etiological agent in wheat seeds samples originating from Central-East China. The grain samples from the UK tested negative for the presence of the FGSC's Asian clade and positive for presence of F. graminearum. It is likely that only F. graminearum s.s. is present in the UK, but the presence of other FGSC members cannot be ruled out and need further investigation. Copyright © 2013 Elsevier B.V. All rights reserved.
Wang, Feng; Fang, Wei; Zhang, Ming-Rong; Zhao, Ming; Liu, Biao; Wang, Zizheng; Hua, Zichun; Yang, Min; Kumata, Katsushi; Hatori, Akiko; Yamasaki, Tomoteru; Yanamoto, Kazuhiko; Suzuki, Kazutoshi
2013-01-01
The C2A domain of synaptotagmin I can target apoptotic cells by binding to exposed anionic phospholipids. The goal of this study was to synthesize and develop 18F-labeled C2A-gluta-thione-S-transferase (GST) as a molecular imaging probe for the detection of apoptosis and to assess the response of paclitaxel chemotherapy in VX2 rabbit lung cancer. Methods 18F-C2A-GST was prepared by labeling C2A-GST with N-succinimidyl 4-18F-fluorobenzoate (18F-SFB). 18F-C2A-GST was confirmed by high-performance liquid chromatography and sodium dodecyl sulfate polyacrylamide gel electrophoresis. The binding of 18F-C2A-GST toward apoptosis was validated in vitro using camptothecin-induced Jurkat cells. Biodistribution of 18F-C2A-GST was determined in mice by a dissection method and small-animal PET. Single-dose paclitaxel was used to induce apoptosis in rabbits bearing VX2 tumors (n = 6), and 2 VX2 rabbits without treatment served as control. 18F-C2A-GST PET was performed before and at 72 h after therapy, and 18F-FDG PET/CT was also performed before treatment. To confirm the presence of apoptosis, tumor tissue was analyzed and activated caspase-3 was measured. Results 18F-C2A-GST was obtained with more than 95% radiochemical purity and was stable for 4 h after formulation. 18F-C2A-GST bound apoptotic cells specifically. Biodistribution in mice showed that 18F-C2A-GST mainly excreted from the kidneys and rapidly cleared from blood and nonspecific organs. High focal uptake of 18F-C2A-GST in the tumor area was determined after therapy, whereas no significant uptake before therapy was found in the tumor with 18F-FDG–avid foci. The maximum standardized uptake value after therapy was 0.47 ± 0.28, significantly higher than that in the control (0.009 ± 0.001; P < 0.001). The apoptotic index was 79.81% ± 8.73% in the therapy group, significantly higher than that in the control (5.03% ± 0.81%; P < 0.001). Activated caspase-3 after paclitaxel treatment increased to 69.55% ± 16.27% and
ERIC Educational Resources Information Center
Sandberg, Per; Larsen, Synnove Lyssand
1993-01-01
Orienteering competitors in the World Cup Event completed a questionnaire related to the use of the mass-start (Hagaby) method rather than the individual start. The competitors found the event slightly less fair, equally challenging, but more fun and exciting than previous World Cup competitions. (KS)
Sulfonyl fluoride-based prosthetic compounds as potential 18F labelling agents.
Inkster, James A H; Liu, Kate; Ait-Mohand, Samia; Schaffer, Paul; Guérin, Brigitte; Ruth, Thomas J; Storr, Tim
2012-08-27
Nucleophilic incorporation of [(18)F]F(-) under aqueous conditions holds several advantages in radiopharmaceutical development, especially with the advent of complex biological pharmacophores. Sulfonyl fluorides can be prepared in water at room temperature, yet they have not been assayed as a potential means to (18)F-labelled biomarkers for PET chemistry. We developed a general route to prepare bifunctional 4-formyl-, 3-formyl-, 4-maleimido- and 4-oxylalkynl-arylsulfonyl [(18)F]fluorides from their sulfonyl chloride analogues in 1:1 mixtures of acetonitrile, THF, or tBuOH and Cs[(18)F]F/Cs(2)CO(3(aq.)) in a reaction time of 15 min at room temperature. With the exception of 4-N-maleimide-benzenesulfonyl fluoride (3), pyridine could be used to simplify radiotracer purification by selectively degrading the precursor without significantly affecting observed yields. The addition of pyridine at the start of [(18)F]fluorination (1:1:0.8 tBuOH/Cs(2)CO(3(aq.))/pyridine) did not negatively affect yields of 3-formyl-2,4,6-trimethylbenzenesulfonyl [(18)F]fluoride (2) and dramatically improved the yields of 4-(prop-2-ynyloxy)benzenesulfonyl [(18)F]fluoride (4). The N-arylsulfonyl-4-dimethylaminopyridinium derivative of 4 (14) can be prepared and incorporates (18)F efficiently in solutions of 100 % aqueous Cs(2)CO(3) (10 mg mL(-1)). As proof-of-principle, [(18)F]2 was synthesised in a preparative fashion [88(±8) % decay corrected (n=6) from start-of-synthesis] and used to radioactively label an oxyamino-modified bombesin(6-14) analogue [35(±6) % decay corrected (n=4) from start-of-synthesis]. Total preparation time was 105-109 min from start-of-synthesis. Although the (18)F-peptide exhibited evidence of proteolytic defluorination and modification, our study is the first step in developing an aqueous, room temperature (18)F labelling strategy. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Cold starting of fluorescent lamps - part I: a description of the transient regime
NASA Astrophysics Data System (ADS)
Langer, Reinhard; Garner, Richard; Paul, Irina; Horn, Siegfried; Tidecks, Reinhard
2016-10-01
In this paper we give a proposal for the transient behaviour of a cold-started fluorescent lamp, from the generation of the first conductive channel over the normal and abnormal glow discharge and the glow-to-arc (GTA) transition to the arc discharge in the steady state. Starting from the equilibrium voltage-current characteristics of the lamp and considering recent experimental results a qualitative description of the transient regime is developed, which was so far not available in the literature.
Ogbi, Mourad; Obi, Ijeoma; Johnson, John A.
2013-01-01
We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n = 5) percentage of maximal cTnI release was 30±7 and 60±17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60–150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts. PMID:23936451
Alvarez, Leslie C; Ponce, Gustavo; Saavedra-Rodriguez, Karla; Lopez, Beatriz; Flores, Adriana E
2015-06-01
The V1016I and F1534C mutations in the voltage-gated sodium channel gene have been associated with resistance to pyrethroids and DDT in Aedes aegypti mosquitoes. A study was carried out to determine the frequency of I1016 and C1534 by real-time PCR in five natural populations of Ae. aegypti in Venezuela during 2008, 2010 and 2012, as well as in a strain selected with 0.14 µg of deltamethrin for 15 generations. In natural populations, frequencies of I1016 varied between 0.01 and 0.37, and frequencies of C1534 between 0.35 and 1.0. In the Pampanito strain, the frequency of I1016 increased from 0.02 in F1 up to 0.5 in F15 and from 0.35 up to fixation for C1534 after selection with deltamethrin. The results showed that C1534 frequencies are higher than I1016 frequencies in natural populations of Ae. aegypti in Venezuela, and that deltamethrin selected the C1534 more rapidly than I1016. © 2014 Society of Chemical Industry.
Probing the 5 f electrons in Am-I by hybrid density functional theory
NASA Astrophysics Data System (ADS)
Atta-Fynn, Raymond; Ray, Asok K.
2009-11-01
The ground states of the actinides and their compounds continue to be matters of considerable controversies. Experimentally, Americium-I (Am-I) is a non-magnetic dhcp metal whereas theoretically an anti-ferromagnetic ground state is predicted. We show that hybrid density functional theory, which admixes a fraction, λ, of exact Hartree-Fock (HF) exchange with approximate DFT exchange, can correctly reproduce the ground state properties of Am. In particular, for λ=0.40, we obtain a non-magnetic ground state with equilibrium atomic volume, bulk modulus, 5 f electron population, and the density of electronic states all in good agreement with experimental data. We argue that the exact HF exchange corrects the overestimation of the approximate DFT exchange interaction.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Moignier, C., E-mail: cyril.moignier@free.fr; Huet, C.; Makovicka, L.
Purpose: In a previous work, output ratio (OR{sub det}) measurements were performed for the 800 MU/min CyberKnife{sup ®} at the Oscar Lambret Center (COL, France) using several commercially available detectors as well as using two passive dosimeters (EBT2 radiochromic film and micro-LiF TLD-700). The primary aim of the present work was to determine by Monte Carlo calculations the output factor in water (OF{sub MC,w}) and the k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} correction factors. The secondary aim was to study the detector response in small beams using Monte Carlomore » simulation. Methods: The LINAC head of the CyberKnife{sup ®} was modeled using the PENELOPE Monte Carlo code system. The primary electron beam was modeled using a monoenergetic source with a radial gaussian distribution. The model was adjusted by comparisons between calculated and measured lateral profiles and tissue-phantom ratios obtained with the largest field. In addition, the PTW 60016 and 60017 diodes, PTW 60003 diamond, and micro-LiF were modeled. Output ratios with modeled detectors (OR{sub MC,det}) and OF{sub MC,w} were calculated and compared to measurements, in order to validate the model for smallest fields and to calculate k{sub Q{sub c{sub l{sub i{sub n,Q{sub m{sub s{sub r}{sup f{sub c}{sub l}{sub i}{sub n},f{sub m}{sub s}{sub r}}}}}}}}} correction factors, respectively. For the study of the influence of detector characteristics on their response in small beams; first, the impact of the atomic composition and the mass density of silicon, LiF, and diamond materials were investigated; second, the material, the volume averaging, and the coating effects of detecting material on the detector responses were estimated. Finally, the influence of the size of silicon chip on diode response was investigated. Results: Looking at measurement ratios (uncorrected output factors) compared to the OF{sub MC,w}, the PTW
Noh, Jaesung; Lee, Kun Mo
2003-05-01
A relative significance factor (f(i)) of an impact category is the external weight of the impact category. The objective of this study is to propose a systematic and easy-to-use method for the determination of f(i). Multiattribute decision-making (MADM) methods including the analytical hierarchy process (AHP), the rank-order centroid method, and the fuzzy method were evaluated for this purpose. The results and practical aspects of using the three methods are compared. Each method shows the same trend, with minor differences in the value of f(i). Thus, all three methods can be applied to the determination of f(i). The rank order centroid method reduces the number of pairwise comparisons by placing the alternatives in order, although it has inherent weakness over the fuzzy method in expressing the degree of vagueness associated with assigning weights to criteria and alternatives. The rank order centroid method is considered a practical method for the determination of f(i) because it is easier and simpler to use compared to the AHP and the fuzzy method.
The F(N) method for the one-angle radiative transfer equation applied to plant canopies
NASA Technical Reports Server (NTRS)
Ganapol, B. D.; Myneni, R. B.
1992-01-01
The paper presents a semianalytical solution method, called the F(N) method, for the one-angle radiative transfer equation in slab geometry. The F(N) method is based on two integral equations specifying the intensities exiting the boundaries of the vegetation canopy; the solution is obtained through an expansion in a set of basis functions with expansion coefficients to be determined. The advantage of this method is that it avoids spatial truncation error entirely because it requires discretization only in the angular variable.
Federal Register 2010, 2011, 2012, 2013, 2014
2013-09-27
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-53-2013] Subzone 9F, Authorization of Production Activity, The Gas Company, LLC dba Hawai'i Gas, (Synthetic Natural Gas), Kapolei, Hawaii On May 22, 2013, The Gas Company, LLC dba Hawai'i Gas submitted a notification of proposed production activity to...
The role of fMRI in cognitive neuroscience: where do we stand?
Poldrack, Russell A
2008-04-01
Functional magnetic resonance imaging (fMRI) has quickly become the most prominent tool in cognitive neuroscience. In this article, I outline some of the limits on the kinds of inferences that can be supported by fMRI, focusing particularly on reverse inference, in which the engagement of specific mental processes is inferred from patterns of brain activation. Although this form of inference is weak, newly developed methods from the field of machine learning offer the potential to formalize and strengthen reverse inferences. I conclude by discussing the increasing presence of fMRI results in the popular media and the ethical implications of the increasing predictive power of fMRI.
Federal Register 2010, 2011, 2012, 2013, 2014
2012-01-24
... DEPARTMENT OF HOMELAND SECURITY U.S. Citizenship and Immigration Services Agency Information...). The Department of Homeland Security, U.S. Citizenship and Immigration Services (USCIS) will be... Department of Homeland Security sponsoring the collection: Form I-129F. U.S. Citizenship and Immigration...
Rauch, Michael; Ruccolo, Serge; Mester, John Paul; Rong, Yi; Parkin, Gerard
2016-01-01
The bulky tris(3- tert -butyl-5-pyrazolyl)hydroborato ligand, [Tp Bu t ,Me ], has been employed to obtain the first structurally characterized example of a molecular magnesium compound that features a terminal fluoride ligand, namely [Tp Bu t ,Me ]MgF, via the reaction of [Tp Bu t ,Me ]MgMe with Me 3 SnF. The chloride, bromide and iodide complexes, [Tp Bu t ,Me ]MgX (X = Cl, Br, I), can also be obtained by an analogous method using Me 3 SnX. The molecular structures of the complete series of halide derivatives, [Tp Bu t ,Me ]MgX (X = F, Cl, Br, I) have been determined by X-ray diffraction. In each case, the Mg-X bond lengths are shorter than the sum of the covalent radii, thereby indicating that there is a significant ionic component to the bonding, in agreement with density functional theory calculations. The fluoride ligand of [Tp Bu t ,Me ]MgF undergoes halide exchange with Me 3 SiX (X = Cl, Br, I) to afford [Tp Bu t ,Me ]MgX and Me 3 SiF. The other halide derivatives [Tp Bu t ,Me ]MgX undergo similar exchange reactions, but the thermodynamic driving forces are much smaller than those involving fluoride transfer, a manifestation of the often discussed silaphilicity of fluorine. In accord with the highly polarized Mg-F bond, the fluoride ligand of [Tp Bu t ,Me ]MgF is capable of serving as a hydrogen bond and halogen bond acceptor, such that it forms adducts with indole and C 6 F 5 I. [Tp Bu t ,Me ]MgF also reacts with Ph 3 CCl to afford Ph 3 CF, thereby demonstrating that [Tp Bu t ,Me ]MgF may be used to form C-F bonds.
Han, Hyemin; Glenn, Andrea L
2018-06-01
In fMRI research, the goal of correcting for multiple comparisons is to identify areas of activity that reflect true effects, and thus would be expected to replicate in future studies. Finding an appropriate balance between trying to minimize false positives (Type I error) while not being too stringent and omitting true effects (Type II error) can be challenging. Furthermore, the advantages and disadvantages of these types of errors may differ for different areas of study. In many areas of social neuroscience that involve complex processes and considerable individual differences, such as the study of moral judgment, effects are typically smaller and statistical power weaker, leading to the suggestion that less stringent corrections that allow for more sensitivity may be beneficial and also result in more false positives. Using moral judgment fMRI data, we evaluated four commonly used methods for multiple comparison correction implemented in Statistical Parametric Mapping 12 by examining which method produced the most precise overlap with results from a meta-analysis of relevant studies and with results from nonparametric permutation analyses. We found that voxelwise thresholding with familywise error correction based on Random Field Theory provides a more precise overlap (i.e., without omitting too few regions or encompassing too many additional regions) than either clusterwise thresholding, Bonferroni correction, or false discovery rate correction methods.
Colorado Even Start. 1998-1999 Progress Report.
ERIC Educational Resources Information Center
Anderson, Beckie
Even Start programs integrate early childhood education, adult literacy or basic education, parenting education and support, and parent and child time to help break the cycle of poverty and illiteracy. This report describes the Even Start program in Colorado, and includes evaluation questions and methods. The report presents evaluation findings…
Colorado Even Start. 1997-1998 Progress Report.
ERIC Educational Resources Information Center
Anderson, Beckie
Even Start programs integrate early childhood education, adult literacy or basic education, parenting education and support, and parent and child time together to help break the cycle of poverty and illiteracy. This report describes the Even Start program in Colorado, including evaluation questions and methods. The report also presents evaluation…
Later Start, Longer Sleep: Implications of Middle School Start Times.
Temkin, Deborah A; Princiotta, Daniel; Ryberg, Renee; Lewin, Daniel S
2018-05-01
Although adolescents generally get less than the recommended 9 hours of sleep per night, research and effort to delay school start times have generally focused on high schools. This study assesses the relation between school start times and sleep in middle school students while accounting for potentially confounding demographic variables. Seventh and eighth grade students attending 8 late starting schools (∼8:00 am, n = 630) and 3 early starting schools (∼7:23 am, n = 343) from a diverse suburban school district completed online surveys about their sleep behaviors. Doubly robust inverse probability of treatment weighted regression estimates of the effects of later school start time on student bedtimes, sleep duration, and daytime sleepiness were generated. Attending a school starting 37 minutes later was associated with an average of 17 additional minutes of sleep per weeknight, despite an average bedtime 15 minutes later. Students attending late starting schools were less sleepy than their counterparts in early starting schools, and more likely to be wide awake. Later school start times were significantly associated with improved sleep outcomes for early adolescents, providing support for the movement to delay school start times for middle schools. © 2018, American School Health Association.
HF-START: A Regional Radio Propagation Simulator
NASA Astrophysics Data System (ADS)
Hozumi, K.; Maruyama, T.; Saito, S.; Nakata, H.; Rougerie, S.; Yokoyama, T.; Jin, H.; Tsugawa, T.; Ishii, M.
2017-12-01
HF-START (HF Simulator Targeting for All-users' Regional Telecommunications) is a user-friendly simulator developed to meet the needs of space weather users. Prediction of communications failure due to space weather disturbances is of high priority. Space weather users from various backgrounds with high economic impact, i.e. airlines, telecommunication companies, GPS-related companies, insurance companies, international amateur radio union, etc., recently increase. Space weather information provided by Space Weather Information Center of NICT is, however, too professional to be understood and effectively used by the users. To overcome this issue, I try to translate the research level data to the user level data based on users' needs and provide an immediate usable data. HF-START is positioned to be a space weather product out of laboratory based truly on users' needs. It is originally for radio waves in HF band (3-30 MHz) but higher frequencies up to L band are planned to be covered. Regional ionospheric data in Japan and southeast Asia are employed as a reflector of skywave mode propagation. GAIA (Ground-to-topside model of Atmosphere and Ionosphere for Aeronomy) model will be used as ionospheric input for global simulation. To evaluate HF-START, an evaluation campaign for Japan region will be launched in coming months. If the campaign successes, it will be expanded to southeast Asia region as well. The final goal of HF-START is to provide the near-realtime necessary radio parameters as well as the warning message of radio communications failure to the radio and space weather users.
Wang, Lin; Sun, Hongjian; Li, Xiaoyan; Fuhr, Olaf; Fenske, Dieter
2016-11-15
The selective activation of the C-F bonds in substituted (2,6-difluorophenyl)phenylimines (2,6-F 2 H 3 C 6 -(C[double bond, length as m-dash]NH)-n'-R-C 6 H 4 (n' = 2, R = H (1); n' = 2, R = Me (2); n' = 4, R = tBu (3))) by Fe(PMe 3 ) 4 with an auxiliary strong Lewis acid (LiBr, LiI, or ZnCl 2 ) was explored. As a result, iron(ii) halides ((H 5 C 6 -(C[double bond, length as m-dash]NH)-2-FH 3 C 6 )FeX(PMe 3 ) 3 (X = Br (8); Cl (9)) and (n-RH 4 C 6 -(C[double bond, length as m-dash]NH)-2'-FH 3 C 6 )FeX(PMe 3 ) 3 (n = 2, R = Me, X = Br (11); n = 4, R = tBu, X = I (12))) were obtained. Under similar reaction conditions, using LiBF 4 instead of LiBr or ZnCl 2 , the reaction of (2,6-difluorophenyl)phenylimine with Fe(PMe 3 ) 4 afforded an ionic complex [(2,6-F 2 H 3 C 6 -(C[double bond, length as m-dash]NH)-H 4 C 6 )Fe(PMe 3 ) 4 ](BF 4 ) (10) via the activation of a C-H bond. The method of C-F bond activation with an auxiliary strong Lewis acid is appropriate for monofluoroarylmethanimines. Without the Lewis acid, iron(ii) hydrides ((2-RH 4 C 6 -(C[double bond, length as m-dash]NH)-2'-FH 3 C 6 )FeH(PMe 3 ) 3 (R = H (13); Me (14))) were generated from the reactions of Fe(PMe 3 ) 4 with the monofluoroarylmethanimines (2-FH 4 C 6 -(C[double bond, length as m-dash]NH)-2'-RC 6 H 4 (R = H (4); Me (5))); however, in the presence of ZnCl 2 or LiBr, iron(ii) halides ((2-RH 4 C 6 -(C[double bond, length as m-dash]NH)-H 4 C 6 )FeX(PMe 3 ) 3 (R = H, X = Cl (15); R = Me, X = Br (16))) could be obtained through the activation of a C-F bond. Furthermore, a C-F bond activation with good regioselectivity in (pentafluorophenyl)arylmethanimines (F 5 C 6 -(C[double bond, length as m-dash]NH)-2,6-Y 2 C 6 H 3 (Y = F (6); H (7))) could be realized in the presence of ZnCl 2 to produce iron(ii) chlorides ((2,6-Y 2 H 3 C 6 -(C[double bond, length as m-dash]NH)-F 4 C 6 )FeCl(PMe 3 ) 3 (Y = F (17); H (18))). This series of iron(ii) halides could be used to catalyze the hydrosilylation reaction of
ERIC Educational Resources Information Center
Collins, Raymond C.; Anderson, Penny R.
The purpose of this guide is to amplify the specific issues concerning substance abuse which Head Start grantees need to address, and to suggest resources and strategies to respond to these issues. The guide consists of five chapters, a bibliography, and two appendixes. An introduction (chapter I) discusses the problem of substance abuse and the…
Method and apparatus for rapid stopping and starting of a thermoacoustic engine
Swift, Gregory W.; Backhaus, Scott N.; Gardner, David L.
2003-11-11
A thermoacoustic engine-driven system with a hot heat exchanger, a regenerator or stack, and an ambient heat exchanger includes a side branch load for rapid stopping and starting, the side branch load being attached to a location in the thermoacoustic system having a nonzero oscillating pressure and comprising a valve, a flow resistor, and a tank connected in series. The system is rapidly stopped simply by opening the valve and rapidly started by closing the valve.
Sensorless Sinusoidal Drives for Fan and Pump Motors by V/f Control
NASA Astrophysics Data System (ADS)
Kiuchi, Mitsuyuki; Ohnishi, Tokuo
This paper proposes sensorless sinusoidal driving methods of permanent magnet synchronous motors for fans and pumps by V/f control. The proposed methods are simple methods that control the motor peak current constant by voltage or frequency control, and are characterized by DC link current detection using a single shunt resistor at carrier wave signal bottom timing. As a result of the dumping factor from square torque load characteristics of fan and pump motors, it is possible to control stable starting and stable steady state by V/f control. In general, pressure losses as a result of the fluid pass of fan and pump systems are nearly constant; therefore, the flow rate and motor torque are determined by revolutions. Accordingly, high efficiency driving is possible by setting corresponding currents to q-axis currents (torque currents) at target revolutions. Because of the simple current detection and motor control methods, the proposed methods are optimum for fan and pump motor driving systems of home appliances.
Storrie-Lombardi, Michael C; Sattler, Birgit
2009-09-01
Laser-induced fluorescence emission (L.I.F.E.) images were obtained in situ following 532 nm excitation of cryoconite assemblages in the ice covers of annual and perennially frozen Antarctic lakes during the 2008 Tawani International Expedition to Schirmacher Oasis and Lake Untersee in Dronning Maud Land, Antarctica. Laser targeting of a single millimeter-scale cryoconite results in multiple neighboring excitation events secondary to ice/air interface reflection and refraction in the bubbles surrounding the primary target. Laser excitation at 532 nm of cyanobacteria-dominated assemblages produced red and infrared autofluorescence activity attributed to the presence of phycoerythrin photosynthetic pigments. The method avoids destruction of individual target organisms and does not require the disruption of either the structure of the microbial community or the surrounding ice matrix. L.I.F.E. survey strategies described may be of interest for orbital monitoring of photosynthetic primary productivity in polar and alpine glaciers, ice sheets, snow, and lake ice of Earth's cryosphere. The findings open up the possibility of searching from either a rover or from orbit for signs of life in the polar regions of Mars and the frozen regions of exoplanets in neighboring star systems.
Lessons learned from starting Rochester Precision Optics
NASA Astrophysics Data System (ADS)
Hurley, William P.
2014-12-01
Thank you very much for coming to attend this talk. I see a few familiar faces in the crowd that have had their own journeys, and if you're thinking of starting your own optics business, this is not the authoritative talk on how to do. It's just a talk on what I've learned from my journey and some of my own stories on Lessons Learned. It does tie into some of the previous talks, and I do give credit to some mentors. The developments I've been involved with do make use of the ability to adapt and change, and there have been Bumps in the Road here and there, and I'll tell you a little bit more about that during this Talk.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Ahunbay, Ergun E., E-mail: eahunbay@mcw.edu; Ates,
Purpose: In a situation where a couch shift for patient positioning is not preferred or prohibited (e.g., MR-linac), segment aperture morphing (SAM) can address target dislocation and deformation. For IMRT/VMAT with flattening-filter-free (FFF) beams, however, SAM method would lead to an adverse translational dose effect due to the beam unflattening. Here the authors propose a new two-step process to address both the translational effect of FFF beams and the target deformation. Methods: The replanning method consists of an offline and an online step. The offline step is to create a series of preshifted-plans (PSPs) obtained by a so-called “warm start”more » optimization (starting optimization from the original plan, rather than from scratch) at a series of isocenter shifts. The PSPs all have the same number of segments with very similar shapes, since the warm start optimization only adjusts the MLC positions instead of regenerating them. In the online step, a new plan is obtained by picking the closest PSP or linearly interpolating the MLC positions and the monitor units of the closest PSPs for the shift determined from the image of the day. This two-step process is completely automated and almost instantaneous (no optimization or dose calculation needed). The previously developed SAM algorithm is then applied for daily deformation. The authors tested the method on sample prostate and pancreas cases. Results: The two-step interpolation method can account for the adverse dose effects from FFF beams, while SAM corrects for the target deformation. Plan interpolation method is effective in diminishing the unflat beam effect and may allow reducing the required number of PSPs. The whole process takes the same time as the previously reported SAM process (5–10 min). Conclusions: The new two-step method plus SAM can address both the translation effects of FFF beams and target deformation, and can be executed in full automation except the delineation of target
1992-04-01
Colonel Richard J. Barringer , USAF The Industrial College of the Armed Forces National Defense University Fort McNair, Washington, D.C. 20319-6000 93...Executive Research Project A94 START II Frame Work Lieutenant Colonel Donald E. Belche U.S. Air Force Faculty Research Advisor Colonel Richard J. Barringer ...1,659 - 3,456 0.48 Bombers 0.11 x 4,208 = 463 - 1,100 = 0.42 Total 9,064 2,248 - 5,956 = 0.38 charts 12 and 13 28 CHART 14 U.§ IA~aI ULA QC TU R AFTER 5
Comparison of analytical methods of brain [18F]FDG-PET after severe traumatic brain injury.
Madsen, Karine; Hesby, Sara; Poulsen, Ingrid; Fuglsang, Stefan; Graff, Jesper; Larsen, Karen B; Kammersgaard, Lars P; Law, Ian; Siebner, Hartwig R
2017-11-01
Loss of consciousness has been shown to reduce cerebral metabolic rates of glucose (CMRglc) measured by brain [ 18 F]FDG-PET. Measurements of regional metabolic patterns by normalization to global cerebral metabolism or cerebellum may underestimate widespread reductions. The aim of this study was to compare quantification methods of whole brain glucose metabolism, including whole brain [18F]FDG uptake normalized to uptake in cerebellum, normalized to injected activity, normalized to plasma tracer concentration, and two methods for estimating CMRglc. Six patients suffering from severe traumatic brain injury (TBI) and ten healthy controls (HC) underwent a 10min static [ 18 F]FDG-PET scan and venous blood sampling. Except from normalizing to cerebellum, all quantification methods found significant lower level of whole brain glucose metabolism of 25-33% in TBI patients compared to HC. In accordance these measurements correlated to level of consciousness. Our study demonstrates that the analysis method of the [ 18 F]FDG PET data has a substantial impact on the estimated whole brain cerebral glucose metabolism in patients with severe TBI. Importantly, the SUVR method which is often used in a clinical setting was not able to distinguish patients with severe TBI from HC at the whole-brain level. We recommend supplementing a static [ 18 F]FDG scan with a single venous blood sample in future studies of patients with severe TBI or reduced level of consciousness. This can be used for simple semi-quantitative uptake values by normalizing brain activity uptake to plasma tracer concentration, or quantitative estimates of CMRglc. Copyright © 2017 Elsevier B.V. All rights reserved.
: gray bar STARTING When the vehicle is started, the gasoline engine "warms up." If necessary assists the gasoline engine when additional power is needed. It also acts as a generator, converting also starts the gasoline engine instantly when needed. Main stage: See through car with battery, engine
Learnings from an Entrepreneur: How to Start a Consulting Practice
NASA Astrophysics Data System (ADS)
Bowes, Debra
2013-03-01
There are important basic learnings I have experienced in starting my own consulting practice over 7 years ago. These learnings will help you maximize your value, reduce competition and build your reputation and business income. I believe these can apply to many fields but certainly for the Life Sciences. A few of the basic I will cover are
Von Start-ups lernen - Methoden und Entwicklungsprozesse, die Jungunternehmen erfolgreich machen
NASA Astrophysics Data System (ADS)
Böhme, Eckhart
Die Start-up-Bewegung bringt beständig sog. Disruptoren hervor, die jede Branche betreffen und so gut wie keinen Lebensbereich auslassen. Diese Jungunternehmen, insbesondere aus der Softwarebranche, verfügen zwar nicht über Ressourcen wie etablierte Unternehmen, sie sind jedoch agil, "hungrig", können frei von "Ballast" agieren und treiben die Digitalisierung aller Branchen voran. Aber auch Start-ups können nicht einfach ungetestete Ideen in erfolgreiche Produkte oder Dienstleistungen umwandeln und ihren Erfolg dem Zufall überlassen. Erfolgreiche Jungunternehmen folgen vielmehr einem strukturierten Prozess, um marktgetestete Nutzenversprechen und Geschäftsmodelle zu entwickeln. Zunehmend adaptieren etablierte Unternehmen innovative Entwicklungsprozesse und Methoden. Die Fragestellung für Energieversorgungsunternehmen (EVUs) lautet, welche Methoden, Werkzeuge und Entwicklungsprozesse, die heute bei vielen Start-ups eingesetzt werden, sie aufgreifen können, um das Unternehmen gegenüber Disruptoren robust zu machen?
Linear regression models and k-means clustering for statistical analysis of fNIRS data.
Bonomini, Viola; Zucchelli, Lucia; Re, Rebecca; Ieva, Francesca; Spinelli, Lorenzo; Contini, Davide; Paganoni, Anna; Torricelli, Alessandro
2015-02-01
We propose a new algorithm, based on a linear regression model, to statistically estimate the hemodynamic activations in fNIRS data sets. The main concern guiding the algorithm development was the minimization of assumptions and approximations made on the data set for the application of statistical tests. Further, we propose a K-means method to cluster fNIRS data (i.e. channels) as activated or not activated. The methods were validated both on simulated and in vivo fNIRS data. A time domain (TD) fNIRS technique was preferred because of its high performances in discriminating cortical activation and superficial physiological changes. However, the proposed method is also applicable to continuous wave or frequency domain fNIRS data sets.
Comprehensive theoretical studies on the low-lying electronic states of NiF, NiCl, NiBr, and NiI.
Zou, Wenli; Liu, Wenjian
2006-04-21
The low-lying electronic states of the nickel monohalides, i.e., NiF, NiCl, NiBr, and NiI, are investigated by using multireference second-order perturbation theory with relativistic effects taken into account. For the energetically lowest 11 lambda-S states and 26 omega states there into, the potential energy curves and corresponding spectroscopic constants (vertical and adiabatic excitation energies, equilibrium bond lengths, vibrational frequencies, and rotational constants) are reported. The calculated results are grossly in very good agreement with those solid experimental data. In particular, the ground state of NiI is shown to be different from those of NiF, NiCl, and NiBr, being in line with the recent experimental observation. Detailed analyses are provided on those states that either have not been assigned or have been incorrectly assigned by previous experiments.
Smith, Fran; Banwell, Elizabeth; Rakhit, Roby
2017-09-01
A qualitative design was used to explore the experience of positive adjustment following a heart attack. Ten men attending a cardiac rehabilitation programme completed in-depth semi-structured interviews. An overarching theme: 'I was in control of it from the start' emerged with six subthemes, relating to intrapersonal and interpersonal factors and processes. The subthemes reflected the importance of identifying controllable versus non-controllable factors and employing adaptive coping strategies.
Backup control airstart performance on a digital electronic engine control-equipped F100-engine
NASA Technical Reports Server (NTRS)
Johnson, J. B.
1984-01-01
The air start capability of a backup control (BUC) was tested for a digital electronic engine control (DEEC) equipped F100 engine, which was installed in an F-15 aircraft. Two air start schedules were tested. Using the group 1 start schedule, based on a 40 sec timer, an air speed of 300 knots was required to ensure successful 40 and 25% BUC mode spooldown airstarts. If core rotor speed (N2) was less than 40% a stall would occur when the start bleed closed, 40 sec after initiation of the air start. All jet fuel starter (JFS) assisted air starts were successful with the group 1 start schedule. For the group 2 schedule, the time between pressurization and start bleed closure ranged between 50 sec and 72 sec. Idle rps was lower than the desired 65% for air starts at higher altitudes and lower air speeds.
AURKA F31I Polymorphism and Breast Cancer Risk in BRCA1 and BRCA2 Mutation Carriers: A CIMBA study
Couch, Fergus J.; Sinilnikova, Olga; Vierkant, Robert A; Pankratz, V. Shane; Fredericksen, Zachary S.; Stoppa-Lyonnet, Dominique; Coupier, Isabelle; Hughes, David; Hardouin, Agnès; Berthet, Pascaline; Peock, Susan; Cook, Margaret; Baynes, Caroline; Hodgson, Shirley; Morrison, Patrick J.; Porteous, Mary E.; Jakubowska, Anna; Lubinski, Jan; Gronwald, Jacek; Spurdle, Amanda B.; Schmutzler, Rita; Versmold, Beatrix; Engel, Christoph; Meindl, Alfons; Sutter, Christian; Horst, Jurgen; Schaefer, Dieter; Offit, Kenneth; Kirchhoff, Tomas; Andrulis, Irene L.; Ilyushik, Eduard; Glendon, Gordon; Devilee, Peter; Vreeswijk, Maaike P.G.; Vasen, Hans F.A.; Borg, Ake; Backenhorn, Katja; Struewing, Jeffery P.; Greene, Mark H.; Neuhausen, Susan L.; Rebbeck, Timothy R.; Nathanson, Katherine; Domchek, Susan; Wagner, Theresa; Garber, Judy E.; Szabo, Csilla; Zikan, Michal; Foretova, Lenka; Olson, Janet E.; Sellers, Thomas A.; Lindor, Noralane; Nevanlinna, Heli; Tommiska, Johanna; Aittomaki, Kristiina; Hamann, Ute; Rashid, Muhammad U.; Torres, Diana; Simard, Jacques; Durocher, Francine; Guenard, Frederic; Lynch, Henry T.; Isaacs, Claudine; Weitzel, Jeffrey; Olopade, Olufunmilayo I.; Narod, Steven; Daly, Mary B.; Godwin, Andrew K.; Tomlinson, Gail; Easton, Douglas F.; Chenevix-Trench, Georgia; Antoniouon, Antonis C.
2009-01-01
The AURKA oncogene is associated with abnormal chromosome segregation and aneuploidy and predisposition to cancer. Amplification of AURKA has been detected at higher frequency in tumors from BRCA1 and BRCA2 mutation carriers than in sporadic breast tumors, suggesting that overexpression of AURKA and inactivation of BRCA1 and BRCA2 co-operate during tumor development and progression. The F31I polymorphism in AURKA has been associated with breast cancer risk in the homozygous state in prior studies. We evaluated whether the AURKA F31I polymorphism modifies breast cancer risk in BRCA1 and BRCA2 mutation carriers from the Consortium of Investigators of Modifiers of BRCA1/2 (CIMBA). CIMBA was established to provide sufficient statistical power through increased numbers of mutation carriers to identify polymorphisms that act as modifiers of cancer risk and can refine breast cancer risk estimates in BRCA1 and BRCA2 mutation carriers. A total of 4935 BRCA1 and 2241 BRCA2 mutation carriers and 11 individuals carrying both BRCA1 and BRCA2 mutations were genotyped for F31I. Overall, homozygosity for the 31I allele was not significantly associated with breast cancer risk in BRCA1 and BRCA2 carriers combined (HR = 0.91; 95% CI 0.77-1.06). Similarly, no significant association was seen in BRCA1 (HR = 0.90; 95% CI 0.75-1.08) or BRCA2 carriers (HR = 0.93; 95% CI 0.67-1.29) or when assessing the modifying effects of either bilateral prophylactic oophorectomy or menopausal status of BRCA1 and BRCA2 carriers. In summary, the F31I polymorphism in AURKA is not associated with a modified risk of breast cancer in BRCA1 and BRCA2 carriers. PMID:17627006
The Project L.I.F.T. Story: Early Lessons from a Public-Private Education Turnaround Initiative
ERIC Educational Resources Information Center
Kim, Juli; Ellison, Shonaka
2015-01-01
Leading Charlotte foundations formed a funding collaborative to support a five-year district turnaround initiative to dramatically improve educational outcomes for students in the West Charlotte High School corridor, one of the city's lowest-performing feeder zones. The "Project L.I.F.T." initiative involves four areas of education…
Rosal, Milagros C; Haughton, Christina F; Estabrook, Barbara B; Wang, Monica L; Chiriboga, Germán; Nguyen, Oahn H T; Person, Sharina D; Lemon, Stephenie C
2016-09-09
Overweight and obesity are prevalent among young women and are greater among minority and low-income women. The postpartum period is critical in women's weight trajectories as many women do not lose their pregnancy weight, and others lose some and then plateau or experience weight gain. Excess weight puts women at greater risk of chronic disease and thus weight loss in the postpartum period may be key to the long-term health of young women. This paper describes the design and methods of a randomized clinical trial of Fresh Start, an innovative narrative-based group intervention aimed at promoting postpartum weight loss among low-income, diverse women. Study participants were recruited from the five sites of the Women, Infants and Children (WIC) program in central Massachusetts. Participants were English-speaking, age ≥ 18 years, 6 weeks to 6 months postpartum, with a body mass index (BMI) ≥ 27 kg/m(2). The Fresh Start postpartum weight loss intervention, adapted from the Diabetes Prevention Program (DPP) in collaboration with WIC staff and clients, consisted of an 8-week group-based curriculum followed by nine monthly telephone calls. It included a narrative component (i.e., storytelling), group discussions, print materials and access to exercise facilities. The study is a two-arm randomized controlled trial. The control condition included print materials and access to exercise facilities. In-person assessments were conducted at baseline and at 6 and 12 months following the eight-week intervention phase. The Fresh Start intervention translated key elements of an evidence-based weight loss protocol into a format that is hypothesized to be relevant, acceptable and effective for the target audience of low-SES postpartum women. This novel intervention was developed in collaboration with WIC to be sustainable within the context of its clinics, which reach approximately 9 million individuals per year across the U.S. via 10,000 clinics. clinicaltrials
DOE Office of Scientific and Technical Information (OSTI.GOV)
Stavrou, Elissaios, E-mail: stavrou1@llnl.gov; Lawrence Livermore National Laboratory, Physical and Life Sciences Directorate, P.O. Box 808 L-350, Livermore, California 94550; Zaug, Joseph M., E-mail: zaug1@llnl.gov
Pressure dependent angle-dispersive x-ray powder diffraction measurements of alpha-phase aluminum trifluoride (α-AlF{sub 3}) and separately, aluminum triiodide (AlI{sub 3}) were conducted using a diamond-anvil cell. Results at 295 K extend to 50 GPa. The equations of state of AlF{sub 3} and AlI{sub 3} were determined through refinements of collected x-ray diffraction patterns. The respective bulk moduli and corresponding pressure derivatives are reported for multiple orders of the Birch-Murnaghan (B-M), finite-strain (F-f), and higher pressure finite-strain (G-g) EOS analysis models. Aluminum trifluoride exhibits an apparent isostructural phase transition at approximately 12 GPa. Aluminum triiodide also undergoes a second-order atomic rearrangement: appliedmore » stress transformed a monoclinically distorted face centered cubic (fcc) structure into a standard fcc structural arrangement of iodine atoms. Results from semi-empirical thermochemical computations of energetic materials formulated with fluorine containing reactants were obtained with the aim of predicting the yield of halogenated products.« less
1986-06-06
Washington D.C.: Office of Air Force History, 1978), pp. 234, 241, 254, ?59. 3 Knaack, Post- Worl -g War 11 Fighters, p. 254. 7 CHAPTER 2 HISTORICAL...The F-IlIA in Southeast Asia: 19 Second Deployment The F-I11B 22 The F-111C 25 The F-1111 25 The F-1IE 30 The F-1I1F 33 iv...Sortie 98 3-13 Maintenance Plan / Scheduling Effectiveness 99 3-14 War Readiness Spares Kit (WRSK) Fill Rate 99 3-15 WRSK / BLSS Withdrawals 100 3-16
Mining the protein data bank with CReF to predict approximate 3-D structures of polypeptides.
Dorn, Márcio; de Souza, Osmar Norberto
2010-01-01
n this paper we describe CReF, a Central Residue Fragment-based method to predict approximate 3-D structures of polypeptides by mining the Protein Data Bank (PDB). The approximate predicted structures are good enough to be used as starting conformations in refinement procedures employing state-of-the-art molecular mechanics methods such as molecular dynamics simulations. CReF is very fast and we illustrate its efficacy in three case studies of polypeptides whose sizes vary from 34 to 70 amino acids. As indicated by the RMSD values, our initial results show that the predicted structures adopt the expected fold, similar to the experimental ones.
1976-02-01
8217-i~ ", i " ’ im i-II U BAKED BEEF WITH NOODLS 1i1 Yield: 100 Portions Each Portion: 8 ounces Ingredients Pounds Grams Procedure Beef, boneless, diced...simmer for approxi- mately 1 hour. Noodles , dry 4.00 1,816 2. Approximately * hour prior to completion of beef cook, start cooking noodles in a separate...tap 27.00 12,260 ture thickens (cook 15 minutes). 4. Add noodles from step 2; mix well and adjust volume to 7.8 gallons. Heat to 180 F.*2 5. Weigh 8
DOE Office of Scientific and Technical Information (OSTI.GOV)
Senekowitsch, R.; Maul, F.D.; Wenisch, H.J.C.
1985-05-01
In the present study radioiodinated F(ab')/sub 2/-fragments of CA19-9 and antibody that reacts specifically with human gastrointestinal cancer were examined for their ability to detect human pancreatic carcinoma hosted in nude mice. Tumor-bearing mice received 80..mu..Ci of I-131-F(ab')/sub 2/ with a specific activity of 1.8..mu..Ci/..mu..g. All mice were imaged after the injection and every 24hr up to 6 days. The retained radioactivity was also registered with a whole-body counter immediately after imaging. As a control F(ab's)/sub 2/ of a nonspecific antibody were administered in parallel to another group of animals bearing the same tumor. Three animals of each group weremore » killed at 1,2,4 and 8 days for determination of the distribution of both labeled antibody-fragments. On scintigraphic images obtained with the CA19-9-F(ab')/sub 2/ the tumors could be visualized 24hr after injection, the best dilineation however was achieved 96hr p.i.. The biodistribution data exhibited a more rapid blood clearance for the specific fragments compared to that for the unspecific ones. Tumors showed an increase in uptake up to 48hr reaching 1.7% of the injected dose per gram, declining to values of 0.08%/g at day 6 p.i.. The highest tumor-to-blood ratios were found after 96h. They were 7 for the CA19-9-fragments compared to 1.5 for the unspecific fragments. The whole body counting revealed a more rapid excretion for the fragments of the specific monoclonal antibodies than for the unspecific ones. In summary the authors were able to show that CA19-9-F(ab')/sub 2/-fragments can be used for immunodetection of human pancreatic carcinoma hosted in nude mice.« less
Permanent electric dipole moments of PtX (X = H, F, Cl, Br, and I) by the composite approach
NASA Astrophysics Data System (ADS)
Deng, Dan; Lian, Yongqin; Zou, Wenli
2017-11-01
Using the FPD composite approach of Peterson et. al. we calculate the permanent electric dipole moments of PtX (X = H, F, Cl, Br, and I) at the equilibrium geometries of their ground states. The dipole moment of PtF is estimated to be 3.421 Debye, being very close to the experimental value of 3.42(6) Debye. This research also suggests the ordering of dipole moments of PtX being proportional to the electronegativity of X.
Spacer capture and integration by a type I-F Cas1-Cas2-3 CRISPR adaptation complex.
Fagerlund, Robert D; Wilkinson, Max E; Klykov, Oleg; Barendregt, Arjan; Pearce, F Grant; Kieper, Sebastian N; Maxwell, Howard W R; Capolupo, Angela; Heck, Albert J R; Krause, Kurt L; Bostina, Mihnea; Scheltema, Richard A; Staals, Raymond H J; Fineran, Peter C
2017-06-27
CRISPR-Cas adaptive immune systems capture DNA fragments from invading bacteriophages and plasmids and integrate them as spacers into bacterial CRISPR arrays. In type I-E and II-A CRISPR-Cas systems, this adaptation process is driven by Cas1-Cas2 complexes. Type I-F systems, however, contain a unique fusion of Cas2, with the type I effector helicase and nuclease for invader destruction, Cas3. By using biochemical, structural, and biophysical methods, we present a structural model of the 400-kDa Cas1 4 -Cas2-3 2 complex from Pectobacterium atrosepticum with bound protospacer substrate DNA. Two Cas1 dimers assemble on a Cas2 domain dimeric core, which is flanked by two Cas3 domains forming a groove where the protospacer binds to Cas1-Cas2. We developed a sensitive in vitro assay and demonstrated that Cas1-Cas2-3 catalyzed spacer integration into CRISPR arrays. The integrase domain of Cas1 was necessary, whereas integration was independent of the helicase or nuclease activities of Cas3. Integration required at least partially duplex protospacers with free 3'-OH groups, and leader-proximal integration was stimulated by integration host factor. In a coupled capture and integration assay, Cas1-Cas2-3 processed and integrated protospacers independent of Cas3 activity. These results provide insight into the structure of protospacer-bound type I Cas1-Cas2-3 adaptation complexes and their integration mechanism.
Seal of transparency heritage in the CISMeF quality-controlled health gateway
Darmoni, SJ; Dahamna, B; Roth-Berghofer, Thomas R
2004-01-01
Background It is an absolute necessity to continually assess the quality of health information on the Internet. Quality-controlled subject gateways are Internet services which apply a selected set of targeted measures to support systematic resource discovery. Methods The CISMeF health gateway became a contributor to the MedCIRCLE project to evaluate 270 health information providers. The transparency heritage consists of using the evaluation performed on providers that are referenced in the CISMeF catalogue for evaluating the documents they publish, thus passing on the transparency label from the publishers to their documents. Results Each site rated in CISMeF has a record in the CISMeF database that generates an RDF into HTML file. The search tool Doc'CISMeF displays information originating from every publisher evaluated with a specific MedCIRCLE button, which is linked to the MedCIRCLE central repository. Starting with 270 websites, this trust heritage has led to 6,480 evaluated resources in CISMeF (49.8% of the 13,012 resources included in CISMeF). Conclusion With the MedCIRCLE project and transparency heritage, CISMeF became an explicit third party. PMID:15367332
Li, Mai Suan; Hu, Chin-Kun; Klimov, Dmitri K.; Thirumalai, D.
2006-01-01
Mechanical folding trajectories for polyproteins starting from initially stretched conformations generated by single-molecule atomic force microscopy experiments [Fernandez, J. M. & Li, H. (2004) Science 303, 1674–1678] show that refolding, monitored by the end-to-end distance, occurs in distinct multiple stages. To clarify the molecular nature of folding starting from stretched conformations, we have probed the folding dynamics, upon force quench, for the single I27 domain from the muscle protein titin by using a Cα-Go model. Upon temperature quench, collapse and folding of I27 are synchronous. In contrast, refolding from stretched initial structures not only increases the folding and collapse time scales but also decouples the two kinetic processes. The increase in the folding times is associated primarily with the stretched state to compact random coil transition. Surprisingly, force quench does not alter the nature of the refolding kinetics, but merely increases the height of the free-energy folding barrier. Force quench refolding times scale as \\documentclass[12pt]{minimal} \\usepackage{amsmath} \\usepackage{wasysym} \\usepackage{amsfonts} \\usepackage{amssymb} \\usepackage{amsbsy} \\usepackage{mathrsfs} \\setlength{\\oddsidemargin}{-69pt} \\begin{document} \\begin{equation*}{\\tau}_{F}\\approx {\\tau}_{F}^{0}{\\mathrm{exp}}(f_{q}{\\Delta}x_{f}/k_{{\\mathrm{B}}}T)\\end{equation*}\\end{document}, where Δxf ≈ 0.6 nm is the location of the average transition state along the reaction coordinate given by end-to-end distance. We predict that τF and the folding mechanism can be dramatically altered by the initial and/or final values of force. The implications of our results for design and analysis of experiments are discussed. PMID:16373511
Motor starting a Brayton cycle power conversion system using a static inverter
NASA Technical Reports Server (NTRS)
Curreri, J. S.; Edkin, R. A.; Kruchowy, R.
1973-01-01
The power conversion module of a 2- to 15-kWe Brayton engine was motor started using a three-phase, 400-hertz static inverter as the power source. Motor-static tests were conducted for initial gas loop pressures of 10, 14, and 17 N/sq cm (15, 20, and 25 psia) over a range of initial turbine inlet temperatures from 366 to 550 K (200 to 530 F). The data are presented to show the effects of temperature and pressure on the motor-start characteristics of the rotating unit. Electrical characteristics during motoring are also discussed.
de Jesus Morales Ramírez, Angel; Hernández, Margarita García; Murillo, Antonieta García; de Jesús Carrillo Romo, Felipe; Palmerin, Joel Moreno; Velazquez, Dulce Yolotzin Medina; Jota, María Luz Carrera
2013-01-01
Lu2O3:Eu3+ transparent, high density, and optical quality thin films were prepared using the sol-gel dip-coating technique, starting with lutetium and europium nitrates as precursors and followed by hydrolysis in an ethanol-ethylene glycol solution. Acetic acid and acetylacetonate were incorporated in order to adjust pH and as a sol stabilizer. In order to increment the thickness of the films and orient the structure, F127 Pluronic acid was incorporated during the sol formation. Structural, morphological, and optical properties of the films were investigated for different F127/Lu molar ratios (0–5) in order to obtain high optical quality films with enhanced thickness compared with the traditional method. X-ray diffraction (XRD) shows that the films present a highly oriented cubic structure <111> beyond 1073 K for a 3-layer film, on silica glass substrates. The thickness, density, porosity, and refractive index evolution of the films were investigated by means of m-lines microscopy along with the morphology by scanning electron microscope (SEM) and luminescent properties. PMID:28809336
Identifying Differences in Early Mathematical Skills among Children in Head Start
ERIC Educational Resources Information Center
Wu, Qiong; Lei, Pui-wa; DiPerna, James C.; Morgan, Paul L.; Reid, Erin E.
2015-01-01
The purpose of this study was to examine early mathematical skill differences among preschool children in US Head Start classrooms. Latent class analysis based on six early mathematical subtest scores (i.e. counting aloud, measurement, counting objects, numbers and shapes, pattern recognition, and grouping) from a sample of 279 Head Start children…
Linear-scaling explicitly correlated treatment of solids: periodic local MP2-F12 method.
Usvyat, Denis
2013-11-21
Theory and implementation of the periodic local MP2-F12 method in the 3*A fixed-amplitude ansatz is presented. The method is formulated in the direct space, employing local representation for the occupied, virtual, and auxiliary orbitals in the form of Wannier functions (WFs), projected atomic orbitals (PAOs), and atom-centered Gaussian-type orbitals, respectively. Local approximations are introduced, restricting the list of the explicitly correlated pairs, as well as occupied, virtual, and auxiliary spaces in the strong orthogonality projector to the pair-specific domains on the basis of spatial proximity of respective orbitals. The 4-index two-electron integrals appearing in the formalism are approximated via the direct-space density fitting technique. In this procedure, the fitting orbital spaces are also restricted to local fit-domains surrounding the fitted densities. The formulation of the method and its implementation exploits the translational symmetry and the site-group symmetries of the WFs. Test calculations are performed on LiH crystal. The results show that the periodic LMP2-F12 method substantially accelerates basis set convergence of the total correlation energy, and even more so the correlation energy differences. The resulting energies are quite insensitive to the resolution-of-the-identity domain sizes and the quality of the auxiliary basis sets. The convergence with the orbital domain size is somewhat slower, but still acceptable. Moreover, inclusion of slightly more diffuse functions, than those usually used in the periodic calculations, improves the convergence of the LMP2-F12 correlation energy with respect to both the size of the PAO-domains and the quality of the orbital basis set. At the same time, the essentially diffuse atomic orbitals from standard molecular basis sets, commonly utilized in molecular MP2-F12 calculations, but problematic in the periodic context, are not necessary for LMP2-F12 treatment of crystals.
Code of Federal Regulations, 2014 CFR
2014-10-01
... 43 Public Lands: Interior 2 2014-10-01 2014-10-01 false What do I need to do to start building and testing a utilization facility if it is not located on Federal lands leased for geothermal resources? 3271.14 Section 3271.14 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE...
Code of Federal Regulations, 2012 CFR
2012-10-01
... 43 Public Lands: Interior 2 2012-10-01 2012-10-01 false What do I need to do to start building and testing a utilization facility if it is not located on Federal lands leased for geothermal resources? 3271.14 Section 3271.14 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE...
Code of Federal Regulations, 2011 CFR
2011-10-01
... 43 Public Lands: Interior 2 2011-10-01 2011-10-01 false What do I need to do to start building and testing a utilization facility if it is not located on Federal lands leased for geothermal resources? 3271.14 Section 3271.14 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE...
Code of Federal Regulations, 2013 CFR
2013-10-01
... 43 Public Lands: Interior 2 2013-10-01 2013-10-01 false What do I need to do to start building and testing a utilization facility if it is not located on Federal lands leased for geothermal resources? 3271.14 Section 3271.14 Public Lands: Interior Regulations Relating to Public Lands (Continued) BUREAU OF LAND MANAGEMENT, DEPARTMENT OF THE...
Peterson, Richard B; Oja, Vello; Eichelmann, Hillar; Bichele, Irina; Dall'Osto, Luca; Laisk, Agu
2014-10-01
This work addresses the question of occurrence and function of photosystem II (PSII) in bundle sheath (BS) cells of leaves possessing NADP-malic enzyme-type C4 photosynthesis (Zea mays). Although no requirement for PSII activity in the BS has been established, several component proteins of PSII have been detected in BS cells of developing maize leaves exhibiting O2-insensitive photosynthesis. We used the basal fluorescence emissions of PSI (F 0I) and PSII (F 0II) as quantitative indicators of the respective relative photosystem densities. Chl fluorescence induction was measured simultaneously at 680 and 750 nm. In mature leaves, the F m(680)/F 0(680) ratio was 10.5 but less in immature leaves. We propose that the lower ratio was caused by the presence of a distinct non-variable component, F c, emitting at 680 and 750 nm. After F c was subtracted, the fluorescence of PSI (F 0I) was detected as a non-variable component at 750 nm and was undetectably low at 680 nm. Contents of Chls a and b were measured in addition to Chl fluorescence. The Chl b/(a + b) was relatively stable in developing sunflower leaves (0.25-0.26), but in maize it increased from 0.09 to 0.21 with leaf tissue age. In sunflower, the F 0I/(F 0I + F 0II) was 0.39 ± 0.01 independent of leaf age, but in maize, this parameter was 0.65 in young tissue of very low Chl content (20-50 mg m(-2)) falling to a stable level of 0.53 ± 0.01 at Chl contents >100 mg m(-2). The values of F 0I/(F 0I + F 0II) showed that in sunflower, excitation was partitioned between PSII and PSI in a ratio of 2:1, but the same ratio was 1:1 in the C4 plant. The latter is consistent with a PSII:PSI ratio of 2:1 in maize mesophyll cells and PSI only in BS cells (2:1:1 distribution). We suggest, moreover, that redox mediation of Chl synthesis, rather than protein accumulation, regulates photosystem assembly to ensure optimum excitation balance between functional PSII and PSI. Indeed, the apparent necessity for two
Langevin, Stanley A; Bent, Zachary W; Solberg, Owen D; Curtis, Deanna J; Lane, Pamela D; Williams, Kelly P; Schoeniger, Joseph S; Sinha, Anupama; Lane, Todd W; Branda, Steven S
2013-04-01
Use of second generation sequencing (SGS) technologies for transcriptional profiling (RNA-Seq) has revolutionized transcriptomics, enabling measurement of RNA abundances with unprecedented specificity and sensitivity and the discovery of novel RNA species. Preparation of RNA-Seq libraries requires conversion of the RNA starting material into cDNA flanked by platform-specific adaptor sequences. Each of the published methods and commercial kits currently available for RNA-Seq library preparation suffers from at least one major drawback, including long processing times, large starting material requirements, uneven coverage, loss of strand information and high cost. We report the development of a new RNA-Seq library preparation technique that produces representative, strand-specific RNA-Seq libraries from small amounts of starting material in a fast, simple and cost-effective manner. Additionally, we have developed a new quantitative PCR-based assay for precisely determining the number of PCR cycles to perform for optimal enrichment of the final library, a key step in all SGS library preparation workflows.
Linear regression models and k-means clustering for statistical analysis of fNIRS data
Bonomini, Viola; Zucchelli, Lucia; Re, Rebecca; Ieva, Francesca; Spinelli, Lorenzo; Contini, Davide; Paganoni, Anna; Torricelli, Alessandro
2015-01-01
We propose a new algorithm, based on a linear regression model, to statistically estimate the hemodynamic activations in fNIRS data sets. The main concern guiding the algorithm development was the minimization of assumptions and approximations made on the data set for the application of statistical tests. Further, we propose a K-means method to cluster fNIRS data (i.e. channels) as activated or not activated. The methods were validated both on simulated and in vivo fNIRS data. A time domain (TD) fNIRS technique was preferred because of its high performances in discriminating cortical activation and superficial physiological changes. However, the proposed method is also applicable to continuous wave or frequency domain fNIRS data sets. PMID:25780751
Guo, Jinxia; Guo, Ning; Lang, Lixin; Kiesewetter, Dale O; Xie, Qingguo; Li, Quanzheng; Eden, Henry S; Niu, Gang; Chen, Xiaoyuan
2014-01-01
A single dynamic PET acquisition using multiple tracers administered closely in time could provide valuable complementary information about a tumor's status under quasiconstant conditions. This study aimed to investigate the utility of dual-tracer dynamic PET imaging with (18)F-alfatide II ((18)F-AlF-NOTA-E[PEG4-c(RGDfk)]2) and (18)F-FDG for parametric monitoring of tumor responses to therapy. We administered doxorubicin to one group of athymic nude mice with U87MG tumors and paclitaxel protein-bound particles to another group of mice with MDA-MB-435 tumors. To monitor therapeutic responses, we performed dual-tracer dynamic imaging, in sessions that lasted 90 min, starting with injection via the tail vein catheters with (18)F-alfatide II, followed 40 min later by (18)F-FDG. To achieve signal separation of the 2 tracers, we fit a 3-compartment reversible model to the time-activity curve of (18)F-alfatide II for the 40 min before (18)F-FDG injection and then extrapolated to 90 min. The (18)F-FDG tumor time-activity curve was isolated from the 90-min dual-tracer tumor time-activity curve by subtracting the fitted (18)F-alfatide II tumor time-activity curve. With separated tumor time-activity curves, the (18)F-alfatide II binding potential (Bp = k3/k4) and volume of distribution (VD) and (18)F-FDG influx rate ((K1 × k3)/(k2 + k3)) based on the Patlak method were calculated to validate the signal recovery in a comparison with 60-min single-tracer imaging and to monitor therapeutic response. The transport and binding rate parameters K1-k3 of (18)F-alfatide II, calculated from the first 40 min of the dual-tracer dynamic scan, as well as Bp and VD correlated well with the parameters from the 60-min single-tracer scan (R(2) > 0.95). Compared with the results of single-tracer PET imaging, (18)F-FDG tumor uptake and influx were recovered well from dual-tracer imaging. On doxorubicin treatment, whereas no significant changes in static tracer uptake values of (18)F-alfatide II
Kramer, Gerbrand Maria; Frings, Virginie; Heijtel, Dennis; Smit, E F; Hoekstra, Otto S; Boellaard, Ronald
2017-06-01
The objective of this study was to validate several parametric methods for quantification of 3'-deoxy-3'- 18 F-fluorothymidine ( 18 F-FLT) PET in advanced-stage non-small cell lung carcinoma (NSCLC) patients with an activating epidermal growth factor receptor mutation who were treated with gefitinib or erlotinib. Furthermore, we evaluated the impact of noise on accuracy and precision of the parametric analyses of dynamic 18 F-FLT PET/CT to assess the robustness of these methods. Methods : Ten NSCLC patients underwent dynamic 18 F-FLT PET/CT at baseline and 7 and 28 d after the start of treatment. Parametric images were generated using plasma input Logan graphic analysis and 2 basis functions-based methods: a 2-tissue-compartment basis function model (BFM) and spectral analysis (SA). Whole-tumor-averaged parametric pharmacokinetic parameters were compared with those obtained by nonlinear regression of the tumor time-activity curve using a reversible 2-tissue-compartment model with blood volume fraction. In addition, 2 statistically equivalent datasets were generated by countwise splitting the original list-mode data, each containing 50% of the total counts. Both new datasets were reconstructed, and parametric pharmacokinetic parameters were compared between the 2 replicates and the original data. Results: After the settings of each parametric method were optimized, distribution volumes (V T ) obtained with Logan graphic analysis, BFM, and SA all correlated well with those derived using nonlinear regression at baseline and during therapy ( R 2 ≥ 0.94; intraclass correlation coefficient > 0.97). SA-based V T images were most robust to increased noise on a voxel-level (repeatability coefficient, 16% vs. >26%). Yet BFM generated the most accurate K 1 values ( R 2 = 0.94; intraclass correlation coefficient, 0.96). Parametric K 1 data showed a larger variability in general; however, no differences were found in robustness between methods (repeatability coefficient, 80
Zheng, Zhaojuan; Mei, Wending; Xia, Meijuan; He, Qin; Ouyang, Jia
2017-06-14
d-Tagatose is a prospective functional sweetener that can be produced by l-arabinose isomerase (AI) from d-galactose. To improve the activity of AI toward d-galactose, the AI of Bacillus coagulans was rationally designed on the basis of molecular modeling and docking. After alanine scanning and site-saturation mutagenesis, variant F279I that exhibited improved activity toward d-galactose was obtained. The optimal temperature and pH of F279I were determined to be 50 °C and 8.0, respectively. This variant possessed 1.4-fold catalytic efficiency compared with the wild-type (WT) enzyme. The recombinant Escherichia coli overexpressing F279I also showed obvious advantages over the WT in biotransformation. Under optimal conditions, 67.5 and 88.4 g L -1 d-tagatose could be produced from 150 and 250 g L -1 d-galactose, respectively, in 15 h. The biocatalyst constructed in this study presents a promising alternative for large-scale d-tagatose production.
Wang, Mengzhe; Svatunek, Dennis; Rohlfing, Katarina; Liu, Yu; Wang, Hui; Giglio, Ben; Yuan, Hong; Wu, Zhanghong; Li, Zibo; Fox, Joseph
2016-01-01
The bioorthogonal reaction between tetrazines and trans-cyclooctenes is a method for the rapid construction of F-18 probes for PET imaging. Described here is a second generation 18F-labeling system based on a conformationally strained trans-cyclooctene (sTCO)—a dienophile that is approximately 2 orders of magnitude more reactive than conventional TCO dienophiles. Starting from a readily prepared tosylate precursor, an 18F labeled sTCO derivative (18F-sTCO) could be synthesized in 29.3 +/- 5.1% isolated yield and with high specific activity. Tetrazine ligation was carried out with a cyclic RGD-conjugate of a diphenyl-s-tetrazine analogue (RGD-Tz) chosen from a diene class with an excellent combination of fast reactivity and stability both for the diene as well as the Diels-Alder adduct. For both the tetrazine and the sTCO, mini-PEG spacers were included to enhance solubility and improve the in vivo distribution profile of the resulting probe. Extremely fast reactivity (up to 2.86 x 105 M-1s-1 at 25 °C in water) has been observed in kinetic studies in the reaction of sTCO with diphenyl-s-tetrazine derivatives. A kinetic study on sTCO diastereomers in 55:45 MeOH:water showed that the syn-diastereomer displayed slightly faster reactivity than the anti-diastereomer. An 18F-sTCO conjugate with RGD-Tz demonstrated prominent and persistent tumor uptake in vivo with good tumor-to-background contrast. Unlike most radiolabeled RGD peptides, the tumor uptake of this PET agent increased from 5.3 +/- 0.2% ID/g at 1 h post injection (p.i.), to 8.9 +/- 0.5% ID/g at 4 h p.i., providing evidence for prolonged blood circulation. These findings suggest that tetrazine ligations employing 18F-sTCO should serve as a powerful and general platform for the rapid construction of peptide or protein derived PET agents. PMID:27162558
Results of R.F.I. Measurements Made in the G.P.S. Band on a General Aviation Aircraft
DOT National Transportation Integrated Search
1979-06-01
The U.S. Department of Transportation/Transportation Systems Center performed tests aboard a General Aviation aircraft in an effort to characterize the radio frequency interference (R.F.I.) environment, encountered by the receiving system of this typ...
1980-09-01
K ( 7 ) D , SOAPSTONE ( 1 3 ) E. lNK (5) F. CRAYON OR PAINT STICK (14) G.DYE (1) H . PE N C I L ( 1 ) 1. ELECTRIC ENGRAVING (1) 2. WHO MANUFACTURES...CHALK ( 2 ) D . DYE (1) H, SOAPSTONE (4) 4. W HAT TYPE OF DISPENSING METHOD IS UTILIZED WITH MARKING MATERIALS? A . BALL POINT TUBE ( 1 3 ) H , STEEL...9 ) L, BAMBOO PEN & INK POT F. SOAPSTONE (12) M . OIL PENCIL ( 1 ) G . L A C S T I C K ( 0 ) N . ELECTRI c ENGRAVER (1) 5, ARE STANDARD COLORS
MO-AB-BRA-05: [18F]NaF PET/CT Imaging Biomarkers in Metastatic Prostate Cancer
DOE Office of Scientific and Technical Information (OSTI.GOV)
Harmon, S; Perk, T; Lin, C
Purpose: Clinical use of {sup 18}F-Sodium Fluoride (NaF) PET/CT in metastatic settings often lacks technology to quantitatively measure full disease dynamics due to high tumor burden. This study assesses radiomics-based extraction of NaF PET/CT measures, including global metrics of overall burden and local metrics of disease heterogeneity, in metastatic prostate cancer for correlation to clinical outcomes. Methods: Fifty-six metastatic Castrate-Resistant Prostate Cancer (mCRPC) patients had NaF PET/CT scans performed at baseline and three cycles into chemotherapy (N=16) or androgen-receptor (AR) inhibitors (N=39). A novel technology, Quantitative Total Bone Imaging (QTBI), was used for analysis. Employing hybrid PET/CT segmentation and articulatedmore » skeletal-registration, QTBI allows for response assessment of individual lesions. Various SUV metrics were extracted from each lesion (iSUV). Global metrics were extracted from composite lesion-level statistics for each patient (pSUV). Proportion of detected lesions and those with significant response (%-increase or %-decrease) was calculated for each patient based on test-retest limits for iSUV metrics. Cox proportional hazard regression analyses were conducted between imaging metrics and progression-free survival (PFS). Results: Functional burden (pSUV{sub total}) assessed mid-treatment was the strongest univariate predictor of PFS (HR=2.03; p<0.0001). Various global metrics outperformed baseline clinical markers, including fraction of skeletal burden, mean uptake (pSUV{sub mean}), and heterogeneity of average lesion uptake (pSUV{sub hetero}). Of 43 patients with paired baseline/mid-treatment imaging, 40 showed heterogeneity in lesion-level response, containing populations of lesions with both increasing/decreasing metrics. Proportion of lesions with significantly increasing iSUV{sub mean} was highly predictive of clinical PFS (HR=2.0; p=0.0002). Patients exhibiting higher proportion of lesions with decreasing i
ERIC Educational Resources Information Center
Han, Jiye Grace; Barrett, Sharon Kebschull
2013-01-01
This case study reports on the work of Denise Watts, who in 2011 was the newly named Project L.I.F.T. executive director and a Charlotte-Mecklenburg Schools zone superintendent. She approached Public Impact for help in meeting the new Project L.I.F.T. (Leadership and Investment for Transformation) goals. Facing urgent needs for real change, Watts…
DOE Office of Scientific and Technical Information (OSTI.GOV)
Giri, U; Sarkar, B; Kaur, H
Purpose: To choose appropriate gantry starting angle for partial left breast irradiation using volumetric modulated arc therapy (VMAT). Methods: A random patient of left breast carcinoma was selected for this study. The slice which was selected for this mathematical formulation was having maximum breast thickness and maximum medial and lateral tangential distance. After this appropriate isocenter was chosen on that CT slice. The distances between various points were measured by the measuring tool in Monaco 5.00.04. Using the various trigonometric equations, a final equation was derived which shows the relationship between Gantry start angle, isocenter Location and tissue thickness. Results:more » The final equation for gantry start for right medial tangential arc is given asStarting angle = 270°+tan^(−1)(sin(θ)/(x-1/x-2 +cosθ))The above equation was tested for 10 cases and it was found to be appropriate for all the cases. Conclusion: Gantry starting angle for partial arc irradiation depends upon Breast thickness, Distance between Medial and lateral tangent and isocenter location.« less
Spectroscopic Measurement of Ion Flow During Merging Start-up of Field-Reversed Configuration
NASA Astrophysics Data System (ADS)
Oka, Hirotaka; Inomoto, Michiaki; Tanabe, Hiroshi; Annoura, Masanobu; Ono, Yasushi; Nemoto, Koshichi
2012-10-01
The counter-helicity merging method [1] of field-reversed configuration (FRC) formation involves generation of bidirectional toroidal flow, known as a ``sling-shot.'' In two fluids regime, reconnection process is strongly affected by the Hall effect [2]. In this study, we have investigated the behavior of toroidal bidirectional flow generated by the counter-helicity merging in two-fluids regime. We use 2D Ion Doppler Spectroscopy to mesure toroidal ion flow during merging start-up of FRC from Ar gas. We defined two cases: one case with a radially pushed-in X line (case I) and the other case with a radially pushed-out X line(case O). The flow during the plasma merging shows radial asymmetry, as expected from the magnetic measurement, but finally relaxes to a unidirectional flow in plasma current direction in both cases. We observed larger toroidal flow in the plasma current direction in case I after FRC is formed, though the FRC in case O has larger magnetic flux. These results suggest that more ions are lost during merging start-up in case I. This selective ion loss might account for stability and confinement of FRCs probably maintained by high energy ions.[4pt] [1] Y. Ono, et al., Nucl. Fusion 39, pp. 2001-2008 (1999).[0pt] [2] M. Inomoto, et al., Phys. Rev. Lett., 97, 135002, (2006)
Associations of a HinfI PCR-RFLP of POU1F1 gene with growth traits in Qinchuan cattle.
Zhang, Chunlei; Liu, Bo; Chen, Hong; Lan, Xianyong; Lei, Chuzhao; Zhang, Zhiqing; Zhang, Runfeng
2009-01-01
The objectives of the present study were to estimate the allele and genotype frequencies of the POU1F1/HinfI polymorphisms in beef cattle belonging to four different genetic groups and to determine the effects of these polymorphisms on growth traits in cattle. The 451-bp PCR products of POU1F1 gene digested with HinfI exhibited three genotypes and two alleles, which were at Hardy-Weinberg equilibrium (P > 0.05). Genotype BB was the predominant genotype and B the predominant allele in the studied populations. There was significant difference between Limousin x Qinchuan and Qinchuan in the distribution of genotypes (P < 0.0001). The association of the polymorphism of the POU1F1 gene with growth traits among Qinchuan, Limousin x Qinchuan, Angus x Qinchuan and Germany Yellow x Qinchuan crosses was analyzed. Body weight and wither height of individuals with genotypes AB were higher (P < 0.05)than that of individuals with genotype BB in the Germany Yellow x Qinchua cross, but were not in the other three populations (P > 0.05).
Code of Federal Regulations, 2010 CFR
2010-07-01
... for Use With Small Appliances C Appendix C to Subpart F of Part 82 Protection of Environment... and Emissions Reduction Pt. 82, Subpt. F, App. C Appendix C to Subpart F of Part 82—Method for Testing... system. II. Test Conditions Tests are to be conducted at 75 degrees F, plus or minus 2 degrees F (23.9 C...
NASA Astrophysics Data System (ADS)
Rodrigues, Fabiano S.; de Paula, Eurico R.; Zewdie, Gebreab K.
2017-03-01
We present results of Capon's method for estimation of in-beam images of ionospheric scattering structures observed by a small, low-power coherent backscatter interferometer. The radar interferometer operated in the equatorial site of São Luís, Brazil (2.59° S, 44.21° W, -2.35° dip latitude). We show numerical simulations that evaluate the performance of the Capon method for typical F region measurement conditions. Numerical simulations show that, despite the short baselines of the São Luís radar, the Capon technique is capable of distinguishing localized features with kilometric scale sizes (in the zonal direction) at F region heights. Following the simulations, we applied the Capon algorithm to actual measurements made by the São Luís interferometer during a typical equatorial spread F (ESF) event. As indicated by the simulations, the Capon method produced images that were better resolved than those produced by the Fourier method. The Capon images show narrow (a few kilometers wide) scattering channels associated with ESF plumes and scattering regions spaced by only a few tens of kilometers in the zonal direction. The images are also capable of resolving bifurcations and the C shape of scattering structures.
Theoretical hyperfine structures of 19F i and 17O i
NASA Astrophysics Data System (ADS)
Aourir, Nouria; Nemouchi, Messaoud; Godefroid, Michel; Jönsson, Per
2018-03-01
Multiconfiguration Hartree-Fock (MCHF) and multiconfiguration Dirac-Hartree-Fock (MCDHF) calculations are performed for the 2 p5P2o , 2 p4(3P ) 3 s 4P , 2 p4(3P ) 3 s 2P , and 2 p4(3P ) 3 p 4So states of 19F i to determine their hyperfine constants. Several computing strategies are considered to investigate electron correlation and relativistic effects. High-order correlation contributions are included in MCHF calculations based on single and double multireference expansions. The largest components of the single reference MCHF wave functions are selected to define the multireference (MR) sets. In this scheme, relativistic corrections are evaluated in the Breit-Pauli approximation. A similar strategy is used for the calculation of MCDHF relativistic wave functions and hyperfine parameters. While correlation and relativistic corrections are found to be rather small for the ground state, we highlight large relativistic effects on the hyperfine constant A3 /2 of 2 p4(3P ) 3 p 4So and, to a lesser extent, on A1 /2 of 2 p4(3P ) 3 s 4P . As expected for such a light system, electron correlation effects dominate over relativity in the calculation of the hyperfine interaction of all other levels considered. We also revisit the hyperfine constants of 2 p3(4S ) 3 s S5o and 2 p3(4S ) 3 p 5P in 17O using similar strategies. The results are found to be in excellent agreement with experiment.
NASA Astrophysics Data System (ADS)
Liu, Xiaodong; Lei, Ming; Zhou, Yi; Song, Bo; Li, Yongfang
2015-08-01
Double cathode buffer layers (CBLs) composed of fullerene derivative functionalized with a crown-ether end group in its side chain (denoted as PCBC) and a LiF layer were introduced between the PCBM acceptor layer and the top cathode in planar p-i-n perovskite solar cells (pero-SCs) based on CH3NH3PbI3-XClX. The devices with the PCBC/LiF double CBLs showed significant improvements in power conversion efficiency (PCE) and long-term stability when compared to the device with LiF single CBL. Through optimizing the spin-coating speed of PCBC, a maximum PCE of 15.53% has been achieved, which is approximately 15% higher than that of the device with single LiF CBL. The remarkable improvement in PCE can be attributed to the formation of a better ohmic contact in the CBL between PCBC and LiF/Al electrode arising from the dipole moment of PCBC, leading to the enhanced fill factor and short-circuit current density (Jsc). Besides the PCE, the long-term stability of the devices with PCBC interlayer is also superior to that of the device with LiF single CBL, which is due to the more effective protection for the perovskite/PCBM interface.
48 CFR 1827.302 - Policy. (NASA supplements paragraphs (a), (b), (c), (d), (e), (f), (g), and (i)).
Code of Federal Regulations, 2010 CFR
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. (NASA supplements paragraphs (a), (b), (c), (d), (e), (f), (g), and (i)). 1827.302 Section 1827.302 Federal Acquisition... the performance of experimental, developmental, or research work with a small business firm or a...
The secret lives of experiments: methods reporting in the fMRI literature.
Carp, Joshua
2012-10-15
Replication of research findings is critical to the progress of scientific understanding. Accordingly, most scientific journals require authors to report experimental procedures in sufficient detail for independent researchers to replicate their work. To what extent do research reports in the functional neuroimaging literature live up to this standard? The present study evaluated methods reporting and methodological choices across 241 recent fMRI articles. Many studies did not report critical methodological details with regard to experimental design, data acquisition, and analysis. Further, many studies were underpowered to detect any but the largest statistical effects. Finally, data collection and analysis methods were highly flexible across studies, with nearly as many unique analysis pipelines as there were studies in the sample. Because the rate of false positive results is thought to increase with the flexibility of experimental designs, the field of functional neuroimaging may be particularly vulnerable to false positives. In sum, the present study documented significant gaps in methods reporting among fMRI studies. Improved methodological descriptions in research reports would yield significant benefits for the field. Copyright © 2012 Elsevier Inc. All rights reserved.
The Role of Classroom Quality in Explaining Head Start Impacts
ERIC Educational Resources Information Center
Connors, Maia C.; Friedman-Krauss, Allison H.; Morris, Pamela A.; Page, Lindsay C.; Feller, Avi
2014-01-01
This study seeks to answer the following question: Are impacts on Head Start classroom quality associated with impacts of Head Start on children's learning and development? This study employs a variety of descriptive and quasi-experimental methods to explore the role of classroom quality as a mediator or mechanism of Head Start impacts. This…
Federal Register 2010, 2011, 2012, 2013, 2014
2012-12-14
...-0001] Agency Information Collection Activities: Petition for Alien Fiance(e), Form Number I-129F... information collection. (2) Title of the Form/Collection: Petition for Alien Fiance(e). (3) Agency form number... petition for an alien fiance(e), spouse, or his/her children. (5) An estimate of the total number of...
On High and Low Starting Frequencies of Type II Radio Bursts
NASA Astrophysics Data System (ADS)
Sharma, J.; Mittal, N.
2017-06-01
We have studied the characteristics of type II radio burst during the period May 1996 to March 2015, for the solar cycle 23 and 24, observed by WIND/WAVES radio instrument. A total of 642 events were recorded by the instrument during the study period. We have divided the events with two starting frequency range (high > 1 MHz; low ≤ 1MHz) as type II1 (i.e., 1-16 MHz) radio burst and type II2 (i.e., 20 KHz - 1020 KHz) radio burst which constitute the DH and km type II radio burst observed by WIND spacecraft, and determined their time and frequency characteristics. The mean drift rate of type II1 and type II2 radio bursts is 29.76 × 10-4 MHz/s and 0.17 × 10-4 MHz/s respectively, which shows that type II1 with high start frequency hase larger drift rate than the type II2 with low starting frequencies. We have also reported that the start frequency and the drift rate of type II1 are in good correlation, with a linear correlation coefficient of 0.58.
Slawson, Sian E; Conway, Paul P; Cossor, Jodi; Chakravorti, Nandini; West, Andrew A
2013-01-01
Work presented in this paper provides a methodology for categorising swimming start performance based on peak force production on the main block and footrest components of the Omega OSB11 starting block. A total of 46 elite British swimmers were tested, producing over 1000 start trials. Overwater cameras were synchronised to a specifically designed start block that allowed the measurement of force production via two sets of four, tri-axis, force transducers; one set in the main block and one in the footrest. Data were then analysed, segregating trials for gender. Each start was categorised, with respect to the peak force production in horizontal and vertical components, into one of nine categories. Three performance indicators, i.e. block time, take-off velocity and distance of entry, were used to assess whether differences in performance could be correlated with these categories. Results from these data suggest that swimmers generating higher than average peak forces were more likely to produce a better overall start performance than those who produced forces lower than the average, for this population of athletes.
Khazaee, Ali; Ebrahimzadeh, Ata; Babajani-Feremi, Abbas
2016-09-01
The study of brain networks by resting-state functional magnetic resonance imaging (rs-fMRI) is a promising method for identifying patients with dementia from healthy controls (HC). Using graph theory, different aspects of the brain network can be efficiently characterized by calculating measures of integration and segregation. In this study, we combined a graph theoretical approach with advanced machine learning methods to study the brain network in 89 patients with mild cognitive impairment (MCI), 34 patients with Alzheimer's disease (AD), and 45 age-matched HC. The rs-fMRI connectivity matrix was constructed using a brain parcellation based on a 264 putative functional areas. Using the optimal features extracted from the graph measures, we were able to accurately classify three groups (i.e., HC, MCI, and AD) with accuracy of 88.4 %. We also investigated performance of our proposed method for a binary classification of a group (e.g., MCI) from two other groups (e.g., HC and AD). The classification accuracies for identifying HC from AD and MCI, AD from HC and MCI, and MCI from HC and AD, were 87.3, 97.5, and 72.0 %, respectively. In addition, results based on the parcellation of 264 regions were compared to that of the automated anatomical labeling atlas (AAL), consisted of 90 regions. The accuracy of classification of three groups using AAL was degraded to 83.2 %. Our results show that combining the graph measures with the machine learning approach, on the basis of the rs-fMRI connectivity analysis, may assist in diagnosis of AD and MCI.
Unterrainer, Marcus; Vettermann, Franziska; Brendel, Matthias; Holzgreve, Adrien; Lifschitz, Michael; Zähringer, Matthias; Suchorska, Bogdana; Wenter, Vera; Illigens, Ben M; Bartenstein, Peter; Albert, Nathalie L
2017-12-01
PET with O-(2- 18 F-fluoroethyl)-L-tyrosine ( 18 F-FET) has reached increasing clinical significance for patients with brain neoplasms. For quantification of standard PET-derived parameters such as the tumor-to-background ratio, the background activity is assessed using a region of interest (ROI) or volume of interest (VOI) in unaffected brain tissue. However, there is no standardized approach regarding the assessment of the background reference. Therefore, we evaluated the intra- and inter-reader variability of commonly applied approaches for clinical 18 F-FET PET reading. The background activity of 20 18 F-FET PET scans was independently evaluated by 6 readers using a (i) simple 2D-ROI, (ii) spherical VOI with 3.0 cm diameter, and (iii) VOI consisting of crescent-shaped ROIs; each in the contralateral, non-affected hemisphere including white and gray matter in line with the European Association of Nuclear Medicine (EANM) and German guidelines. To assess intra-reader variability, each scan was evaluated 10 times by each reader. The coefficient of variation (CoV) was assessed for determination of intra- and inter-reader variability. In a second step, the best method was refined by instructions for a guided background activity assessment and validated by 10 further scans. Compared to the other approaches, the crescent-shaped VOIs revealed most stable results with the lowest intra-reader variabilities (median CoV 1.52%, spherical VOI 4.20%, 2D-ROI 3.69%; p < 0.001) and inter-reader variabilities (median CoV 2.14%, spherical VOI 4.02%, 2D-ROI 3.83%; p = 0.001). Using the guided background assessment, both intra-reader variabilities (median CoV 1.10%) and inter-reader variabilities (median CoV 1.19%) could be reduced even more. The commonly applied methods for background activity assessment show different variability which might hamper 18 F-FET PET quantification and comparability in multicenter settings. The proposed background activity assessment using a
NASA Technical Reports Server (NTRS)
1988-01-01
F-104G (N826NA) in flight over the Mojave Desert in January 1988. This aircraft was the last of eleven F-104s delivered to the Dryden Flight Research Center over a period of four decades. The initial group of four (a YF-104A, two F-104As and a two-seat F-104B) arrived between August 1956 and December 1959. One of the F-104As was returned to the Air Force in 1961, and the other was lost in a non-fatal accident in 1962. To support X-15 activities, three special F-104Ns went to NASA in 1963. One crashed in the XB-70 midair collision, and it was replaced by an F-104A/G. (This was an F-104A modified to a G configuration.) As the initial F-104 fleet aged, a pair of two-seat TF-104Gs and a single-seat F-104G joined the Dryden inventory in June 1975. F-104G N826NA, shown in the photo, was one of these. Between 1975 and 1990, the older F-104s were retired - the YF-104A in November 1975, the F-104A/G in June 1977, the F-104B in June 1983, and the two F-104Ns in January 1987 and October 1990. As the F-104s phased out, the replacement F-18s started arriving at Dryden in 1984. F-104s N826NA made its 1,415th and last flight on February 3, 1994. The last two TF-104s ended service in September 1995, ending a 39 year involvement with the aircraft by the NACA and NASA.
XeCl laser pumped iodine laser using t-C4F9I
NASA Technical Reports Server (NTRS)
Hwang, In Heon; Han, Kwang S.
1989-01-01
An iodine photodissociation laser using t-C4F9I as the active material was pumped by an XeCl laser. An iodine laser output energy of 3 mJ with pulse duration of 25 ns was obtained when the pumping pulse energy was 80 mJ, the iodide pressure was 70 torr, and the reflectance of the output mirror was 85 percent. The high pumping efficiency and low threshold pump power achieved in this experiment are attributable to the high absorption cross section at the pump laser wavelength (308 nm) of the iodide used.
2011-09-01
SEP 2011 2. REPORT TYPE N/A 3. DATES COVERED - 4. TITLE AND SUBTITLE Final Phase I Environmental Baseline Survey Parcel E2, F, and I...lead-based paint LUST leaking underground storage tank M.D.M. Mount Diablo Meridian MFH military family housing MHPI Military Housing...northwest OWS oil/water separator PADS PCB Activity Database PCB polychorinated biphenyl PCR Physical Condition Report PDF portable
2011-09-01
21 SEP 2011 2. REPORT TYPE N/A 3. DATES COVERED 4. TITLE AND SUBTITLE Final Phase I Environmental Baseline Survey Parcels E2, F, and I...leaking underground storage tank M.D.M. Mount Diablo Meridian MFH military family housing MHPI Military Housing Privatization Initiative MSL...water separator PADS PCB Activity Database PCB polychorinated biphenyl PCR Physical Condition Report PDF portable document format PPV
Optimization of steam-vortex plasma-torch start-up
NASA Astrophysics Data System (ADS)
Mikhailov, B. I.
2011-12-01
We propose a new optimal method of steam-vortex plasma-torches start-up; this method completely prevents the danger of water steam condensation in the arc chamber and all undesirable consequences of it.
Dose escalation methods in phase I cancer clinical trials.
Le Tourneau, Christophe; Lee, J Jack; Siu, Lillian L
2009-05-20
Phase I clinical trials are an essential step in the development of anticancer drugs. The main goal of these studies is to establish the recommended dose and/or schedule of new drugs or drug combinations for phase II trials. The guiding principle for dose escalation in phase I trials is to avoid exposing too many patients to subtherapeutic doses while preserving safety and maintaining rapid accrual. Here we review dose escalation methods for phase I trials, including the rule-based and model-based dose escalation methods that have been developed to evaluate new anticancer agents. Toxicity has traditionally been the primary endpoint for phase I trials involving cytotoxic agents. However, with the emergence of molecularly targeted anticancer agents, potential alternative endpoints to delineate optimal biological activity, such as plasma drug concentration and target inhibition in tumor or surrogate tissues, have been proposed along with new trial designs. We also describe specific methods for drug combinations as well as methods that use a time-to-event endpoint or both toxicity and efficacy as endpoints. Finally, we present the advantages and drawbacks of the various dose escalation methods and discuss specific applications of the methods in developmental oncotherapeutics.
Evaluation of methods to detect the cotton pathogen Fusarium oxysporum f. sp. vasinfectum race 4
USDA-ARS?s Scientific Manuscript database
Fusarium wilt caused by Fusarium oxysporum f. sp. vasinfectum (Fov) is an important disease of cotton. Fov race 4, identified in the San Joaquin Valley of California, has caused serious losses and is a potential threat to US cotton production. Tests have been developed to rapidly identify race 4 i...
Chemical analysis of monomers in epoxy resins based on bisphenols F and A.
Pontén, A; Zimerson, E; Sörensen, O; Bruze, M
2004-05-01
Diglycidyl ether of bisphenol A (DGEBA) is the monomer and most important contact allergen in epoxy resin(s) based on bisphenol A (DGEBA-R). Both thin-layer chromatography (TLC) and high-pressure liquid chromatography (HPLC) methods are available for the analysis of products containing DGEBA-R. With respect to detection and quantification, epoxy resins of the bisphenol F-type, i.e. epoxy resins containing the isomers of diglycidyl ethers of bisphenol F (DGEBF), are not as well investigated as DGEBA-R. The isomers of DGEBF are p,p'-DGEBF, o,p'-DGEBF and o,o'-DGEBF. Both p,p'-DGEBF and o,p'-DGEBF have been shown to be contact allergens in humans, and all 3 isomers are sensitizers in the guinea pig maximization test. We aimed (i). to develop HPLC methods for separation and purification of the individual DGEBF isomers, (ii). to detect and quantify the DGEBF isomers in epoxy resins of the bisphenol F-type and (iii). to evaluate and develop the TLC as a method for the detection of the DGEBF monomers. We found the total content of the DGEBF isomers in the investigated epoxy resins of the bisphenol F-type to vary from 17.0 to 81.7% w/w. Some of them also contained 0.1-2.4% w/w DGEBA. The HPLC method showed a sensitivity that was 2000-20 000x higher than that obtained with the TLC method for the DGEBF monomers. We concluded that the range of the DGEBF isomer content in epoxy resins of the bisphenol F-type is approximately the same as the monomer content in liquid compared to solid DGEBA-R. The relevance of contact allergy to DGEBA-R can remain unrecognized if the suspected product is an epoxy resin of the bisphenol F-type, which is analysed with the TLC method.
NASA Astrophysics Data System (ADS)
Gelija, Devarajulu; Borelli, Deva Prasad Raju
2018-02-01
The concentration variation of Ho3+ ion-doped SiO2-Al2O3-Na2CO3-SrF2-CaF2 glasses has been prepared by conventional melt quenching method. The thermal stability of 1 mol % of Ho3+-doped oxyfluorosilicate glass has been calculated using the differential thermal analysis (DTA) spectra. The phenomenological Judd-Ofelt intensity parameters Ωλ ( λ = 2, 4 and 6) were calculated for all concentrations of Ho3+ ions. The luminescence spectra in visible region of Ho3+ ion-doped glasses were recorded under the excitation wavelength of 452 nm. The spectra consists of several intense emission bands (5F4, 5S2) → 5I8 (547 nm), 5F3 → 5I8 (647 nm), 5F5 → 5I7 (660 nm) and (5F4, 5S2) → 5I7 (750 nm) in the range 500-780 nm. The fluorescence emission at ˜2.0 µm (5I7 → 5I8) was observed under the excitation of 488 nm Ar-ion laser. The stimulated emission cross section for 5I7 → 5I8 transition (˜2.0 µm) varies from 8.46 to 9.52 × 10-21 cm2, as calculated by the Fuchtbauer-Ladenburg (FL) theory. However, Mc-Cumber theory was used to calculate emission cross section values about 4.24-5.75 × 10-21 cm2 for the 5I7 → 5I8 transition in all concentrations of Ho3+-doped oxyfluorosilicate glasses. Therefore, these results reveal that the 0.5 mol % of Ho3+-doped oxyfluorosilicate glasses, exhibiting higher emission cross section, has potentially been used for laser applications at ˜ 2.0 µm.
On Kasner solution in Bianchi I f( T) cosmology
NASA Astrophysics Data System (ADS)
Skugoreva, Maria A.; Toporensky, Alexey V.
2018-05-01
Recently the cosmological dynamics of an anisotropic Universe in f( T) gravity became an area of intense investigations. Some earlier papers devoted to this issue contain contradictory claims about the nature and propertied of vacuum solutions in this theory. The goal of the present paper is to clarify this situation. We compare properties of f( T) and f( R) vacuum solutions and outline differences between them. The Kasner solution appears to be an exact solution for the T=0 branch, and an asymptotic solution for the T ≠ 0 branch. It is shown that the Kasner solution is a past attractor if T<0, being a past and future attractor for the T>0 branch.
Bianchi type I in f(T) gravitational theories
NASA Astrophysics Data System (ADS)
M, I. Wanas; G, G. L. Nashed; O, A. Ibrahim
2016-05-01
A tetrad field that is homogeneous and anisotropic which contains two unknown functions A(t) and B(t) of cosmic time is applied to the field equations of f (T), where T is the torsion scalar, T = T μ νρ S μ νρ . We calculate the equation of continuity and rewrite it as a product of two brackets, the first is a function of f (T) and the second is a function of the two unknowns A(t) and B(t). We use two different relations between the two unknown functions A(t) and B(t) in the second bracket to solve it. Both of these relations give constant scalar torsion and solutions coincide with the de Sitter one. So, another assumption related to the contents of the matter fields is postulated. This assumption enables us to drive a solution with a non-constant value of the scalar torsion and a form of f (T) which represents ΛCDM. Project supported by the Egyptian Ministry of Scientific Research (Project No. 24-2-12).
Asada, Mamiko Nasu; Nemoto, Takayuki; Mimura, Hisashi
2016-03-01
We recently developed several new relaxation filter-selective signal excitation (RFS) methods for (13)C solid-state nuclear magnetic resonance (NMR) that allow (13)C signal extraction of the target components from pharmaceuticals. These methods were successful in not only qualification but also quantitation over the wide range of 5% to 100%. Here, we aimed to improve the sensitivity of these methods and initially applied them to (19)F solid-state NMR, on the basis that the fluorine atom is one of the most sensitive NMR-active nuclei. For testing, we selected atorvastatin calcium (ATC), an antilipid BCS class II drug that inhibits 3-hydroxy-3-methylglutaryl-coenzyme A reductase and is marketed in crystalline and amorphous forms. Tablets were obtained from 2 generic drug suppliers, and the ATC content occurred mainly as an amorphous form. Using the RFS method with (19)F solid-state NMR, we succeeded in qualifying trace amounts (less than 0.5% w/w level) of crystalline phase (Form I) of ATC in the tablets. RFS methods with (19)F solid-state NMR are practical and time efficient and can contribute not only to the study of pharmaceutical drugs, including those with small amounts of a highly potent active ingredient within a formulated product, but also to the study of fluoropolymers in material sciences. Copyright © 2016 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.
Seo, Dong Seok; Lee, Jong Kook; Hwang, Kyu Hong; Hahn, Byung Dong; Yoon, Seog Young
2015-08-01
Three types of raw materials were used for the fabrication of hydroxyapatite coatings by using the room temperature spraying method and their influence on the microstructure and in vitro characteristics were investigated. Starting hydroxyapatite powders for coatings on titanium substrate were prepared by a heat treatment at 1100 °C for 2 h of bovine bone, bone ash, and commercial hydroxyapatite powders. The phase compositions and Ca/P ratios of the three hydroxyapatite coatings were similar to those of the raw materials without decomposition or formation of a new phase. All hydroxyapatite coatings showed a honeycomb structure, but their surface microstructures revealed different features in regards to surface morphology and roughness, based on the staring materials. All coatings consisted of nano-sized grains and had dense microstructure. Inferred from in vitro experiments in pure water, all coatings have a good dissolution-resistance and biostability in water.
NaF-assisted combustion synthesis of MoSi2 nanoparticles and their densification behavior
NASA Astrophysics Data System (ADS)
Nersisyan, Hayk H.; Lee, Tae Hyuk; Ri, Vladislav; Lee, Jong Hyeon; Suh, Hoyoung; Kim, Jin-Gyu; Son, Hyeon Taek; Kim, Yong-Ho
2017-03-01
The exothermic reduction of oxides mixture (MoO3+2SiO2) by magnesium in NaF melt enables the synthesis of nanocrystalline MoSi2 powders in near-quantitative yields. The combustion wave with temperature of about 1000-1200 °C was recorded in highly diluted by NaF starting mixtures. The by-products of combustion reaction (NaF and MgO) were subsequently removed by leaching with acid and washing with water. The as-prepared MoSi2 nanopowder composed of spherical and dendritic shape particles was consolidated using the spark plasma sintering method at 1200-1500 °C and 50 MPa for 10 min. The result was dense compacts (98.6% theoretical density) possessing submicron grains and exhibiting hardness of 8.74-12.92 GPa.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Liu, Xiaodong; Zhou, Yi, E-mail: yizhou@suda.edu.cn, E-mail: songbo@suda.edu.cn, E-mail: liyf@iccas.ac.cn; Song, Bo, E-mail: yizhou@suda.edu.cn, E-mail: songbo@suda.edu.cn, E-mail: liyf@iccas.ac.cn
2015-08-10
Double cathode buffer layers (CBLs) composed of fullerene derivative functionalized with a crown-ether end group in its side chain (denoted as PCBC) and a LiF layer were introduced between the PCBM acceptor layer and the top cathode in planar p-i-n perovskite solar cells (pero-SCs) based on CH{sub 3}NH{sub 3}PbI{sub 3−X}Cl{sub X}. The devices with the PCBC/LiF double CBLs showed significant improvements in power conversion efficiency (PCE) and long-term stability when compared to the device with LiF single CBL. Through optimizing the spin-coating speed of PCBC, a maximum PCE of 15.53% has been achieved, which is approximately 15% higher than thatmore » of the device with single LiF CBL. The remarkable improvement in PCE can be attributed to the formation of a better ohmic contact in the CBL between PCBC and LiF/Al electrode arising from the dipole moment of PCBC, leading to the enhanced fill factor and short-circuit current density (J{sub sc}). Besides the PCE, the long-term stability of the devices with PCBC interlayer is also superior to that of the device with LiF single CBL, which is due to the more effective protection for the perovskite/PCBM interface.« less
Szabó, István; Telekes, Hajnalka; Czakó, Gábor
2015-06-28
We develop a full-dimensional global analytical potential energy surface (PES) for the F(-) + CH3F reaction by fitting about 50 000 energy points obtained by an explicitly correlated composite method based on the second-order Møller-Plesset perturbation-F12 and coupled-cluster singles, doubles, and perturbative triples-F12a methods and the cc-pVnZ-F12 [n = D, T] basis sets. The PES accurately describes the (a) back-side attack Walden inversion mechanism involving the pre- and post-reaction (b) ion-dipole and (c) hydrogen-bonded complexes, the configuration-retaining (d) front-side attack and (e) double-inversion substitution pathways, as well as (f) the proton-abstraction channel. The benchmark quality relative energies of all the important stationary points are computed using the focal-point analysis (FPA) approach considering electron correlation up to coupled-cluster singles, doubles, triples, and perturbative quadruples method, extrapolation to the complete basis set limit, core-valence correlation, and scalar relativistic effects. The FPA classical(adiabatic) barrier heights of (a), (d), and (e) are -0.45(-0.61), 46.07(45.16), and 29.18(26.07) kcal mol(-1), respectively, the dissociation energies of (b) and (c) are 13.81(13.56) and 13.73(13.52) kcal mol(-1), respectively, and the endothermicity of (f) is 42.54(38.11) kcal mol(-1). Quasiclassical trajectory computations of cross sections, scattering (θ) and initial attack (α) angle distributions, as well as translational and internal energy distributions are performed for the F(-) + CH3F(v = 0) reaction using the new PES. Apart from low collision energies (Ecoll), the SN2 excitation function is nearly constant, the abstraction cross sections rapidly increase with Ecoll from a threshold of ∼40 kcal mol(-1), and retention trajectories via double inversion are found above Ecoll = ∼ 30 kcal mol(-1), and at Ecoll = ∼ 50 kcal mol(-1), the front-side attack cross sections start to increase very rapidly. At
NASA Astrophysics Data System (ADS)
Szabó, István; Telekes, Hajnalka; Czakó, Gábor
2015-06-01
We develop a full-dimensional global analytical potential energy surface (PES) for the F- + CH3F reaction by fitting about 50 000 energy points obtained by an explicitly correlated composite method based on the second-order Møller-Plesset perturbation-F12 and coupled-cluster singles, doubles, and perturbative triples-F12a methods and the cc-pVnZ-F12 [n = D, T] basis sets. The PES accurately describes the (a) back-side attack Walden inversion mechanism involving the pre- and post-reaction (b) ion-dipole and (c) hydrogen-bonded complexes, the configuration-retaining (d) front-side attack and (e) double-inversion substitution pathways, as well as (f) the proton-abstraction channel. The benchmark quality relative energies of all the important stationary points are computed using the focal-point analysis (FPA) approach considering electron correlation up to coupled-cluster singles, doubles, triples, and perturbative quadruples method, extrapolation to the complete basis set limit, core-valence correlation, and scalar relativistic effects. The FPA classical(adiabatic) barrier heights of (a), (d), and (e) are -0.45(-0.61), 46.07(45.16), and 29.18(26.07) kcal mol-1, respectively, the dissociation energies of (b) and (c) are 13.81(13.56) and 13.73(13.52) kcal mol-1, respectively, and the endothermicity of (f) is 42.54(38.11) kcal mol-1. Quasiclassical trajectory computations of cross sections, scattering (θ) and initial attack (α) angle distributions, as well as translational and internal energy distributions are performed for the F- + CH3F(v = 0) reaction using the new PES. Apart from low collision energies (Ecoll), the SN2 excitation function is nearly constant, the abstraction cross sections rapidly increase with Ecoll from a threshold of ˜40 kcal mol-1, and retention trajectories via double inversion are found above Ecoll = ˜ 30 kcal mol-1, and at Ecoll = ˜ 50 kcal mol-1, the front-side attack cross sections start to increase very rapidly. At low Ecoll, the
Left-right correlation in coupled F-center defects.
Janesko, Benjamin G
2016-08-07
This work explores how left-right correlation, a textbook problem in electronic structure theory, manifests in a textbook example of electrons trapped in crystal defects. I show that adjacent F-center defects in lithium fluoride display symptoms of "strong" left-right correlation, symptoms similar to those seen in stretched H2. Simulations of UV/visible absorption spectra qualitatively fail to reproduce experiment unless left-right correlation is taken into account. This is of interest to both the electronic structure theory and crystal-defect communities. Theorists have a new well-behaved system to test their methods. Crystal-defect groups are cautioned that the approximations that successfully model single F-centers may fail for adjacent F-centers.
Theoretical Study of Decomposition Pathways for HArF and HKrF
NASA Technical Reports Server (NTRS)
Chaban, Galina M.; Lundell, Jan; Gerber, R. Benny; Kwak, Donchan (Technical Monitor)
2002-01-01
To provide theoretical insights into the stability and dynamics of the new rare gas compounds HArF and HKrF, reaction paths for decomposition processes HRgF to Rg + HF and HRgF to H + Rg + F (Rg = Ar, Kr) are calculated using ab initio electronic structure methods. The bending channels, HRgF to Rg + HF, are described by single-configurational MP2 and CCSD(T) electronic structure methods, while the linear decomposition paths, HRgF to H + Rg + F, require the use of multi-configurational wave functions that include dynamic correlation and are size extensive. HArF and HKrF molecules are found to be energetically stable with respect to atomic dissociation products (H + Rg + F) and separated by substantial energy barriers from Rg + HF products, which ensure their kinetic stability. The results are compatible with experimental data on these systems.
NASA Astrophysics Data System (ADS)
Ji, Wei; Li, Xiaodong; Wang, Jingyu; Ye, Baoyun; Wang, Cailing
2016-10-01
Solid spherical octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine/fluororubber2602 (HMX/F2602) was prepared by the suspension spray-drying method as follows: firstly, thinning octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) was obtained by a solvent-anti-solvent method. Secondly, thinning HMX suspended in ethyl acetate solvent in a solution of a binder-F2602-was made into a suspension. Finally, the samples were prepared by spray drying. The samples were characterized by scanning electron microscopy (SEM), X-ray photoelectron spectrometry (XPS), X-ray diffraction (XRD), and Fourier transform infrared (FTIR), and its thermal stability as well as mechanical and spark sensitivities were measured. The results of SEM showed that the grain of HMX/F2602 was solid spherical and the particle distribution was homogeneous. The results of XPS indicated that F2602 can be successfully coated on the surface of HMX crystals. Compared to raw HMX, th characteristic drop height was increased from 19.60 to 40.37 cm, an increase of 79.10%. The friction sensitivities of HMX reduced from 100 to 28% and the spark sensitivity of HMX/F2602 increased. The critical explosion temperatures of raw HMX and HMX/F2602 were 275.43 and 274.30°C, respectively. The amount of gas evolution of raw HMX and HMX/F2602 was 0.15 and 0.12 ml.(5 g)-1, respectively. The results of DSC and vacuum stability tests (VSTs) indicate that the thermal stability of HMX/F2602 was equal to that of raw HMX and HMX and F2602 had good compatibility.
A wavelet method for modeling and despiking motion artifacts from resting-state fMRI time series
Patel, Ameera X.; Kundu, Prantik; Rubinov, Mikail; Jones, P. Simon; Vértes, Petra E.; Ersche, Karen D.; Suckling, John; Bullmore, Edward T.
2014-01-01
The impact of in-scanner head movement on functional magnetic resonance imaging (fMRI) signals has long been established as undesirable. These effects have been traditionally corrected by methods such as linear regression of head movement parameters. However, a number of recent independent studies have demonstrated that these techniques are insufficient to remove motion confounds, and that even small movements can spuriously bias estimates of functional connectivity. Here we propose a new data-driven, spatially-adaptive, wavelet-based method for identifying, modeling, and removing non-stationary events in fMRI time series, caused by head movement, without the need for data scrubbing. This method involves the addition of just one extra step, the Wavelet Despike, in standard pre-processing pipelines. With this method, we demonstrate robust removal of a range of different motion artifacts and motion-related biases including distance-dependent connectivity artifacts, at a group and single-subject level, using a range of previously published and new diagnostic measures. The Wavelet Despike is able to accommodate the substantial spatial and temporal heterogeneity of motion artifacts and can consequently remove a range of high and low frequency artifacts from fMRI time series, that may be linearly or non-linearly related to physical movements. Our methods are demonstrated by the analysis of three cohorts of resting-state fMRI data, including two high-motion datasets: a previously published dataset on children (N = 22) and a new dataset on adults with stimulant drug dependence (N = 40). We conclude that there is a real risk of motion-related bias in connectivity analysis of fMRI data, but that this risk is generally manageable, by effective time series denoising strategies designed to attenuate synchronized signal transients induced by abrupt head movements. The Wavelet Despiking software described in this article is freely available for download at www
Kimura, Yasuyuki; Siméon, Fabrice G; Zoghbi, Sami S; Zhang, Yi; Hatazawa, Jun; Pike, Victor W; Innis, Robert B; Fujita, Masahiro
2012-02-01
A new PET ligand, 3-fluoro-5-(2-(2-(18)F-(fluoromethyl)-thiazol-4-yl)ethynyl)benzonitrile (18F-SP203) can quantify metabotropic glutamate subtype 5 receptors (mGluR5) in human brain by a bolus injection and kinetic modeling. As an alternative approach to a bolus injection, binding can simply be measured as a ratio of tissue to metabolite-corrected plasma at a single time point under equilibrium conditions achieved by administering the radioligand with a bolus injection followed by a constant infusion. The purpose of this study was to validate the equilibrium method as an alternative to the standard kinetic method for measuring 18F-SP203 binding in the brain. Nine healthy subjects were injected with 18F-SP203 using a bolus plus constant infusion for 300 min. A single ratio of bolus-to-constant infusion (the activity of bolus equaled to that of infusion over 219 min) was applied to all subjects to achieve equilibrium in approximately 120 min. As a measure of ligand binding, we compared total distribution volume (VT) calculated by the equilibrium and kinetic methods in each scan. The equilibrium method calculated VT by the ratio of radioactivity in the brain to the concentration of 18F-SP203 in arterial plasma at 120 min, and the kinetic method calculated VT by a two-tissue compartment model using brain and plasma dynamic data from 0 to 120 min. VT obtained via the equilibrium method was highly correlated with VT obtained via kinetic modeling. Inter-subject variability of VT obtained via the equilibrium method was slightly smaller than VT obtained via the kinetic method. VT obtained via the equilibrium method was ~10% higher than VT obtained via the kinetic method, indicating a small difference between the measurements. Taken together, the results of this study show that using the equilibrium method is an acceptable alternative to the standard kinetic method when using 18F-SP203 to measure mGluR5. Although small differences in the measurements obtained via the
Morphology evolution and pure red upconversion mechanism of β-NaLuF4 crystals.
Lin, Hao; Xu, Dekang; Li, Anming; Teng, Dongdong; Yang, Shenghong; Zhang, Yueli
2016-06-16
A series of β-NaLuF4 crystals were synthesized via a hydrothermal method. Hexagonal phase microdisks, microprisms, and microtubes were achieved by simply changing the amount of citric acid in the initial reaction solution. Pure red upconversion (UC) luminescence can be observed in β-NaLuF4:Yb(3+), Tm(3+), Er(3+) and Li(+) doped β-NaLuF4:20% Yb(3+), 1% Tm(3+), 20% Er(3+). Based on the rate equations, we report the theoretical model about the pure red UC mechanism in Yb(3+)/Tm(3+)/Er(3+) doped system. It is proposed that the pure red UC luminescence is mainly ascribed to the energy transfer UC from Tm(3+):(3)F4 → (3)H6 to Er(3+):(4)I11/2 → (4)F9/2 and the cross-relaxation (CR) effect [Er(3+):(4)S3/2 + (4)I15/2 → (4)I9/2 + (4)I13/2] rather than the long-accepted mechanism [CR process among Er(3+):(4)F7/2 + (4)I11/2 → (4)F9/2 + (4)F9/2]. In addition, compared to the Li(+)-free counterpart, the pure red UC luminescence in β-NaLuF4:20% Yb(3+), 1% Tm(3+), 20% Er(3+) with 15 mol% Li(+) doping is enhanced by 13.7 times. This study provides a general and effective approach to obtain intense pure red UC luminescence, which can be applied to other synthetic strategies.
Morphology evolution and pure red upconversion mechanism of β-NaLuF4 crystals
Lin, Hao; Xu, Dekang; Li, Anming; Teng, Dongdong; Yang, Shenghong; Zhang, Yueli
2016-01-01
A series of β-NaLuF4 crystals were synthesized via a hydrothermal method. Hexagonal phase microdisks, microprisms, and microtubes were achieved by simply changing the amount of citric acid in the initial reaction solution. Pure red upconversion (UC) luminescence can be observed in β-NaLuF4:Yb3+, Tm3+, Er3+ and Li+ doped β-NaLuF4:20% Yb3+, 1% Tm3+, 20% Er3+. Based on the rate equations, we report the theoretical model about the pure red UC mechanism in Yb3+/Tm3+/Er3+ doped system. It is proposed that the pure red UC luminescence is mainly ascribed to the energy transfer UC from Tm3+:3F4 → 3H6 to Er3+:4I11/2 → 4F9/2 and the cross-relaxation (CR) effect [Er3+:4S3/2 + 4I15/2 → 4I9/2 + 4I13/2] rather than the long-accepted mechanism [CR process among Er3+:4F7/2 + 4I11/2 → 4F9/2 + 4F9/2]. In addition, compared to the Li+-free counterpart, the pure red UC luminescence in β-NaLuF4:20% Yb3+, 1% Tm3+, 20% Er3+ with 15 mol% Li+ doping is enhanced by 13.7 times. This study provides a general and effective approach to obtain intense pure red UC luminescence, which can be applied to other synthetic strategies. PMID:27306720
Brede, Dag Anders; Lothe, Sheba; Salehian, Zhian; Faye, Therese; Nes, Ingolf F
2007-12-01
This report describes the first functional analysis of a bacteriocin immunity gene from Propionibacterium freudenreichii and its use as a selection marker for food-grade cloning. Cloning of the pcfI gene (previously orf5 [located as part of the pcfABC propionicin F operon]) rendered the sensitive host 1,000-fold more tolerant to the propionicin F bacteriocin. The physiochemical properties of the 127-residue large PcfI protein resemble those of membrane-bound immunity proteins from bacteriocin systems found in lactic acid bacteria. The high level of immunity conferred by pcfI allowed its use as a selection marker for plasmid transformation in P. freudenreichii. Electroporation of P. freudenreichii IFO12426 by use of the pcfI expression plasmid pSL102 and propionicin F selection (200 bacteriocin units/ml) yielded 10(7) transformants/microg DNA. The 2.7-kb P. freudenreichii food-grade cloning vector pSL104 consists of the pLME108 replicon, a multiple cloning site, and pcfI expressed from the constitutive P(pampS) promoter for selection. The pSL104 vector efficiently facilitated cloning of the propionicin T1 bacteriocin in P. freudenreichii. High-level propionicin T1 production (640 BU/ml) was obtained with the IFO12426 strain, and the food-grade propionicin T1 expression plasmid pSL106 was maintained by approximately 91% of the cells over 25 generations in the absence of selection. To the best of our knowledge this is the first report of an efficient cloning system that facilitates the generation of food-grade recombinant P. freudenreichii strains.
iHOPerator: user-scripting a personalized bioinformatics Web, starting with the iHOP website
Good, Benjamin M; Kawas, Edward A; Kuo, Byron Yu-Lin; Wilkinson, Mark D
2006-01-01
Background User-scripts are programs stored in Web browsers that can manipulate the content of websites prior to display in the browser. They provide a novel mechanism by which users can conveniently gain increased control over the content and the display of the information presented to them on the Web. As the Web is the primary medium by which scientists retrieve biological information, any improvements in the mechanisms that govern the utility or accessibility of this information may have profound effects. GreaseMonkey is a Mozilla Firefox extension that facilitates the development and deployment of user-scripts for the Firefox web-browser. We utilize this to enhance the content and the presentation of the iHOP (information Hyperlinked Over Proteins) website. Results The iHOPerator is a GreaseMonkey user-script that augments the gene-centred pages on iHOP by providing a compact, configurable visualization of the defining information for each gene and by enabling additional data, such as biochemical pathway diagrams, to be collected automatically from third party resources and displayed in the same browsing context. Conclusion This open-source script provides an extension to the iHOP website, demonstrating how user-scripts can personalize and enhance the Web browsing experience in a relevant biological setting. The novel, user-driven controls over the content and the display of Web resources made possible by user-scripts, such as the iHOPerator, herald the beginning of a transition from a resource-centric to a user-centric Web experience. We believe that this transition is a necessary step in the development of Web technology that will eventually result in profound improvements in the way life scientists interact with information. PMID:17173692
Sellers, Brian G; Viljoen, Jodi L.; Cruise, Keith R.; Nicholls, Tonia L.; Dvoskin, Joel A.
2012-01-01
The Short-Term Assessment of Risk and Treatability: Adolescent Version (START:AV) is a new structured professional judgment guide for assessing short-term risks in adolescents. The scheme may be distinguished from other youth risk assessment and treatment planning instruments by its inclusion of 23 dynamic factors that are each rated for both vulnerability and strength. In addition, START:AV is also unique in that it focuses on multiple adverse outcomes—namely, violence, self-harm, suicide, unauthorized leave, substance abuse, self-neglect, victimization, and general offending—over the short-term (i.e., weeks to months) rather than long-term (i.e., years). This paper describes a pilot implementation and preliminary evaluation of START:AV in three secure juvenile correctional facilities in the southern United States. Specifically, we examined the descriptive characteristics and psychometric properties of START:AV assessments completed by 21 case managers on 291 adolescent offenders (250 boys and 41 girls) at the time of admission. Results provide preliminary support for the feasibility of completing START:AV assessments as part of routine practice. Findings also highlight differences in the characteristics of START:AV assessments for boys and girls and differential associations between the eight START:AV risk domains. Though results are promising, further research is needed to establish the reliability and validity of START:AV assessments completed in the field. PMID:23316116
Haeussinger, F B; Dresler, T; Heinzel, S; Schecklmann, M; Fallgatter, A J; Ehlis, A-C
2014-07-15
Functional near-infrared spectroscopy (fNIRS) is an optical neuroimaging method that detects temporal concentration changes of oxygenated and deoxygenated hemoglobin within the cortex, so that neural activation can be inferred. However, even though fNIRS is a very practical and well-tolerated method with several advantages particularly in methodically challenging measurement situations (e.g., during tasks involving movement or open speech), it has been shown to be confounded by systemic compounds of non-cerebral, extra-cranial origin (e.g. changes in blood pressure, heart rate). Especially event-related signal patterns induced by dilation or constriction of superficial forehead and temple veins impair the detection of frontal brain activation elicited by cognitive tasks. To further investigate this phenomenon, we conducted a simultaneous fNIRS-fMRI study applying a working memory paradigm (n-back). Extra-cranial signals were obtained by extracting the BOLD signal from fMRI voxels within the skin. To develop a filter method that corrects for extra-cranial skin blood flow, particularly intended for fNIRS data sets recorded by widely used continuous wave systems with fixed optode distances, we identified channels over the forehead with probable major extra-cranial signal contributions. The averaged signal from these channels was then subtracted from all fNIRS channels of the probe set. Additionally, the data were corrected for motion and non-evoked systemic artifacts. Applying these filters, we can show that measuring brain activation in frontal brain areas with fNIRS was substantially improved. The resulting signal resembled the fMRI parameters more closely than before the correction. Future fNIRS studies measuring functional brain activation in the forehead region need to consider the use of different filter options to correct for interfering extra-cranial signals. Copyright © 2014 Elsevier Inc. All rights reserved.
NASA Astrophysics Data System (ADS)
Guillén-Santiago, A.; Olvera, M. De La L.; Maldonado, A.; Asomoza, R.; Acosta, D. R.
2004-04-01
Conductive and highly transparent fluorine-doped zinc oxide (ZnO:F) thin films were deposited onto glass substrates by the chemical spray technique, using zinc acetate and hydrofluoric acid as precursors. Electrical, structural, morphological and optical characteristics were analyzed as a function of the ageing-time of the starting solution, alcoholic solvent type (methanol or ethanol) and the substrate temperature. The results show that these variables play a crucial role on the physical properties measured. The growth rates obtained were of 3 nm/s, showing that the chemical species involved are adequate for the film growth. The effect of the solution ageing-time on the electrical properties was monitored along three weeks. A gradual resistivity decrease with the ageing-time was observed, until a minimum value is reached, at 7 or 9 days depending on the alcohol employed. Films deposited after this time have resistivity values slightly higher. All the films were polycrystalline, with a hexagonal wurtzite structure whose preferential growth is strongly dependent on the deposition variables. Under optimal deposition conditions, ZnO:F films with a high transmittance in the visible spectrum (>85%), resistivity as low as 7 × 10-3 cm and maximum electronic mobility around of 4 cm2/(V-s) were obtained.
Postinjection L-phenylalanine increases basal ganglia contrast in PET scans of 6-18F-DOPA
DOE Office of Scientific and Technical Information (OSTI.GOV)
Doudet, D.J.; McLellan, C.A.; Aigner, T.G.
The sensitivity of 18F-DOPA positron emission tomography for imaging presynaptic dopamine systems is limited by the amount of specific-to-nonspecific accumulation of radioactivity in brain. In rhesus monkeys, we have been able to increase this ratio by taking advantage of the lag time between 18F-DOPA injection and the formation of its main metabolite, the amino acid 18F-fluoromethoxydopa, the entrance of which into brain is responsible for most of the brain's nonspecific radioactivity. By infusing an unlabeled amino acid, L-phenylalanine, starting 15 min after 18F-DOPA administration, we preferentially blocked the accumulation of 18F-fluoromethoxydopa by preventing its entrance into brain through competition atmore » the large neutral amino acid transport system of the blood-brain barrier. This method appears as reliable as the original and more sensitive, as demonstrated by the comparison of normal and MPTP-treated animals under both conditions.« less
A Low-Erosion Starting Technique for High-Performance Arcjets
NASA Technical Reports Server (NTRS)
Sankovic, John M.; Curran, Francis M.
1994-01-01
The NASA arcjet program is currently sponsoring development of high specific impulse thrusters for next generation geosynchronous communications satellites (2 kW-class) and low-power arcjets for power limited spacecraft (approx. 0.5 kW-class). Performance goals in both of these efforts will require up to 1000 starts at propellant mass flow rates significantly below those used in state-of-the-art arcjet thruster systems (i.e., high specific power levels). Reductions in mass flow rate can lead to damaging modes of operation, particularly at thruster ignition. During the starting sequence, the gas dynamic force due to low propellant flow is often insufficient to rapidly push the arc anode attachment to its steady-state position in the diverging section of the nozzle. This paper describes the development and demonstration of a technique which provides for non-damaging starts at low steady-state flow rates. The technique employs a brief propellant pressure pulse at ignition to increase gas dynamic forces during the critical ignition/transition phase of operation. Starting characteristics obtained using both pressure-pulsed and conventional starting techniques were compared across a wide range of propellant flow rates. The pressure-pulsed starting technique provided reliable starts at mass flow rates down to 21 mg/s, typically required for 700 s specific impulse level operation of 2 kW thrusters. Following the comparison, a 600 start test was performed across a wide flow rate range. Post-test inspection showed minimal erosion of critical arcjet anode/nozzle surfaces.
NASA Astrophysics Data System (ADS)
Gonzalez Hidalgo, Jose Carlos; Peña Angulo, Dhais; Salinas Solé, Celia; Jiménez Castañeda, Azucena; Brunetti, Michele
2017-04-01
One of the most interesting issues in climate analyses of trend is the comparison between different results. This is a difficult task not only because of different spatial density of information, or data format (raster or station), but also because they usually analyze different temporal periods, sometimes differing only in few years, and trend of time (climate) variables can vary dramatically accordingly length of period and starting year (Lüdecke et al., 2011). In this poster we present the global frame of an approach that during the last years has attracted the attention of some researchers: the moving windows analyze. Basically it consists in calculate the trends for all the possible period, combining length and starting year in any given series of climate variables. The analysis obviously only can be applied to one series of data (i.e. one station), and the results are usually presented in triangular diagrams. This approach has been applied to regional, national or global series both to temperature and precipitation (Brunetti et al., 2006; Liebmann et al., 2010; González.Hidalgo et al. 2010, 2016, between others). The spatial differences in the behavior of temperatures and precipitation during the last year has been noticed in many research, particularly when high density of stations has been used, so the question is how to use this approach in dozens, hundreds or thousands of stations? We present in this poster example of graphical analyses of moving windows, how to read the graphs, the possibility that this analyses offers, etc. In a sequence of posters the analyze is applied to a high-resolution grid of monthly temperatures of Spanish mainland, MOTEDAS dataset (1951-2010), at season and monthly temporal scale (see Winter-II, Spring-III, Summer-IV and Autumn-V Posters). To apply the approach we have used an ergodic transformations from time (each temporal series) to space (all the series in the same period), i.e. we present the results of season and
1 Stop/Start vehicles use a combination of regenerative and conventional friction braking to slow , The gasoline engine in a start-stop hybrid is much like those in conventional vehicles. Unlike other hybrids that use an electric motor to help power the vehicle, the engine in a start-stop hybrid is usually
powers the vehicle at low speeds, it is larger and holds much more energy than batteries used to start also used to start the gasoline engine instantly when needed. Power Split Device: The power split low speeds, it is larger and holds much more energy than batteries used to start conventional vehicles
78 FR 49372 - Notice of Availability of New Starts and Small Starts Policy Guidance
Federal Register 2010, 2011, 2012, 2013, 2014
2013-08-14
...-0009] Notice of Availability of New Starts and Small Starts Policy Guidance AGENCY: Federal Transit... Administration (FTA) is issuing final policy guidance to sponsors of New Starts and Small Starts projects. This... framework for the New Starts and Small Starts evaluation and rating process; the policy guidance complements...
40 CFR Appendix I to Part 261 - Representative Sampling Methods
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 27 2013-07-01 2013-07-01 false Representative Sampling Methods I Appendix I to Part 261 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES...—Representative Sampling Methods The methods and equipment used for sampling waste materials will vary with the...
Starting out - Patient's appreciative words taught me to look for the good in others.
Martins, Craig Alvin
2013-05-08
I remember clearly my placement in a hospice as a first-year nursing student. My thoughts when I started the placement were that it would involve death and a lot of sadness, but this was not what I found.
Improved GMP-compliant multi-dose production and quality control of 6-[18F]fluoro-L-DOPA.
Luurtsema, G; Boersma, H H; Schepers, M; de Vries, A M T; Maas, B; Zijlma, R; de Vries, E F J; Elsinga, P H
2017-01-01
6-[ 18 F]Fluoro-L-3,4-dihydroxyphenylalanine (FDOPA) is a frequently used radiopharmaceutical for detecting neuroendocrine and brain tumors and for the differential diagnosis of Parkinson's disease. To meet the demand for FDOPA, a high-yield GMP-compliant production method is required. Therefore, this study aimed to improve the FDOPA production and quality control procedures to enable distribution of the radiopharmaceutical over distances.FDOPA was prepared by electrophilic fluorination of the trimethylstannyl precursor with [ 18 F]F 2 , produced from [ 18 O] 2 via the double-shoot approach, leading to FDOPA with higher specific activity as compared to FDOPA which was synthesized, using [ 18 F]F 2 produced from 20 Ne, leading to FDOPA with a lower specific activity. The quality control of the product was performed using a validated UPLC system and compared with quality control with a conventional HPLC system. Impurities were identified using UPLC-MS. The [ 18 O] 2 double-shoot radionuclide production method yielded significantly more [ 18 F]F 2 with less carrier F 2 than the conventional method starting from 20 Ne. After adjustment of radiolabeling parameters substantially higher amounts of FDOPA with higher specific activity could be obtained. Quality control by UPLC was much faster and detected more side-products than HPLC. UPLC-MS showed that the most important side-product was FDOPA-quinone, rather than 6-hydroxydopa as suggested by the European Pharmacopoeia. The production and quality control of FDOPA were significantly improved by introducing the [ 18 O] 2 double-shoot radionuclide production method, and product analysis by UPLC, respectively. As a result, FDOPA is now routinely available for clinical practice and for distribution over distances.
iXora: exact haplotype inferencing and trait association.
Utro, Filippo; Haiminen, Niina; Livingstone, Donald; Cornejo, Omar E; Royaert, Stefan; Schnell, Raymond J; Motamayor, Juan Carlos; Kuhn, David N; Parida, Laxmi
2013-06-06
We address the task of extracting accurate haplotypes from genotype data of individuals of large F1 populations for mapping studies. While methods for inferring parental haplotype assignments on large F1 populations exist in theory, these approaches do not work in practice at high levels of accuracy. We have designed iXora (Identifying crossovers and recombining alleles), a robust method for extracting reliable haplotypes of a mapping population, as well as parental haplotypes, that runs in linear time. Each allele in the progeny is assigned not just to a parent, but more precisely to a haplotype inherited from the parent. iXora shows an improvement of at least 15% in accuracy over similar systems in literature. Furthermore, iXora provides an easy-to-use, comprehensive environment for association studies and hypothesis checking in populations of related individuals. iXora provides detailed resolution in parental inheritance, along with the capability of handling very large populations, which allows for accurate haplotype extraction and trait association. iXora is available for non-commercial use from http://researcher.ibm.com/project/3430.
Analysis of an Hp-Non-conforming Discontinuous Galerkin Spectral Element Method for Wave
2011-04-01
Scientific Computing, 36 (2008), pp. 351–390. [25] Eleuterio F . Toro , Riemann Solvers and Numerical Methods for Fluid Dynamics, Springer, 1999. [26...denoted by ñ, and the contravariant flux [15] is defined as F̃i = Jeai · F , i = 1, 2, 3, with ai as the contravariant basis vectors. We now describe...wave propagation case by the following definitions, q = ( E v ) ∈ V, Q = ( I 0 0 ρI ) , g = ( 0 f ) ∈ V, with I denoting the fourth-order identity tensor
Yam, Kai Chi; Fehr, Ryan; Barnes, Christopher M
2014-11-01
In this research, we draw from the stereotyping literature to suggest that supervisor ratings of job performance are affected by employees' start times-the time of day they first arrive at work. Even when accounting for total work hours, objective job performance, and employees' self-ratings of conscientiousness, we find that a later start time leads supervisors to perceive employees as less conscientious. These perceptions in turn cause supervisors to rate employees as lower performers. In addition, we show that supervisor chronotype acts as a boundary condition of the mediated model. Supervisors who prefer eveningness (i.e., owls) are less likely to hold negative stereotypes of employees with late start times than supervisors who prefer morningness (i.e., larks). Taken together, our results suggest that supervisor ratings of job performance are susceptible to stereotypic beliefs based on employees' start times. (PsycINFO Database Record (c) 2014 APA, all rights reserved).
Phase portraits of general f(T) cosmology
NASA Astrophysics Data System (ADS)
Awad, A.; El Hanafy, W.; Nashed, G. G. L.; Saridakis, Emmanuel N.
2018-02-01
We use dynamical system methods to explore the general behaviour of f(T) cosmology. In contrast to the standard applications of dynamical analysis, we present a way to transform the equations into a one-dimensional autonomous system, taking advantage of the crucial property that the torsion scalar in flat FRW geometry is just a function of the Hubble function, thus the field equations include only up to first derivatives of it, and therefore in a general f(T) cosmological scenario every quantity is expressed only in terms of the Hubble function. The great advantage is that for one-dimensional systems it is easy to construct the phase space portraits, and thus extract information and explore in detail the features and possible behaviours of f(T) cosmology. We utilize the phase space portraits and we show that f(T) cosmology can describe the universe evolution in agreement with observations, namely starting from a Big Bang singularity, evolving into the subsequent thermal history and the matter domination, entering into a late-time accelerated expansion, and resulting to the de Sitter phase in the far future. Nevertheless, f(T) cosmology can present a rich class of more exotic behaviours, such as the cosmological bounce and turnaround, the phantom-divide crossing, the Big Brake and the Big Crunch, and it may exhibit various singularities, including the non-harmful ones of type II and type IV. We study the phase space of three specific viable f(T) models offering a complete picture. Moreover, we present a new model of f(T) gravity that can lead to a universe in agreement with observations, free of perturbative instabilities, and applying the Om(z) diagnostic test we confirm that it is in agreement with the combination of SNIa, BAO and CMB data at 1σ confidence level.
2014-01-01
Background Mutations in pfdhfr and pfdhps genes have been shown to associate with sulphadoxine-pyrimethamine (SP) resistance of Plasmodium falciparum parasites. However, pfdhfr, pfdhps genotypes and the correlations to SP treatment outcome in Indonesia has not yet been well analysed. Methods After obtaining informed consent, 61 uncomplicated falciparum malaria patients were recruited in Banjar district, South Kalimantan Province, Indonesia, from October 2009 to August 2010. They were treated by a single oral dose of SP and its effects on clinical and parasitological status were followed until day 28 after treatment. Occasionally, a thick smear blood film for microscopy observation and blood spot on a filter paper for pfdhfr and pfdhps genotype analysis were collected. Results Pfdhfr and pfdhps genotypes from 24 P. falciparum-infected patients consisting of adequate clinical parasitological response (ACPR) (n = 6; 25.0%) and early treatment failure (ETF) (n = 10; 41.7%) or late parasitological failure (LPF) (n = 8; 33.3%) were obtained by sequencing. Two novel mutations of pfdhps gene, K540T and I588F, were determined in ten and five isolates, respectively. These mutations were present in the pfdhfr/pfdhps combined haplotypes of ANRNI/SGTGA (n = 6), ANRNL/SGTGA (n = 4), and ANRNI/SGEAA(588F) (n = 5), (mutation codons are bold typed); these haplotypes were mostly belonging to parasitological failure (ETF or LPF). The parasites acquiring five mutations in pfdhfr/pfdhps haplotypes and four mutations with additional I588F did not respond adequately to SP treatment. Conclusion Many of Plasmodium falciparum infected patients in Banjar district, South Kalimantan, Indonesia did not respond adequately to SP treatment and these low ineffectiveness of SP in this area was associated with two novel mutations of pfdhps, K540T and I588F. PMID:25187019
NASA Astrophysics Data System (ADS)
Locht, R.; Leyh, B.; Dehareng, D.; Hottmann, K.; Baumgärtel, H.
2010-01-01
The threshold photoelectron spectrum (TPES) and the constant ion state (CIS) spectra of the individual ionic states of C2H3F have been recorded using synchrotron radiation. For comparison a well-resolved HeI photoelectron spectrum (HeI-PES) has also been measured and analysed in detail. The TPES has been measured between 9.5 eV and 35 eV photon energy. Numerous vibrational structures, reported for the first time, observed in the ground state and the six excited states of the cation are analysed. Quantum chemical calculations have been performed and provide strong support to the assignments. State-selected CIS spectra highlighted the major importance of autoionization for the production of almost all ionized states of C2H3F observed in this work.
Application of artificial neural network to fMRI regression analysis.
Misaki, Masaya; Miyauchi, Satoru
2006-01-15
We used an artificial neural network (ANN) to detect correlations between event sequences and fMRI (functional magnetic resonance imaging) signals. The layered feed-forward neural network, given a series of events as inputs and the fMRI signal as a supervised signal, performed a non-linear regression analysis. This type of ANN is capable of approximating any continuous function, and thus this analysis method can detect any fMRI signals that correlated with corresponding events. Because of the flexible nature of ANNs, fitting to autocorrelation noise is a problem in fMRI analyses. We avoided this problem by using cross-validation and an early stopping procedure. The results showed that the ANN could detect various responses with different time courses. The simulation analysis also indicated an additional advantage of ANN over non-parametric methods in detecting parametrically modulated responses, i.e., it can detect various types of parametric modulations without a priori assumptions. The ANN regression analysis is therefore beneficial for exploratory fMRI analyses in detecting continuous changes in responses modulated by changes in input values.
1945-03-07
RIGHTS WHICH MAY BE INVOLVED. "WraGHTFIELD, DAyTONfÖHiÖ J $tö;>$bM#ihU*Äi!*>f-vv**K.’i»f *.. siKA .-;:- -^A^-JSkiLLAAi^ ^jjpp^pr1^-"^^^ >??w...yv it $tö;>$bM#ihU*Äi!*>f-vv**K.’i»f *.. siKA .-;:- -^A^-JSkiLLAAi^ ^jjpp^pr1^-"^^^ >??w??> ^rzr CONHDEN71AL TITLE: Methods of Production and
LRS Bianchi type-I cosmological model with constant deceleration parameter in f(R,T) gravity
NASA Astrophysics Data System (ADS)
Bishi, Binaya K.; Pacif, S. K. J.; Sahoo, P. K.; Singh, G. P.
A spatially homogeneous anisotropic LRS Bianchi type-I cosmological model is studied in f(R,T) gravity with a special form of Hubble's parameter, which leads to constant deceleration parameter. The parameters involved in the considered form of Hubble parameter can be tuned to match, our models with the ΛCDM model. With the present observed value of the deceleration parameter, we have discussed physical and kinematical properties of a specific model. Moreover, we have discussed the cosmological distances for our model.
TrustRank: a Cold-Start tolerant recommender system
NASA Astrophysics Data System (ADS)
Zou, Haitao; Gong, Zhiguo; Zhang, Nan; Zhao, Wei; Guo, Jingzhi
2015-02-01
The explosive growth of the World Wide Web leads to the fast advancing development of e-commerce techniques. Recommender systems, which use personalised information filtering techniques to generate a set of items suitable to a given user, have received considerable attention. User- and item-based algorithms are two popular techniques for the design of recommender systems. These two algorithms are known to have Cold-Start problems, i.e., they are unable to effectively handle Cold-Start users who have an extremely limited number of purchase records. In this paper, we develop TrustRank, a novel recommender system which handles the Cold-Start problem by leveraging the user-trust networks which are commonly available for e-commerce applications. A user-trust network is formed by friendships or trust relationships that users specify among them. While it is straightforward to conjecture that a user-trust network is helpful for improving the accuracy of recommendations, a key challenge for using user-trust network to facilitate Cold-Start users is that these users also tend to have a very limited number of trust relationships. To address this challenge, we propose a pre-processing propagation of the Cold-Start users' trust network. In particular, by applying the personalised PageRank algorithm, we expand the friends of a given user to include others with similar purchase records to his/her original friends. To make this propagation algorithm scalable to a large amount of users, as required by real-world recommender systems, we devise an iterative computation algorithm of the original personalised TrustRank which can incrementally compute trust vectors for Cold-Start users. We conduct extensive experiments to demonstrate the consistently improvement provided by our proposed algorithm over the existing recommender algorithms on the accuracy of recommendations for Cold-Start users.
Scenario-Based Training at the F.B.I.
ERIC Educational Resources Information Center
Whitcomb, Chris
1999-01-01
The 16-week training program offered by the FBI Academy for all new agents is a scenario-based curriculum that includes a range of subjects from the rules of evidence to defensive tactics and provides agents with a clear understanding of how to conduct a full investigation from start to finish. (JOW)
An evaluation of independent component analyses with an application to resting-state fMRI
Matteson, David S.; Ruppert, David; Eloyan, Ani; Caffo, Brian S.
2013-01-01
Summary We examine differences between independent component analyses (ICAs) arising from different as-sumptions, measures of dependence, and starting points of the algorithms. ICA is a popular method with diverse applications including artifact removal in electrophysiology data, feature extraction in microarray data, and identifying brain networks in functional magnetic resonance imaging (fMRI). ICA can be viewed as a generalization of principal component analysis (PCA) that takes into account higher-order cross-correlations. Whereas the PCA solution is unique, there are many ICA methods–whose solutions may differ. Infomax, FastICA, and JADE are commonly applied to fMRI studies, with FastICA being arguably the most popular. Hastie and Tibshirani (2003) demonstrated that ProDenICA outperformed FastICA in simulations with two components. We introduce the application of ProDenICA to simulations with more components and to fMRI data. ProDenICA was more accurate in simulations, and we identified differences between biologically meaningful ICs from ProDenICA versus other methods in the fMRI analysis. ICA methods require nonconvex optimization, yet current practices do not recognize the importance of, nor adequately address sensitivity to, initial values. We found that local optima led to dramatically different estimates in both simulations and group ICA of fMRI, and we provide evidence that the global optimum from ProDenICA is the best estimate. We applied a modification of the Hungarian (Kuhn-Munkres) algorithm to match ICs from multiple estimates, thereby gaining novel insights into how brain networks vary in their sensitivity to initial values and ICA method. PMID:24350655
Cancer Localization in the Prostate with F-18 Fluorocholine Position Emission Tomography
2008-01-01
R , Ward E, Murray T , Xu J, Thun MJ. Cancer statistics, 2007. CA...2007. 8 C C S F I l p m p t f a i l z i m m * † ‡ § S A 4 ancer Imaging With Fluorine-18–Labeled holine Derivatives andi A. Kwee, MD,*,† Timothy R ...prostate cancer imaging. v i s f b t r h i K n u f t B l t i m i F s i b a d i s w l l o t c p P i p w t h d p 422 S.A. Kwee
Left-right correlation in coupled F-center defects
DOE Office of Scientific and Technical Information (OSTI.GOV)
Janesko, Benjamin G., E-mail: b.janesko@tcu.edu
This work explores how left-right correlation, a textbook problem in electronic structure theory, manifests in a textbook example of electrons trapped in crystal defects. I show that adjacent F-center defects in lithium fluoride display symptoms of “strong” left-right correlation, symptoms similar to those seen in stretched H{sub 2}. Simulations of UV/visible absorption spectra qualitatively fail to reproduce experiment unless left-right correlation is taken into account. This is of interest to both the electronic structure theory and crystal-defect communities. Theorists have a new well-behaved system to test their methods. Crystal-defect groups are cautioned that the approximations that successfully model single F-centersmore » may fail for adjacent F-centers.« less
Gobbetti, M.; Ferranti, P.; Smacchi, E.; Goffredi, F.; Addeo, F.
2000-01-01
Two fermented milks containing angiotensin-I-converting-enzyme (ACE)-inhibitory peptides were produced by using selected Lactobacillus delbrueckii subsp. bulgaricus SS1 and L. lactis subsp. cremoris FT4. The pH 4.6-soluble nitrogen fraction of the two fermented milks was fractionated by reversed-phase fast-protein liquid chromatography. The fractions which showed the highest ACE-inhibitory indexes were further purified, and the related peptides were sequenced by tandem fast atom bombardment-mass spectrometry. The most inhibitory fractions of the milk fermented by L. delbrueckii subsp. bulgaricus SS1 contained the sequences of β-casein (β-CN) fragment 6-14 (f6-14), f7-14, f73-82, f74-82, and f75-82. Those from the milk fermented by L. lactis subsp. cremoris FT4 contained the sequences of β-CN f7-14, f47-52, and f169-175 and κ-CN f155-160 and f152-160. Most of these sequences had features in common with other ACE-inhibitory peptides reported in the literature. In particular, the β-CN f47-52 sequence had high homology with that of angiotensin-II. Some of these peptides were chemically synthesized. The 50% inhibitory concentrations (IC50s) of the crude purified fractions containing the peptide mixture were very low (8.0 to 11.2 mg/liter). When the synthesized peptides were used individually, the ACE-inhibitory activity was confirmed but the IC50s increased considerably. A strengthened inhibitory effect of the peptide mixtures with respect to the activity of individual peptides was presumed. Once generated, the inhibitory peptides were resistant to further proteolysis either during dairy processing or by trypsin and chymotrypsin. PMID:10966406
A comparison of the survival of F+RNA and F+DNA coliphages in lake water microcosms.
Long, Sharon C; Sobsey, Mark D
2004-03-01
The survival of seven F+RNA phages (MS2 Group I ATCC type strain, two Group I environmental isolates, a Group II environmental isolate, a Group III environmental isolate, and two Group IV environmental isolates) and six F+DNA phages (M13, fd, f1, and ZJ/2 ATCC type strains, and two environmental isolates) were examined in microcosms using a surface drinking water source. Phages were spiked into replicate aliquots of a source water at about 20,000 pfu/ml. Replicate spikes were incubated at 4 and 20 degrees C and monitored for 110 days. At 4 degrees C, Groups I and II F+ RNA phages were detectable through 110 days, with reductions of about 1 and 3 log10, respectively. The Group III F+RNA phage demonstrated 5 log10 reduction after 3 weeks, and the Group IV F+RNA phages were reduced to detection limits (5 log10 reduction) within 10 days. Of the F+DNA phages, all four type strains were detectable with about 2.5 log10 reduction after 110 days at 4 degrees C. The F+DNA environmental isolates were detectable with about a 4 log10 reduction after 110 days at 4 degrees C. All phages demonstrated faster decay at 20 degrees C. These results suggest that differences in F+ phage survival may influence their prevalence in environmental waters and the ability to attribute their prevalence to specific human and animal sources of faecal contamination.
Caregivers' attitudes regarding portion size served to Head Start children
USDA-ARS?s Scientific Manuscript database
The purpose of this study was to identify caregivers' attitudes regarding amounts and types of foods served to Head Start preschoolers using qualitative methods. Researchers conducted 8 focus groups (4 African American; 4 Hispanic) with 33 African American and 29 Hispanic Head Start caregivers. Mode...
Analysis of angular momentum effect on swimming kick-start performance.
Taladriz, Sonia; de la Fuente-Caynzos, Blanca; Arellano, Raúl
2016-06-14
The aim of this study was to analyse the mechanics of rotation and the temporal, angular and kinematics variables during the aerial phase for the kick-start with respect to the grab start. Nine elite swimmers (70.0 ± 7.7 kg; 178 ± 9.4 cm; 24.5 ± 5.3 years; 824 ± 119 FINA points scoring) performed the starts on the OMEGA OSB11 starting block followed by 5 m gliding at maximum velocity. Nineteen comparisons of kinematics variables across start technique were performed with critical alpha adjusted using a Holm's correction to maintain an experiment-wise type I error rate of p <0.05. The differences were statistically evaluated by T-test and Wilcoxon test. Significant advantages for the kick-start were observed in all temporal variables (except in the flight time) and in the vertical take-off velocity. Similarities in the centre of mass angular momentum at take-off (120.89 ± 17.66, 126.61 ± 13.51 s(-1).10(-3), p-value <0.294; kick-start and grab start) caused that KS did not increase the temporal advantages obtained on the block at 5 m distance. Two different rotational movements were found for both techniques. A displacement of the rear leg and front leg on the block and during the flight respectively permits a higher lower limbs position relative to the trunk at hands entry for kick-start. However, larger rotational movement of the trunk characterized grab start. It was concluded that shorter block times and rotational displacements of the lower limbs on the block and flight phase are the key of the best performance for kick-start at 5 m distance. Copyright © 2016 Elsevier Ltd. All rights reserved.
Code of Federal Regulations, 2012 CFR
2012-07-01
... appendix F requirements to evaluate continuous emission monitoring systems? 60.1245 Section 60.1245... Commenced After June 6, 2001 Continuous Emission Monitoring § 60.1245 Am I exempt from any appendix B or... carbon dioxide) continuous emission monitoring system. Therefore, your oxygen (or carbon dioxide...
FEDAL SYSTEM OPERATION DURING STATION START-UP. Test Results (T-643734). Core I, Seed 2. Section I
DOE Office of Scientific and Technical Information (OSTI.GOV)
None
An investigation was conducted to determine if any failed blanket fuel elements exist in core locations previously found to have high levels of delayed neutron emitter activity. Data from Fedal System monitors indicate that J5 may have a failed blanket element, there is no evidence of failure at core location F7. (J.R.D.)
Association of Taq I, Fok I and Apa I polymorphisms in Vitamin D Receptor (VDR) gene with leprosy.
Neela, Venkata Sanjeev Kumar; Suryadevara, Naveen Chandra; Shinde, Vidya Gouri; Pydi, Satya Sudheer; Jain, Suman; Jonnalagada, Subbanna; Singh, Surya Satyanarayana; Valluri, Vijaya Lakshmi; Anandaraj, M P J S
2015-06-01
Vitamin D Receptor (VDR) is a transacting transcription factor which mediates immunomodulatory function and plays a key role in innate and adaptive immune responses through its ligand and polymorphisms in VDR gene may affect its regulatory function. To investigate the association of three VDR gene polymorphisms (TaqI rs731236, FokI rs2228570 and ApaI rs7975232) with leprosy. The study group includes 404 participants of which 222 were leprosy patients (paucibacillary=87, multibacillary=135) and 182 healthy controls. Genotyping was done using PCR-RFLP technique. Statistical analysis was performed using SNP Stats and PLINK software. The VDR FokI (rs2228570) ff genotype, ApaI (rs7975232) AA, Aa genotype and haplotype T-f-a, T-F-A were positively associated with leprosy when compared to healthy controls. The two variants at Fok and Apa positions in VDR gene are significantly associated with leprosy. Genotypes at FokI (ff), ApaI (aa) and haplotype (T-F-a, T-f-a) may contribute to the risk of developing leprosy by altering VDR phenotype/levels subsequently modulation of immune response. Copyright © 2015 American Society for Histocompatibility and Immunogenetics. Published by Elsevier Inc. All rights reserved.
A wavelet method for modeling and despiking motion artifacts from resting-state fMRI time series.
Patel, Ameera X; Kundu, Prantik; Rubinov, Mikail; Jones, P Simon; Vértes, Petra E; Ersche, Karen D; Suckling, John; Bullmore, Edward T
2014-07-15
The impact of in-scanner head movement on functional magnetic resonance imaging (fMRI) signals has long been established as undesirable. These effects have been traditionally corrected by methods such as linear regression of head movement parameters. However, a number of recent independent studies have demonstrated that these techniques are insufficient to remove motion confounds, and that even small movements can spuriously bias estimates of functional connectivity. Here we propose a new data-driven, spatially-adaptive, wavelet-based method for identifying, modeling, and removing non-stationary events in fMRI time series, caused by head movement, without the need for data scrubbing. This method involves the addition of just one extra step, the Wavelet Despike, in standard pre-processing pipelines. With this method, we demonstrate robust removal of a range of different motion artifacts and motion-related biases including distance-dependent connectivity artifacts, at a group and single-subject level, using a range of previously published and new diagnostic measures. The Wavelet Despike is able to accommodate the substantial spatial and temporal heterogeneity of motion artifacts and can consequently remove a range of high and low frequency artifacts from fMRI time series, that may be linearly or non-linearly related to physical movements. Our methods are demonstrated by the analysis of three cohorts of resting-state fMRI data, including two high-motion datasets: a previously published dataset on children (N=22) and a new dataset on adults with stimulant drug dependence (N=40). We conclude that there is a real risk of motion-related bias in connectivity analysis of fMRI data, but that this risk is generally manageable, by effective time series denoising strategies designed to attenuate synchronized signal transients induced by abrupt head movements. The Wavelet Despiking software described in this article is freely available for download at www
Performance of blind source separation algorithms for fMRI analysis using a group ICA method.
Correa, Nicolle; Adali, Tülay; Calhoun, Vince D
2007-06-01
Independent component analysis (ICA) is a popular blind source separation technique that has proven to be promising for the analysis of functional magnetic resonance imaging (fMRI) data. A number of ICA approaches have been used for fMRI data analysis, and even more ICA algorithms exist; however, the impact of using different algorithms on the results is largely unexplored. In this paper, we study the performance of four major classes of algorithms for spatial ICA, namely, information maximization, maximization of non-Gaussianity, joint diagonalization of cross-cumulant matrices and second-order correlation-based methods, when they are applied to fMRI data from subjects performing a visuo-motor task. We use a group ICA method to study variability among different ICA algorithms, and we propose several analysis techniques to evaluate their performance. We compare how different ICA algorithms estimate activations in expected neuronal areas. The results demonstrate that the ICA algorithms using higher-order statistical information prove to be quite consistent for fMRI data analysis. Infomax, FastICA and joint approximate diagonalization of eigenmatrices (JADE) all yield reliable results, with each having its strengths in specific areas. Eigenvalue decomposition (EVD), an algorithm using second-order statistics, does not perform reliably for fMRI data. Additionally, for iterative ICA algorithms, it is important to investigate the variability of estimates from different runs. We test the consistency of the iterative algorithms Infomax and FastICA by running the algorithm a number of times with different initializations, and we note that they yield consistent results over these multiple runs. Our results greatly improve our confidence in the consistency of ICA for fMRI data analysis.
Structure-seeking multilinear methods for the analysis of fMRI data.
Andersen, Anders H; Rayens, William S
2004-06-01
In comprehensive fMRI studies of brain function, the data structures often contain higher-order ways such as trial, task condition, subject, and group in addition to the intrinsic dimensions of time and space. While multivariate bilinear methods such as principal component analysis (PCA) have been used successfully for extracting information about spatial and temporal features in data from a single fMRI run, the need to unfold higher-order data sets into bilinear arrays has led to decompositions that are nonunique and to the loss of multiway linkages and interactions present in the data. These additional dimensions or ways can be retained in multilinear models to produce structures that are unique and which admit interpretations that are neurophysiologically meaningful. Multiway analysis of fMRI data from multiple runs of a bilateral finger-tapping paradigm was performed using the parallel factor (PARAFAC) model. A trilinear model was fitted to a data cube of dimensions voxels by time by run. Similarly, a quadrilinear model was fitted to a higher-way structure of dimensions voxels by time by trial by run. The spatial and temporal response components were extracted and validated by comparison to results from traditional SVD/PCA analyses based on scenarios of unfolding into lower-order bilinear structures.
NASA Technical Reports Server (NTRS)
Pinson, Robin M.; Schmitt, Terri L.; Hanson, John M.
2008-01-01
Six degree-of-freedom (DOF) launch vehicle trajectories are designed to follow an optimized 3-DOF reference trajectory. A vehicle has a finite amount of control power that it can allocate to performing maneuvers. Therefore, the 3-DOF trajectory must be designed to refrain from using 100% of the allowable control capability to perform maneuvers, saving control power for handling off-nominal conditions, wind gusts and other perturbations. During the Ares I trajectory analysis, two maneuvers were found to be hard for the control system to implement; a roll maneuver prior to the gravity turn and an angle of attack maneuver immediately after the J-2X engine start-up. It was decided to develop an approach for creating smooth maneuvers in the optimized reference trajectories that accounts for the thrust available from the engines. A feature of this method is that no additional angular velocity in the direction of the maneuver has been added to the vehicle after the maneuver completion. This paper discusses the equations behind these new maneuvers and their implementation into the Ares I trajectory design cycle. Also discussed is a possible extension to adjusting closed-loop guidance.
Quantum I/f noise in infrared detectors and scanning tunneling microscopes
NASA Astrophysics Data System (ADS)
Truong, Amanda Marie
Noise is, by definition, any random and persistent disturbance, which interferes with the clarity of a signal. Modern electronic devices are designed to limit noise, and in most cases the classical forms of noise have been eliminated or greatly reduced through careful design. However, there is a fundamental, quite unavoidable type of noise, called quantum l/f noise, which occurs at low frequencies and is a fundamental consequence of the discrete nature of the charge carriers themselves. This quantum l/f noise is present in any physical cross section or process rate, such as carrier mobility, diffusion rates and scattering processes. Although quantum l/f noise has been observed for nearly a century, there has been much debate over its origin and formulation. But as modern electronic devices require greater levels of performance and detection, the l/f noise phenomenon has moved to the forefront, becoming the subject of intense research. Here, for the first time, the quantum l/f fluctuations present in both the dark current of the Quantum Well Intersubband Photodetector and the tunneling current of the Scanning Tunneling Microscope are investigated. Using the quantum l/f theory, the quantum l/f noise occurring in each of these devices is formulated. The theoretical noise results are then compared with the experimental findings of various authors with very good agreement. This important work provides a foundation for understanding quantum l/f noise and its causes in the QWIP and STM devices, and could ultimately lead to improved technology and noise reduction in these devices and others.
Rapid starting methanol reactor system
Chludzinski, Paul J.; Dantowitz, Philip; McElroy, James F.
1984-01-01
The invention relates to a methanol-to-hydrogen cracking reactor for use with a fuel cell vehicular power plant. The system is particularly designed for rapid start-up of the catalytic methanol cracking reactor after an extended shut-down period, i.e., after the vehicular fuel cell power plant has been inoperative overnight. Rapid system start-up is accomplished by a combination of direct and indirect heating of the cracking catalyst. Initially, liquid methanol is burned with a stoichiometric or slightly lean air mixture in the combustion chamber of the reactor assembly. The hot combustion gas travels down a flue gas chamber in heat exchange relationship with the catalytic cracking chamber transferring heat across the catalyst chamber wall to heat the catalyst indirectly. The combustion gas is then diverted back through the catalyst bed to heat the catalyst pellets directly. When the cracking reactor temperature reaches operating temperature, methanol combustion is stopped and a hot gas valve is switched to route the flue gas overboard, with methanol being fed directly to the catalytic cracking reactor. Thereafter, the burner operates on excess hydrogen from the fuel cells.
Peterson, Lanell M; O'Sullivan, Janet; Wu, Qian Vicky; Novakova-Jiresova, Alena; Jenkins, Isaac; Lee, Jean H; Shields, Andrew; Montgomery, Susan; Linden, Hannah M; Gralow, Julie R; Gadi, Vijayakrishna K; Muzi, Mark; Kinahan, Paul E; Mankoff, David A; Specht, Jennifer M
2018-05-10
Assessing therapy response of breast cancer bone metastases is challenging. In retrospective studies, serial 18 F-FDG PET was predictive of time to skeletal related events (tSRE) and time-to-progression (TTP). 18 F-NaF PET improves bone metastasis detection compared to bone scans. We prospectively tested 18 F-FDG PET and 18 F-NaF PET to predict tSRE, TTP, and overall survival (OS) in patients with bone-dominant metastatic breast cancer (BD MBC). Methods: Patients with BD MBC were imaged with 18 F-FDG PET and 18 F-NaF PET prior to starting new therapy (scan1) and again at a range of times centered around approximately 4 months later (scan2). SUV max and SULpeak were recorded for a single index lesion and up to 5 most dominant lesions for each scan. tSRE, TTP, and OS were assessed exclusive of the PET images. Univariate Cox regression was performed to test the association between clinical endpoints and 18 F-FDG PET and 18 F-NaF PET measures. mPERCIST (Modified PET Response Criteria in Solid Tumors) criteria were also applied. Survival curves for mPERCIST compared response categories of Complete Response+Partial Response+Stable Disease versus Progressive Disease (CR+PR+SD vs PD) for tSRE, TTP, and OS. Results: Twenty-eight patients were evaluated. Higher FDG SULpeak at scan2 predicted shorter time to tSRE ( P = <0.001) and TTP ( P = 0.044). Higher FDG SUV max at scan2 predicted a shorter time to tSRE ( P = <0.001). A multivariable model using FDG SUV max of the index lesion at scan1 plus the difference in SUV max of up to 5 lesions between scans was predictive for tSRE and TTP. Among 24 patients evaluable by 18 F-FDG PET mPERCIST, tSRE and TTP were longer in responders (CR, PR, or stable) compared to non-responders (PD) ( P = 0.007, 0.028 respectively), with a trend toward improved survival ( P = 0.1). An increase in the uptake between scans of up to 5 lesions by 18 F-NaF PET was associated with longer OS ( P = 0.027). Conclusion: Changes in 18 F-FDG PET parameters
NASA Astrophysics Data System (ADS)
Page, M. D.; Waclawik, E. R.; Holloway, J. H.; Legon, A. C.
1999-10-01
The ground-state rotational spectra of the isotopomers CH 3C 14N⋯ 35ClF, CH 3C 14N⋯ 37ClF, CD 3C 14N⋯ 35ClF and CH 3C 15N⋯ 35ClF of a symmetric-rotor complex formed by methyl cyanide and chlorine monofluoride have been observed and analysed to give the spectroscopic constants B0, DJ, DJK, χaa( 14N), χaa(Cl) and Mbb. Interpretations of these quantities on the basis of simple models enabled the geometry and strength of binding of the complex to be determined. It is found that the atoms C-CN⋯ClF lie on the C 3 axis of this complex of C 3v symmetry and that the distance r(N⋯Cl)=2.561(2) Å. The quadratic force constants associated with the intermolecular stretching mode and with the bending motion of the CH 3CN subunit pivoted at its mass centre were determined from the centrifugal distortion constants DJ and 2 DJ+ DJK. Their values were k σ=13.9(3) N m -1 and k α=3.0(1)×10 -20 J rad -2, respectively. A comparison of r(N⋯Cl) values and of k σ values establishes that the +I effect of the CH 3 group when it replaces H in HCN leads to a similar shortening of r(N⋯Cl) and to a similar increase in k σ in the two series RCN⋯ClF and RCN⋯HCl (R=H or CH 3).
Federal Register 2010, 2011, 2012, 2013, 2014
2013-06-03
... Activity, The Gas Company, LLC dba Hawai'i Gas, Subzone 9F (Synthetic Natural Gas), Kapolei, Hawaii The Gas... May 22, 2013. The subzone currently has authority to produce synthetic natural gas, carbon dioxide... during customs entry procedures that apply to synthetic natural gas, carbon dioxide, hydrogen...
Transient line starting analysis of the ultra-high speed PMSM
Cheng, Wenjie; Li, Wei; Xiao, ling; Li, Ming; Tian, Yongsheng; Sun, Yanhua; Yu, Lie
2017-01-01
Aiming at the ultra high speed permanent magnet synchronous motor (PMSM) supported by gas foil bearings (GFBs), this paper calculates the transient line starting of the motor. Firstly, the start effect of the rotor composed of cylindrical PM and stainless steel sleeve is studied. Then, in order to enhance the start torque, copper ring, nickel ring and copper squirrel-cage are introduced in the rotor and their start effect are analysed, respectively. It can be found that the rotor including nickel ring can be accelerated to set speed, but all the other rotors are failed due to the higher PM and braking torques. It can be concluded that some material owning slight large relative permeability can be applied in the rotor to reduce the PM field and contribute to start by using the line-start method. PMID:28105384
Molecular Dynamic Simulation Reveals Damaging Impact of RAC1 F28L Mutation in the Switch I Region
Sethumadhavan, Rao; Purohit, Rituraj
2013-01-01
Ras-related C3 botulinum toxin substrate 1 (RAC1) is a plasma membrane-associated small GTPase which cycles between the active GTP-bound and inactive GDP-bound states. There is wide range of evidences indicating its active participation in inducing cancer-associated phenotypes. RAC1 F28L mutation (RACF28L) is a fast recycling mutation which has been implicated in several cancer associated cases. In this work we have performed molecular docking and molecular dynamics simulation (~0.3 μs) to investigate the conformational changes occurring in the mutant protein. The RMSD, RMSF and NHbonds results strongly suggested that the loss of native conformation in the Switch I region in RAC1 mutant protein could be the reason behind its oncogenic transformation. The overall results suggested that the mutant protein attained compact conformation as compared to the native. The major impact of mutation was observed in the Switch I region which might be the crucial reason behind the loss of interaction between the guanine ring and F28 residue. PMID:24146998
U.S. EPA, Pesticide Product Label, KELTHANE 4F, 09/22/1981
2011-04-14
... i)t'~" :t' "t 'r,Hlt" "t·, .. , f', ." I', .j" rI~ 11<;,',1 I", ~':J~ In <. d·,r,n"" ... t' ·RITO(>..~ B ll.j:,h .<, f,>(, " r·· •• "j<.. t~·f', '1'• d<." "~dr 't' ,:>t" l'1t f <':"_10(" ...
Polyadenylation site prediction using PolyA-iEP method.
Kavakiotis, Ioannis; Tzanis, George; Vlahavas, Ioannis
2014-01-01
This chapter presents a method called PolyA-iEP that has been developed for the prediction of polyadenylation sites. More precisely, PolyA-iEP is a method that recognizes mRNA 3'ends which contain polyadenylation sites. It is a modular system which consists of two main components. The first exploits the advantages of emerging patterns and the second is a distance-based scoring method. The outputs of the two components are finally combined by a classifier. The final results reach very high scores of sensitivity and specificity.
Planning and Reviewing for Success. Training Guides for the Head Start Learning Community.
ERIC Educational Resources Information Center
Aspen Systems Corp., Rockville, MD.
This guide offers Head Start staff a blueprint for developing the skills and methods necessary for a Head Start program's planning and review process. The guide stresses the need for Head Start administrative and managerial leadership to maintain a holistic, integrated approach; use the strength and resources of Head Start team members; identify…
1995-03-13
A Vought F-8A Crusader was selected by NASA as the testbed aircraft (designated TF-8A) to install an experimental Supercritical Wing (SCW) in place of the conventional wing. The unique design of the Supercritical Wing reduces the effect of shock waves on the upper surface near Mach 1, which in turn reduces drag. In the photograph the TF-8A Crusader with the Supercritical Wing is shown on static display in front of the NASA Dryden Flight Research Center, Edwards, California. The F-8 SCW aircraft, along with the F-8 Digital Fly-By-Wire aircraft were placed on display on May 27, 1992, at a conference marking the 20th anniversary of the start of the two programs.
Jones, R. E.; Ward, D. K.
2016-07-18
Here, given the unique optical properties of LiF, it is often used as an observation window in high-temperature and -pressure experiments; hence, estimates of its transmission properties are necessary to interpret observations. Since direct measurements of the thermal conductivity of LiF at the appropriate conditions are difficult, we resort to molecular simulation methods. Using an empirical potential validated against ab initio phonon density of states, we estimate the thermal conductivity of LiF at high temperatures (1000–4000 K) and pressures (100–400 GPa) with the Green-Kubo method. We also compare these estimates to those derived directly from ab initio data. To ascertainmore » the correct phase of LiF at these extreme conditions, we calculate the (relative) phase stability of the B1 and B2 structures using a quasiharmonic ab initio model of the free energy. We also estimate the thermal conductivity of LiF in an uniaxial loading state that emulates initial stages of compression in high-stress ramp loading experiments and show the degree of anisotropy induced in the conductivity due to deformation.« less
Zhang, Fen-Fen; Jiang, Meng-Hong; Sun, Lin-Lin; Zheng, Feng; Dong, Lei; Shah, Vishva; Shen, Wen-Bin; Ding, Ya
2015-01-07
To expand the application scope of nuclear magnetic resonance (NMR) technology in quantitative analysis of pharmaceutical ingredients, (19)F nuclear magnetic resonance ((19)F-NMR) spectroscopy has been employed as a simple, rapid, and reproducible approach for the detection of a fluorine-containing model drug, sitagliptin phosphate monohydrate (STG). ciprofloxacin (Cipro) has been used as the internal standard (IS). Influential factors, including the relaxation delay time (d1) and pulse angle, impacting the accuracy and precision of spectral data are systematically optimized. Method validation has been carried out in terms of precision and intermediate precision, linearity, limit of detection (LOD) and limit of quantification (LOQ), robustness, and stability. To validate the reliability and feasibility of the (19)F-NMR technology in quantitative analysis of pharmaceutical analytes, the assay result has been compared with that of (1)H-NMR. The statistical F-test and student t-test at 95% confidence level indicate that there is no significant difference between these two methods. Due to the advantages of (19)F-NMR, such as higher resolution and suitability for biological samples, it can be used as a universal technology for the quantitative analysis of other fluorine-containing pharmaceuticals and analytes.
Jensen, O; Gabre, P; Sköld, U M; Birkhed, D; Povlsen, L
2014-05-01
The aim of this study was to explore the oral health professionals' (OHPs') perspectives regarding their strategies, considerations and methods when teaching their patients the most effective way of toothbrushing with fluoride (F) toothpaste. A qualitative research method was used to collect data. To stimulate interactivity among the participants, interviews were performed in focus groups. Five groups of OHPs, including dentists, dental hygienists and dental nurses, were interviewed a total of 23 individuals. The interviews were analysed using manifest and latent qualitative content analysis. Data were systematically condensed and coded to the relevant phrases that identified their content. Three categories were identified in the manifest and latent content analysis: (i) strategies and intentions, (ii) providing oral hygiene information and instruction and (iii) barriers to optimal oral healthcare education. Health promotion and seeing to the patients' best interest were driving forces among the OHPs as well as personal success in their preventive work. They focused on toothbrushing techniques more than on how to use F toothpaste. Barriers to oral health information were cost to the patients and, to some extent, the opinion of the OHPs that some patients were impossible to motivate or that patients already know what to do. The OHPs described toothbrushing with F toothpaste as very important, although the plaque removal perspective dominated. They did not focus on how to use F toothpaste, because they believed that knowledge about and appropriate behaviour concerning F toothpaste were already familiar to their patients. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Lessons learned: design, start-up, and operation of cryogenic systems
NASA Astrophysics Data System (ADS)
Bell, W. M.; Bagley, R. E.; Motew, S.; Young, P.-W.
2014-11-01
Cryogenic systems involving a pumped cryogenic fluid, such as liquid nitrogen (LN2), require careful design since the cryogen is close to its boiling point and cold. At 1 atmosphere, LN2 boils at 77.4 K (-320.4 F). These systems, typically, are designed to transport the cryogen, use it for process heat removal, or for generation of gas (GN2) for process use. As the design progresses, it is important to consider all aspects of the design including, cryogen storage, pressure control and safety relief systems, thermodynamic conditions, equipment and instrument selection, materials, insulation, cooldown, pump start-up, maximum design and minimum flow rates, two phase flow conditions, heat flow, process control to meet and maintain operating conditions, piping integrity, piping loads on served equipment, warm-up, venting, and shut-down. "Cutting corners" in the design process can result in stalled start-ups, field rework, schedule hits, or operational restrictions. Some of these "lessoned learned" are described in this paper.
30 CFR 250.1504 - May I use alternative training methods?
Code of Federal Regulations, 2010 CFR
2010-07-01
... must be conducted according to, and meet the objectives of, your training plan. ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I use alternative training methods? 250... Safety Training § 250.1504 May I use alternative training methods? You may use alternative training...
Becker, Brandon D.; Herman, Allison N.; Gooze, Rachel A.
2013-01-01
Introduction Despite attention to the health of low-income children in Head Start, little is known about the health of adults working for the program. The objective of our study was to compare the physical and mental health of women working in Pennsylvania Head Start programs with the health of US women who have similar sociodemographic characteristics. Methods We used data from a web-based survey in 2012 in which 2,199 of 3,375 (65.2%) staff in 66 Pennsylvania Head Start programs participated. For the 2,122 female respondents, we determined the prevalence of fair or poor health status, frequent (≥14 d/mo) unhealthy days, frequent (≥10 d/y) work absences due to illness, diagnosed depression, and 3 or more of 6 physical health conditions. We compared these prevalences with those found in 2 national samples of employed women of similar age, education, race/ethnicity, and marital status. Results Among Head Start staff, 85.7% were non-Hispanic white, 62.4% were married, and 60.3% had completed college. The prevalence (% [95% confidence interval]) of several health indicators was higher in Head Start staff than in the national samples: fair or poor health (14.6% [13.1%–16.1%] vs 5.1% [4.5%–5.6%]), frequent unhealthy days (28.3% [26.3%–30.2%] vs 14.5% [14.1%–14.9%]), diagnosed depression (23.5% [21.7%–25.3%] vs 17.6% [17.1%–18.0%]), and 3 or more physical health conditions (21.8% [20.0%–23.6%] vs 12.6% [11.7%–13.5%]). Conclusion Women working with children in Head Start programs have poorer physical and mental health than do US women who have similar sociodemographic characteristics. PMID:24176085
Epstein, Richard H; Dexter, Franklin
2012-03-01
Anesthesia groups may wish to decrease the supervision ratio for nontrainee providers. Because hospitals offer many first-case starts and focus on starting these cases on time, the number of anesthesiologists needed is sensitive to this ratio. The number of operating rooms that an anesthesiologist can supervise concurrently is determined by the probability of multiple simultaneous critical portions of cases (i.e., requiring presence) and the availability of cross-coverage. A simulation study showed peak occurrence of critical portions during first cases, and frequent supervision lapses. These predictions were tested using real data from an anesthesia information management system. The timing and duration of critical portions of cases were determined from 1 yr of data at a tertiary care hospital. The percentages of days with at least one supervision lapse occurring at supervision ratios between 1:1 and 1:3 were determined. Even at a supervision ratio of 1:2, lapses occurred on 35% of days (lower 95% confidence limit = 30%). The peak incidence occurred before 8:00 AM, P < 0.0001 for the hypothesis that most (i.e., >50%) lapses occurred before this time. The average time from operating room entry until ready for prepping and draping (i.e., anesthesia release time) during first case starts was 22.2 min (95% confidence interval 21.8-22.8 min). Decreasing the supervision ratio from 1:2 to 1:3 has a large effect on supervision lapses during first-case starts. To mitigate such lapses, either staggered starts or additional anesthesiologists working at the start of the day would be required.
Having your cake and eating it too; effective engagement in start-ups from an academic seat
NASA Astrophysics Data System (ADS)
Mirkin, Chad
2012-02-01
In order for scientific advances to have a positive impact on society, they must be successfully transitioned from conceptually fundamental endeavors in academic research laboratories to valuable enabling technologies at start-up companies. Nanosphere, NanoInk, and AuraSense are three start-up companies that have been spun out of Northwestern based on research initiated in my laboratory. These companies are focused on commercializing nanotechnology-based applications in the life science and semiconductor industries and have turned discoveries from my lab into viable commercial products. For example, several of the systems developed at these start-ups are in the clinical trial phase, with one already approved by the FDA, and they are poised to have a positive world-wide impact. Herein, I discuss the challenges associated with identifying commercial value in academic research projects, securing intellectual property, forming a company as a legal entity, and locating sources of start-up funds. Further, I will discuss the rewards of venturing into such enterprises and the ways of ensuring a start-up company's long-term success, while juggling the numerous responsibilities of an academic seat. I argue that these two activities are done not in competition, but rather are integral for driving the type of high-level, synergistic scientific research that is being done today.
Getting started with package sampSurf
Jeffrey H. Gove
2014-01-01
The sampSurf package is designed to facilitate the comparison of new and existing areal sampling methods through simulation. The package is thoroughly documented in several vignettes as mentioned below. This document is meant to point you in the right direction in finding the needed information to get started using sampSurf.
A method to quantify at late imaging a release rate of 18F-FDG in tissues.
Laffon, Eric; Allard, Michèle; Marthan, Roger; Ducassou, Dominique
2005-08-01
This theoretical work shows that the rate constant for the (18)F-FDG release in tissues can be assessed without needing any arterial blood sampling. The method requires that the clearance of (18)F-FDG from plasma has occurred, whereas (18)F-FDG is still present in the tissue. This condition can be met dating from 3 h after (18)F-FDG injection, when hydration and/or phlorizin injection are applied after the routine static acquisition. The release rate constant can be obtained from a graphical analysis performed at the later decreasing phase of the tissue tracer activity. A two-compartment and a three-compartment model are developed, both in accordance with one another. To cite this article: E. Laffon et al., C. R. Biologies 328 (2005).
Later Start, Longer Sleep: Implications of Middle School Start Times
ERIC Educational Resources Information Center
Temkin, Deborah A.; Princiotta, Daniel; Ryberg, Renee; Lewin, Daniel S.
2018-01-01
Background: Although adolescents generally get less than the recommended 9 hours of sleep per night, research and effort to delay school start times have generally focused on high schools. This study assesses the relation between school start times and sleep in middle school students while accounting for potentially confounding demographic…
Brede, Dag Anders; Lothe, Sheba; Salehian, Zhian; Faye, Therese; Nes, Ingolf F.
2007-01-01
This report describes the first functional analysis of a bacteriocin immunity gene from Propionibacterium freudenreichii and its use as a selection marker for food-grade cloning. Cloning of the pcfI gene (previously orf5 [located as part of the pcfABC propionicin F operon]) rendered the sensitive host 1,000-fold more tolerant to the propionicin F bacteriocin. The physiochemical properties of the 127-residue large PcfI protein resemble those of membrane-bound immunity proteins from bacteriocin systems found in lactic acid bacteria. The high level of immunity conferred by pcfI allowed its use as a selection marker for plasmid transformation in P. freudenreichii. Electroporation of P. freudenreichii IFO12426 by use of the pcfI expression plasmid pSL102 and propionicin F selection (200 bacteriocin units/ml) yielded 107 transformants/μg DNA. The 2.7-kb P. freudenreichii food-grade cloning vector pSL104 consists of the pLME108 replicon, a multiple cloning site, and pcfI expressed from the constitutive PpampS promoter for selection. The pSL104 vector efficiently facilitated cloning of the propionicin T1 bacteriocin in P. freudenreichii. High-level propionicin T1 production (640 BU/ml) was obtained with the IFO12426 strain, and the food-grade propionicin T1 expression plasmid pSL106 was maintained by ∼91% of the cells over 25 generations in the absence of selection. To the best of our knowledge this is the first report of an efficient cloning system that facilitates the generation of food-grade recombinant P. freudenreichii strains. PMID:17933941
Sintupachee, Siriluk; Promden, Worrawat; Ngamrojanavanich, Nattaya; Sitthithaworn, Worapan; De-Eknamkul, Wanchai
2015-10-01
While attempting to isolate the enzyme geranylgeraniol 18-hydroxylase, which is involved in plaunotol biosynthesis in Croton stellatopilosus (Cs), the cDNAs for a cytochrome P450 monooxygenase(designated as CYP76F45) and an NADPH-cytochrome P450 reductase (designated as CPR I based on its classification) were isolated from the leaf. The CYP76F45 and CsCPR I genes have open reading frames (ORFs) encoding 507- and 711-amino acid proteins with predicted relative molecular weights of 56.7 and 79.0 kDa,respectively. Amino acid sequence comparison showed that both CYP76F45 (63–73%) and CsCPR I (79–83%) share relatively high sequence identities with homologous proteins in other plant species.Phylogenetic tree analysis confirmed that CYP76F45 belongs to the CYP76 family and that CsCPR I belongs to Class I of dicotyledonous CPRs, with both being closely related to Ricinus communis genes. Functional characterization of both enzymes, each expressed separately in Escherichia coli as recombinant proteins,showed that only simultaneous incubation of the membrane bound proteins with the substrate geraniol (GOH) and the coenzyme NADPH could form 8-hydroxygeraniol. The enzyme mixture could also utilize acyclic sesquiterpene farnesol (FOH) with a comparable substrate preference ratio (GOH:FOH) of 54:46. The levelsof the CYP76F45 and CsCPR I transcripts in the shoots, leaves and twigs of C. stellatopilosus were correlated with the levels of a major monoterpenoid indole alkaloid, identified tentatively as 19-Evallesamine,that accumulated in these plant parts. These results suggested that CYP76F45 and CPR I function as the enzyme geraniol-8-hydroxylase (G8H), which is likely to be involved in the biosynthesis of the indole alkaloid in C. stellatopilosus [corrected]. Copyright © 2015 Elsevier Ltd. All rights reserved.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 9 2013-07-01 2013-07-01 false Am I exempt from any 40 CFR part 60... Emission Monitoring § 62.15190 Am I exempt from any 40 CFR part 60 appendix B or appendix F requirements to... emission monitoring system require you to also evaluate your oxygen (or carbon dioxide) continuous emission...
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 9 2012-07-01 2012-07-01 false Am I exempt from any 40 CFR part 60... Emission Monitoring § 62.15190 Am I exempt from any 40 CFR part 60 appendix B or appendix F requirements to... emission monitoring system require you to also evaluate your oxygen (or carbon dioxide) continuous emission...
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 9 2014-07-01 2014-07-01 false Am I exempt from any 40 CFR part 60... Emission Monitoring § 62.15190 Am I exempt from any 40 CFR part 60 appendix B or appendix F requirements to... emission monitoring system require you to also evaluate your oxygen (or carbon dioxide) continuous emission...
Identifying Head Start Children for Higher Tiers of Language and Literacy Instruction
ERIC Educational Resources Information Center
Albritton, Kizzy; Stuckey, Adrienne; Patton Terry, Nicole
2017-01-01
The application of Response to Intervention (RtI) to early childhood settings presents many opportunities and challenges; however, it remains unclear how best to implement this framework in settings in which children at risk of academic difficulty are overrepresented, like Head Start. One of the first steps in implementing any RtI process is the…
NASA Astrophysics Data System (ADS)
Sirait, Kamson; Tulus; Budhiarti Nababan, Erna
2017-12-01
Clustering methods that have high accuracy and time efficiency are necessary for the filtering process. One method that has been known and applied in clustering is K-Means Clustering. In its application, the determination of the begining value of the cluster center greatly affects the results of the K-Means algorithm. This research discusses the results of K-Means Clustering with starting centroid determination with a random and KD-Tree method. The initial determination of random centroid on the data set of 1000 student academic data to classify the potentially dropout has a sse value of 952972 for the quality variable and 232.48 for the GPA, whereas the initial centroid determination by KD-Tree has a sse value of 504302 for the quality variable and 214,37 for the GPA variable. The smaller sse values indicate that the result of K-Means Clustering with initial KD-Tree centroid selection have better accuracy than K-Means Clustering method with random initial centorid selection.
Vandenberg AFB, California. Limited Surface Observations Climatic Summary (LISOCS). Parts A-F.
1985-06-01
TSURFACE WINDS BE .T S I i/, AZ PERCENTAGE FREQUENCY OF WIND DIRECTION AND SPEED (FROM HOURLY OBSERVATIONS) TATION STATION AM lAll COSTS CLASSl MOUSl (LI t...6 VARIL_. Ii CALM - _ _ _ _ _ _ _ _ _ _ _ TOTAL NUMBER OF OBSERVATIONS USAFETAC TO099 DES (OL A) PREVIOUS EDITIONS 0F THIS F0ORM AWE OSOLETE...I .. . . El....,,l IX) ll , x I i.IObl. MIe. Mo. of HIo...l .’II. TIpO ..?,.O IJ ~ .Hm 3l# :I R,.I. .n’. -, -. * +O sJ32P o6iF .73p *IlOp .93F T...I
Federal Register 2010, 2011, 2012, 2013, 2014
2012-10-11
...-0001] Agency Information Collection Activities: Petition for Alien Fianc[eacute](e), Form I-129F.../Collection: Petition for Alien Fianc[eacute](e). (3) Agency form number, if any, and the applicable component... United States in order to petition for an alien fianc[eacute](e), spouse, or his/her children. (5) An...
Kirjavainen, Anna K; Forsback, Sarita; López-Picón, Francisco R; Marjamäki, Päivi; Takkinen, Jatta; Haaparanta-Solin, Merja; Peters, Dan; Solin, Olof
2018-01-01
Several psychiatric and neurodegenerative diseases are associated with malfunction of brain norepinephrine transporter (NET). However, current clinical evaluations of NET function are limited by the lack of sufficiently sensitive methods of detection. To this end, we have synthesized exo-3-[(6-[ 18 F]fluoro-2-pyridyl)oxy]-8-azabicyclo[3.2.1]-octane ([ 18 F]NS12137) as a radiotracer for positron emission tomography (PET) and have demonstrated that it is highly specific for in vivo detection of NET-rich regions of rat brain tissue. We applied two methods of electrophilic, aromatic radiofluorination of the precursor molecule, exo-3-[(6-trimethylstannyl-2-pyridyl)oxy]-8-azabicyclo-[3.2.1]octane-8-carboxylate: (1) direct labeling with [ 18 F]F 2 , and (2) labeling with [ 18 F]Selectfluor, a derivative of [ 18 F]F 2 , using post-target produced [ 18 F]F 2 . The time-dependent distribution of [ 18 F]NS12137 in brain tissue of healthy, adult Sprague-Dawley rats was determined by ex vivo autoradiography. The specificity of [ 18 F]NS12137 binding was demonstrated on the basis of competitive binding by nisoxetine, a known NET antagonist of high specificity. [ 18 F]NS12137 was successfully synthesized with radiochemical yields of 3.9% ± 0.3% when labeled with [ 18 F]F 2 and 10.2% ± 2.7% when labeled with [ 18 F]Selectfluor. The molar activity of radiotracer was 8.8 ± 0.7 GBq/μmol with [ 18 F]F 2 labeling and 6.9 ± 0.4 GBq/μmol with [ 18 F]Selectfluor labeling at the end of synthesis of [ 18 F]NS12137. Uptake of [ 18 F]NS12137 in NET-rich areas in rat brain was demonstrated with the locus coeruleus (LCoe) having the highest regional uptake. Prior treatment of rats with nisoxetine showed no detectable [ 18 F]NS12137 in the LCoe. Analyses of whole brain samples for radiometabolites showed only the parent compound [ 18 F]NS12137. Uptake of 18 F-radioactivity in bone increased with time. The two electrophilic 18 F-labeling methods proved to be suitable for synthesis of [ 18 F
Optimizing methods for linking cinematic features to fMRI data.
Kauttonen, Janne; Hlushchuk, Yevhen; Tikka, Pia
2015-04-15
One of the challenges of naturalistic neurosciences using movie-viewing experiments is how to interpret observed brain activations in relation to the multiplicity of time-locked stimulus features. As previous studies have shown less inter-subject synchronization across viewers of random video footage than story-driven films, new methods need to be developed for analysis of less story-driven contents. To optimize the linkage between our fMRI data collected during viewing of a deliberately non-narrative silent film 'At Land' by Maya Deren (1944) and its annotated content, we combined the method of elastic-net regularization with the model-driven linear regression and the well-established data-driven independent component analysis (ICA) and inter-subject correlation (ISC) methods. In the linear regression analysis, both IC and region-of-interest (ROI) time-series were fitted with time-series of a total of 36 binary-valued and one real-valued tactile annotation of film features. The elastic-net regularization and cross-validation were applied in the ordinary least-squares linear regression in order to avoid over-fitting due to the multicollinearity of regressors, the results were compared against both the partial least-squares (PLS) regression and the un-regularized full-model regression. Non-parametric permutation testing scheme was applied to evaluate the statistical significance of regression. We found statistically significant correlation between the annotation model and 9 ICs out of 40 ICs. Regression analysis was also repeated for a large set of cubic ROIs covering the grey matter. Both IC- and ROI-based regression analyses revealed activations in parietal and occipital regions, with additional smaller clusters in the frontal lobe. Furthermore, we found elastic-net based regression more sensitive than PLS and un-regularized regression since it detected a larger number of significant ICs and ROIs. Along with the ISC ranking methods, our regression analysis proved
Preparing Specialized Undergraduate Pilot Training Graduates for F-35A Training
2010-06-11
the two sides of this argument and analyze the new data acquired from an F-22A lead-in program and the fact that the F-35A has started flying with...flight operations under Instrument or Visual Flight Rules to include day / night IFR operations in the terminal and enroute environment. Have limited
DeepIED: An epileptic discharge detector for EEG-fMRI based on deep learning.
Hao, Yongfu; Khoo, Hui Ming; von Ellenrieder, Nicolas; Zazubovits, Natalja; Gotman, Jean
2018-01-01
Presurgical evaluation that can precisely delineate the epileptogenic zone (EZ) is one important step for successful surgical resection treatment of refractory epilepsy patients. The noninvasive EEG-fMRI recording technique combined with general linear model (GLM) analysis is considered an important tool for estimating the EZ. However, the manual marking of interictal epileptic discharges (IEDs) needed in this analysis is challenging and time-consuming because the quality of the EEG recorded inside the scanner is greatly deteriorated compared to the usual EEG obtained outside the scanner. This is one of main impediments to the widespread use of EEG-fMRI in epilepsy. We propose a deep learning based semi-automatic IED detector that can find the candidate IEDs in the EEG recorded inside the scanner which resemble sample IEDs marked in the EEG recorded outside the scanner. The manual marking burden is greatly reduced as the expert need only edit candidate IEDs. The model is trained on data from 30 patients. Validation of IEDs detection accuracy on another 37 consecutive patients shows our method can improve the median sensitivity from 50.0% for the previously proposed template-based method to 84.2%, with false positive rate as 5 events/min. Reproducibility validation on 15 patients is applied to evaluate if our method can produce similar hemodynamic response maps compared with the manual marking ground truth results. We explore the concordance between the maximum hemodynamic response and the intracerebral EEG defined EZ and find that both methods produce similar percentage of concordance (76.9%, 10 out of 13 patients, electrode was absent in the maximum hemodynamic response in two patients). This tool will make EEG-fMRI analysis more practical for clinical usage.
"I Am Much More than Just a Mum". Social Capital, Empowerment and Sure Start
ERIC Educational Resources Information Center
Bagley, Carl; Ackerley, Clare L.
2006-01-01
An earlier article published in this journal sought to recover the views of professionals concerned with the delivery and implementation of a "Third Way" multiagency programme tackling the social exclusion of young children and their families known as Sure Start. The tentative findings suggested a "bottom-up" partnership…
Generation of the Starting Plane Flowfield for Supersonic Flow over a Spherically Capped Body
1985-05-09
1.26419b 1.142020 1.418790 1.49bbb9 1.5723211 AKC LENGTH HMS Of SHOCK SHfKn= -U.040ti3T 0.040n37 U.12223b 0.202H24 0.2a?liS6...0 00*32lM/.*0 0 00*3BB»/*0 0 Ofl*3F*l/*0 0 00*4///9*0 0 00*396F9*0 II 00*3666>;*0 0 00*3969^*0 0 00*3/ Hm *0 0 00*3FH/*°0 n 00*3I6F**0 00...0.10B9k.Ol 25 0.1344F.01 0.i;F...l «. HM .^, .00 «.W..lt-ol ...l.M.JF.nl •’•^^’’’ *" ^^q^^::o oiibBE.oS 0 s’.UE.Ol O.bOJbE.Ol
Babiker, Abdel G; Emery, Sean; Fätkenheuer, Gerd; Gordin, Fred M; Grund, Birgit; Lundgren, Jens D; Neaton, James D; Pett, Sarah L; Phillips, Andrew; Touloumi, Giota; Vjecha, Michael J
2012-01-01
Background Untreated human immunodeficiency virus (HIV) infection is characterized by progressive depletion of CD4+ T lymphocyte (CD4) count leading to the development of opportunistic diseases (acquired immunodeficiency syndrome (AIDS)), and more recent data suggest that HIV is also associated with an increased risk of serious non-AIDS (SNA) diseases including cardiovascular, renal, and liver diseases and non-AIDS-defining cancers. Although combination antiretroviral treatment (ART) has resulted in a substantial decrease in morbidity and mortality in persons with HIV infection, viral eradication is not feasible with currently available drugs. The optimal time to start ART for asymptomatic HIV infection is controversial and remains one of the key unanswered questions in the clinical management of HIV-infected individuals. Purpose In this article, we outline the rationale and methods of the Strategic Timing of AntiRetroviral Treatment (START) study, an ongoing multicenter international trial designed to assess the risks and benefits of initiating ART earlier than is currently practiced. We also describe some of the challenges encountered in the design and implementation of the study and how these challenges were addressed. Methods A total of 4000 study participants who are HIV type 1 (HIV-1) infected, ART naïve with CD4 count > 500 cells/μL are to be randomly allocated in a 1:1 ratio to start ART immediately (early ART) or defer treatment until CD4 count is <350 cells/ μL (deferred ART) and followed for a minimum of 3 years. The primary outcome is time to AIDS, SNA, or death. The study had a pilot phase to establish feasibility of accrual, which was set as the enrollment of at least 900 participants in the first year. Results Challenges encountered in the design and implementation of the study included the limited amount of data on the risk of a major component of the primary endpoint (SNA) in the study population, changes in treatment guidelines when the pilot
Deriving earth science products from SSM/I
NASA Technical Reports Server (NTRS)
Wentz, Frank J.
1995-01-01
A few of the major accomplishments during the second phase include: (1) all three Special Sensor Microwave Imagers (SSM/I's: F08, F10, and F11) have been cross-calibrated; (2) a very large, quality-controlled, collocated SSM/I and radiosonde data set has been produced; (3) the SSM/I-radiosonde and SSM/I-buoy data sets have been used to calibrate the SSM/I ocean retrieval algorithm; (4) ocean products have been produced for both F10 and F11 SSM/I for 1991-1993; (5) the SSM/I-buoy data set was used to better determine the variation of the ocean T(sub B) with wind direction; and (6) it was demonstrated that under high wind conditions, wind direction information can be obtained from individual SSM/I observations.
Meng, Ying; Shen, Fei; Yuan, Hairong; Zou, Dexun; Liu, Yanping; Zhu, Baoning; Chufo, Akiber; Jaffar, Muhammad; Li, Xiujin
2014-11-01
Batch anaerobic digestion was employed to investigate the efficient start-up strategies for the liquefied food waste, and sequencing batch digestion was also performed to determine maximum influent organic loading rate (OLR) for efficient and stable operation. The results indicated that the start-up could be well improved using appropriate wastewater organic load and food-to-microorganism ratios (F/M). When digestion was initialized at low chemical oxygen demand (COD) concentration of 20.0 gCOD L(-1), the start-up would go well using lower F/M ratio of 0.5-0.7. The OLR 7.0 gCOD L(-1) day(-1) was recommended for operating the ASBR digestion, in which the COD conversion of 96.7 ± 0.53% and biomethane yield of 3.5 ± 0.2 L gCOD(-1) were achieved, respectively. The instability would occur when OLR was higher than 7.0 gCOD L(-1) day(-1), and this instability was not recoverable. Lipid was suggested to be removed before anaerobic digestion. The anaerobic digestion process in engineering project ran well, and good performance was achieved when the start-up and operational strategies from laboratory study were applied. For case application, stable digestion performance was achieved in a digester (850 m(3) volume) with biogas production of 1.0-3.8 m(3) m(-3) day(-1).
Maggioni, Eleonora; Tana, Maria Gabriella; Arrigoni, Filippo; Zucca, Claudio; Bianchi, Anna Maria
2014-05-15
Functional Magnetic Resonance Imaging (fMRI) is used for exploring brain functionality, and recently it was applied for mapping the brain connection patterns. To give a meaningful neurobiological interpretation to the connectivity network, it is fundamental to properly define the network framework. In particular, the choice of the network nodes may affect the final connectivity results and the consequent interpretation. We introduce a novel method for the intra subject topological characterization of the nodes of fMRI brain networks, based on a whole brain parcellation scheme. The proposed whole brain parcellation algorithm divides the brain into clusters that are homogeneous from the anatomical and functional point of view, each of which constitutes a node. The functional parcellation described is based on the Tononi's cluster index, which measures instantaneous correlation in terms of intrinsic and extrinsic statistical dependencies. The method performance and reliability were first tested on simulated data, then on a real fMRI dataset acquired on healthy subjects during visual stimulation. Finally, the proposed algorithm was applied to epileptic patients' fMRI data recorded during seizures, to verify its usefulness as preparatory step for effective connectivity analysis. For each patient, the nodes of the network involved in ictal activity were defined according to the proposed parcellation scheme and Granger Causality Analysis (GCA) was applied to infer effective connectivity. We showed that the algorithm 1) performed well on simulated data, 2) was able to produce reliable inter subjects results and 3) led to a detailed definition of the effective connectivity pattern. Copyright © 2014 Elsevier B.V. All rights reserved.
76 FR 37174 - Capital Investment Program-New Starts and Small Starts Program Funds
Federal Register 2010, 2011, 2012, 2013, 2014
2011-06-24
... DEPARTMENT OF TRANSPORTATION Federal Transit Administration Capital Investment Program--New Starts... apportionment of the FY 2011 Capital Investment (New Starts and Small Starts) program funds. The funds will be... FY 2011, $1,596,800,000 was appropriated for the Capital Investments Grant Account, which includes...
11 CFR 300.71 - Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)).
Code of Federal Regulations, 2010 CFR
2010-01-01
....71 Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)). No individual described in 11 CFR 300.70 shall spend any funds for a public communication that refers to a clearly... limitations, prohibitions, and reporting requirements of the Act. See definition of public communication at 11...
11 CFR 300.71 - Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)).
Code of Federal Regulations, 2011 CFR
2011-01-01
....71 Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)). No individual described in 11 CFR 300.70 shall spend any funds for a public communication that refers to a clearly... limitations, prohibitions, and reporting requirements of the Act. See definition of public communication at 11...
11 CFR 300.71 - Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)).
Code of Federal Regulations, 2014 CFR
2014-01-01
....71 Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)). No individual described in 11 CFR 300.70 shall spend any funds for a public communication that refers to a clearly... limitations, prohibitions, and reporting requirements of the Act. See definition of public communication at 11...
11 CFR 300.71 - Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)).
Code of Federal Regulations, 2013 CFR
2013-01-01
....71 Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)). No individual described in 11 CFR 300.70 shall spend any funds for a public communication that refers to a clearly... limitations, prohibitions, and reporting requirements of the Act. See definition of public communication at 11...
11 CFR 300.71 - Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)).
Code of Federal Regulations, 2012 CFR
2012-01-01
....71 Federal funds required for certain public communications (2 U.S.C. 441i(f)(1)). No individual described in 11 CFR 300.70 shall spend any funds for a public communication that refers to a clearly... limitations, prohibitions, and reporting requirements of the Act. See definition of public communication at 11...
Sheldon, E M; Downar, J B
2000-08-15
Novel approaches to the development of analytical procedures for monitoring incoming starting material in support of chemical/pharmaceutical processes are described. High technology solutions were utilized for timely process development and preparation of high quality clinical supplies. A single robust HPLC method was developed and characterized for the analysis of the key starting material from three suppliers. Each supplier used a different process for the preparation of this material and, therefore, each suppliers' material exhibited a unique impurity profile. The HPLC method utilized standard techniques acceptable for release testing in a QC/manufacturing environment. An automated experimental design protocol was used to characterize the robustness of the HPLC method. The method was evaluated for linearity, limit of quantitation, solution stability, and precision of replicate injections. An LC-MS method that emulated the release HPLC method was developed and the identities of impurities were mapped between the two methods.
Where to start with pest control
; Environment Human Health Animal Health Safe Use Practices Food Safety Environment Air Water Soil Wildlife Ingredients Low-Risk Pesticides Organic Pesticide Ingredients Pesticide Incidents Human Exposure Pet Exposure :00PM Pacific Time, Mon-Fri A B C D E F G H I J K L M N O P Q R S T U V W X Y Z A-Z Index Health &
The Backstroke Swimming Start: State of the Art
de Jesus, Karla; de Jesus, Kelly; Fernandes, Ricardo J.; Vilas-Boas, João Paulo; Sanders, Ross
2014-01-01
As sprint swimming events can be decided by margins as small as .01 s, thus, an effective start is essential. This study reviews and discusses the ‘state of the art’ literature regarding backstroke start biomechanics from 23 documents. These included two swimming specific publications, eight peer-reviewed journal articles, three from the Biomechanics and Medicine in Swimming Congress series, eight from the International Society of Biomechanics in Sports Conference Proceedings, one from a Biomechanics Congress and one academic (PhD) thesis. The studies had diverse aims, including swimmers’ proficiency levels and data collection settings. There was no single consensus for defining phase descriptions; and kinematics, kinetics and EMG approaches were implemented in laboratory settings. However, researchers face great challenges in improving methods of quantifying valid, reliable and accurate data between laboratory and competition conditions. For example, starting time was defined from the starting signal to distances as disparate as ∼5 m to 22.86 m in several studies. Due to recent rule changes, some of the research outcomes now refer to obsolete backstroke start techniques, and only a few studies considered the actual international rules. This literature review indicated that further research is required, in both laboratory and competition settings focusing on the combined influences of the current rules and block configuration on backstroke starting performances. PMID:25414737
40 CFR 63.5425 - When must I start recordkeeping to determine my compliance ratio?
Code of Federal Regulations, 2012 CFR
2012-07-01
...) and (2) of this section: (1) If the startup of your new or reconstructed affected source is before... February 27, 2002. (2) If the startup of your new or reconstructed affected source is after February 27, 2002, then you must start recordkeeping to determine your compliance ratio upon startup of your...
40 CFR 63.5425 - When must I start recordkeeping to determine my compliance ratio?
Code of Federal Regulations, 2013 CFR
2013-07-01
...) and (2) of this section: (1) If the startup of your new or reconstructed affected source is before... February 27, 2002. (2) If the startup of your new or reconstructed affected source is after February 27, 2002, then you must start recordkeeping to determine your compliance ratio upon startup of your...
40 CFR 63.5425 - When must I start recordkeeping to determine my compliance ratio?
Code of Federal Regulations, 2011 CFR
2011-07-01
... this section: (1) If the startup of your new or reconstructed affected source is before February 27..., 2002. (2) If the startup of your new or reconstructed affected source is after February 27, 2002, then you must start recordkeeping to determine your compliance ratio upon startup of your affected source...
40 CFR 63.5425 - When must I start recordkeeping to determine my compliance ratio?
Code of Federal Regulations, 2010 CFR
2010-07-01
... this section: (1) If the startup of your new or reconstructed affected source is before February 27..., 2002. (2) If the startup of your new or reconstructed affected source is after February 27, 2002, then you must start recordkeeping to determine your compliance ratio upon startup of your affected source...
40 CFR 63.5425 - When must I start recordkeeping to determine my compliance ratio?
Code of Federal Regulations, 2014 CFR
2014-07-01
...) and (2) of this section: (1) If the startup of your new or reconstructed affected source is before... February 27, 2002. (2) If the startup of your new or reconstructed affected source is after February 27, 2002, then you must start recordkeeping to determine your compliance ratio upon startup of your...
Dover AFB Delaware. Revised Uniform Summary of Surface Weather Observations. Parts A-F
1974-08-07
8217 C IN @1 iN 2,2 71 SE 5, _ I _____. ws . 2,. A,’ , S _____ __ . _____ ____Sw . , 2, - :j ih , I. I I 12 .. SSWA NABE O2 .O 1.4 a CIO.S921 0 soi 4... SY HrsOMthTprat u MMA c Pe. H. AFD573 t ) 91660R 77 0 41 0 2-408b- 0_F_32_F_67_F73_F _8__F_ 93_ _ol I’- a ii-E 29(,06 899 3*CE/MA296.C4.19 -4- -E _1
ERIC Educational Resources Information Center
Zhang, Chenyi; Hur, Jinhee; Diamond, Karen E.; Powell, Douglas
2015-01-01
This study examined the classroom writing environment in 31 Head Start classrooms, and explored the relations between the writing environment, children's (N = 262) name-writing, and children's letter knowledge using pathway analysis. Our analyses showed that Head Start classrooms provided opportunities (i.e., writing materials and teachers'…
On a difficulty in eigenfunction expansion solutions for the start-up of fluid flow
NASA Astrophysics Data System (ADS)
Christov, Ivan C.
2015-11-01
Most mathematics and engineering textbooks describe the process of ``subtracting off'' the steady state of a linear parabolic partial differential equation as a technique for obtaining a boundary-value problem with homogeneous boundary conditions that can be solved by separation of variables (i.e., eigenfunction expansions). While this method produces the correct solution for the start-up of the flow of, e.g., a Newtonian fluid between parallel plates, it can lead to erroneous solutions to the corresponding problem for a class of non-Newtonian fluids. We show that the reason for this is the non-rigorous enforcement of the start-up condition in the textbook approach, which leads to a violation of the principle of causality. Nevertheless, these boundary-value problems can be solved correctly using eigenfunction expansions, and we present the formulation that makes this possible (in essence, an application of Duhamel's principle). The solutions obtained by this new approach are shown to agree identically with those obtained by using the Laplace transform in time only, a technique that enforces the proper start-up condition implicitly (hence, the same error cannot be committed). Supported, in part, by NSF Grant DMS-1104047 and the U.S. DOE (Contract No. DE-AC52-06NA25396) through the LANL/LDRD Program.
1976-05-01
attached to the wing or under the fuselage.__ DD ’JO77,S 1473 EDITION OF NOV 61 IS OBSOLETE UNICLASSIFILEDV~D.n SEUIYC ASIIAINOFTI -E %inDI I...cruciform fins. 61 7 Shock shape deduced from flow field properties. (a) M D 1. 5. 62 7 Continued. (b) MW = 2.0 63 7 Concluded. (c) M. = 2.5. 64 8 Flow...equation (14) h panel span, figure 2 K constant associated with line source strength function f(•), equation (I-8) SKd constant associated with line
34 CFR 200.80 - Migrant Education Even Start Program definition.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 34 Education 1 2012-07-01 2012-07-01 false Migrant Education Even Start Program definition. 200.80 Section 200.80 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION, DEPARTMENT OF EDUCATION TITLE I-IMPROVING THE ACADEMIC ACHIEVEMENT OF THE...
ERIC Educational Resources Information Center
Research Assessment Management, Inc., Silver Spring, MD.
A quality Head Start facility should provide a physical environment responsive both to the needs of the children and families served and to the needs of staff, volunteers, and community agencies that share space with Head Start. This manual is a tool for Head Start grantees and delegate agencies for assessing existing facilities, making…
Improved Manufacturing Methods for Navy Peacoats
1991-09-30
oaeration requir= S a heavy ;;erd, feed machine II n CC T is can e done either with a r I 2 .’" ark buttonhoie loc-tion with the I Ir fo I...AD-A243 702 F A S H I 0 N I INSTITUTE OF TECHNOLOGYI R E S EARCH DTIC I REPORT SELECTEI.. D D I IMPROVED MANUFACTURING METHODS FOR NAVY PEACOATS I I...A008. I IHenr A/Seesselberg Dir ctor, Advanced Apparel Manufacturing Technology Programs, Fashion Institute of Technology I Noah Bronner Research
Development of functional imaging in the human brain (fMRI); the University of Minnesota experience
Uğurbil, Kâmil
2012-01-01
The human functional magnetic resonance imaging (fMRI) experiments performed in the Center for Magnetic Resonance Research (CMRR), University of Minnesota, were planned between two colleagues who had worked together previously in Bell Laboratories in the late nineteen seventies, namely myself and Seiji Ogawa. These experiments were motivated by the Blood Oxygenation Level Dependent (BOLD) contrast developed by Seiji. We discussed and planned human studies to explore imaging human brain activity using the BOLD mechanism on the 4 Tesla human system that I was expecting to receive for CMRR. We started these experiments as soon as this 4 Tesla instrument became marginally operational. These were the very first studies performed on the 4 Tesla scanner in CMRR; had the scanner became functional earlier, they would have been started earlier as well. We had positive results certainly by August 1991 annual meeting of the Society of Magnetic Resonance in Medicine (SMRM) and took some of the data with us to that meeting. I believe, however, that neither the MGH colleagues nor us, at the time, had enough data and/or conviction to publish these extraordinary observations; it took more or less another six months or so before the papers from these two groups were submitted for publication within five days of each other to the Proceedings of the National Academy of Sciences, USA, after rejections by Nature. Based on this record, it is fair to say that fMRI was achieved independently and at about the same time at MGH, in an effort credited largely to Ken Kwong, and in CMRR, University of Minnesota in an effort led by myself and Seiji Ogawa. PMID:22342875
Solenoid-free plasma start-up in spherical tokamaks
NASA Astrophysics Data System (ADS)
Raman, R.; Shevchenko, V. F.
2014-10-01
The central solenoid is an intrinsic part of all present-day tokamaks and most spherical tokamaks. The spherical torus (ST) confinement concept is projected to operate at high toroidal beta and at a high fraction of the non-inductive bootstrap current as required for an efficient reactor system. The use of a conventional solenoid in a ST-based fusion nuclear facility is generally believed to not be a possibility. Solenoid-free plasma start-up is therefore an area of extensive worldwide research activity. Solenoid-free plasma start-up is also relevant to steady-state tokamak operation, as the central transformer coil of a conventional aspect ratio tokamak reactor would be located in a high radiation environment but would be needed only during the initial discharge initiation and current ramp-up phases. Solenoid-free operation also provides greater flexibility in the selection of the aspect ratio and simplifies the reactor design. Plasma start-up methods based on induction from external poloidal field coils, helicity injection and radio frequency current drive have all made substantial progress towards meeting this important need for the ST. Some of these systems will now undergo the final stages of test in a new generation of large STs, which are scheduled to begin operations during the next two years. This paper reviews research to date on methods for inducing the initial start-up current in STs without reliance on the conventional central solenoid.
Miao, Jianyin; Chen, Feilong; Duan, Shan; Gao, Xiangyang; Liu, Guo; Chen, Yunjiao; Dixon, William; Xiao, Hang; Cao, Yong
2015-08-19
Antimicrobial peptides have received increasing attention in the agricultural and food industries due to their potential to control pathogens. However, to facilitate the development of novel peptide-based antimicrobial agents, details regarding the molecular mechanisms of these peptides need to be elucidated. The aim of this study was to investigate the antimicrobial mechanism of peptide F1, a bacteriocin found in Tibetan kefir, against Escherichia coli at protein levels using iTRAQ-based quantitative proteomic analysis. In response to treatment with peptide F1, 31 of the 280 identified proteins in E. coli showed alterations in their expression, including 10 down-regulated proteins and 21 up-regulated proteins. These 31 proteins all possess different molecular functions and are involved in different molecular pathways, as is evident in referencing the Kyoto Encyclopedia of Genes and Genomes pathways. Specifically, pathways that were significantly altered in E. coli in response to peptide F1 treatment include the tricarboxylic acid cycle, oxidative phosphorylation, glycerophospholipid metabolism, and the cell cycle-caulobacter pathways, which was also associated with inhibition of the cell growth, induction of morphological changes, and cell death. The results provide novel insights into the molecular mechanisms of antimicrobial peptides.
Bairl, A; Müller, P
1998-11-01
The TnphoA-induced Bradyrhizobium japonicum mutant 184 shows slow growth and aberrant colonization of soybean nodules. Using a DNA fragment adjacent to the transposon insertion site as a probe, a 3.4-kb BglII fragment of B. japonicum 110spc4 DNA was identified and cloned. Sequence analysis indicated that two truncated ORFs and three complete ORFs were encoded on this fragment. A database search revealed homologies to several other prokaryotic proteins: PdxJ (an enzyme involved in vitamin B6 biosynthesis), AcpS (acyl carrier protein synthase), Lep or Sip (prokaryotic type I signal peptidase), RNase III (an endoribonuclease which processes double-stranded rRNA precursors and mRNA) and Era (a GTP-binding protein required for cell division). The mutation in strain 184 was found to lie within the signal peptidase gene, which was designated sipF. Therefore, sipF is located in a region that encodes gene products involved in posttranscriptional and posttranslational processing processes. By complementation of the lep(ts) E. coli mutant strain IT41 it was demonstrated that sipF indeed encodes a functional signal peptidase, and genetic complementation of B. japonicum mutant 184 by a 2.8-kb SalI fragment indicated that sipF is expressed from a promoter located directly upstream of sipF. Using a non-polar kanamycin resistance cassette, a specific sipF mutant was constructed which exhibited defects in symbiosis similar to those of the original mutant 184.
Code of Federal Regulations, 2014 CFR
2014-01-01
... 7 Agriculture 1 2014-01-01 2014-01-01 false If I want to use these procedures to have USDA consider my complaint, how long will it take for USDA to make a decision? 15f.3 Section 15f.3 Agriculture... USDA consider my complaint, how long will it take for USDA to make a decision? To the maximum extent...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 7 Agriculture 1 2012-01-01 2012-01-01 false If I want to use these procedures to have USDA consider my complaint, how long will it take for USDA to make a decision? 15f.3 Section 15f.3 Agriculture... USDA consider my complaint, how long will it take for USDA to make a decision? To the maximum extent...
Code of Federal Regulations, 2010 CFR
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false If I want to use these procedures to have USDA consider my complaint, how long will it take for USDA to make a decision? 15f.3 Section 15f.3 Agriculture... USDA consider my complaint, how long will it take for USDA to make a decision? To the maximum extent...
Code of Federal Regulations, 2011 CFR
2011-01-01
... 7 Agriculture 1 2011-01-01 2011-01-01 false If I want to use these procedures to have USDA consider my complaint, how long will it take for USDA to make a decision? 15f.3 Section 15f.3 Agriculture... USDA consider my complaint, how long will it take for USDA to make a decision? To the maximum extent...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 7 Agriculture 1 2013-01-01 2013-01-01 false If I want to use these procedures to have USDA consider my complaint, how long will it take for USDA to make a decision? 15f.3 Section 15f.3 Agriculture... USDA consider my complaint, how long will it take for USDA to make a decision? To the maximum extent...
Evaluating the Social Validity of the Early Start Denver Model: A Convergent Mixed Methods Study.
Ogilvie, Emily; McCrudden, Matthew T
2017-09-01
An intervention has social validity to the extent that it is socially acceptable to participants and stakeholders. This pilot convergent mixed methods study evaluated parents' perceptions of the social validity of the Early Start Denver Model (ESDM), a naturalistic behavioral intervention for children with autism. It focused on whether the parents viewed (a) the ESDM goals as appropriate for their children, (b) the intervention procedures as acceptable and appropriate, and (c) whether changes in their children's behavior was practically significant. Parents of four children who participated in the ESDM completed the TARF-R questionnaire and participated in a semi-structured interview. Both data sets indicated that parents rated their experiences with the ESDM positively and rated it as socially-valid. The findings indicated that what was implemented in the intervention is complemented by how it was implemented and by whom.
Covalent character and electric field dependence of H2-AgX (X = F - I).
Li, Xinying
2018-06-16
Mechanisms of Ag-X and Ag…H 2 interactions and stabilities of T-shaped H 2 -AgX (X = F - I) series were investigated at the CCSD(T) level. The "no-density" bond with smaller positive Laplacian and ELF values in interaction regions, as well as considerable delocalization index values, suggest weak covalent "charge-shift" character for the Ag…H 2 interaction. Structure and stability dependence on the electric field were investigated at the MP2 level. Relative total energy curves show obvious parabolic character, and the plots can be fitted by quadratic polynomials as functions of electric field strength.
An improved 2D MoF method by using high order derivatives
NASA Astrophysics Data System (ADS)
Chen, Xiang; Zhang, Xiong
2017-11-01
The MoF (Moment of Fluid) method is one of the most accurate approaches among various interface reconstruction algorithms. Alike other second order methods, the MoF method needs to solve an implicit optimization problem to obtain the optimal approximate interface, so an iteration process is inevitable under most circumstances. In order to solve the optimization efficiently, the properties of the objective function are worthy of studying. In 2D problems, the first order derivative has been deduced and applied in the previous researches. In this paper, the high order derivatives of the objective function are deduced on the convex polygon. We show that the nth (n ≥ 2) order derivatives are discontinuous, and the number of the discontinuous points is two times the number of the polygon edge. A rotation algorithm is proposed to successively calculate these discontinuous points, thus the target interval where the optimal solution is located can be determined. Since the high order derivatives of the objective function are continuous in the target interval, the iteration schemes based on high order derivatives can be used to improve the convergence rate. Moreover, when iterating in the target interval, the value of objective function and its derivatives can be directly updated without explicitly solving the volume conservation equation. The direct update makes a further improvement of the efficiency especially when the number of edges of the polygon is increasing. The Halley's method, which is based on the first three order derivatives, is applied as the iteration scheme in this paper and the numerical results indicate that the CPU time is about half of the previous method on the quadrilateral cell and is about one sixth on the decagon cell.
First Born amplitude for transitions from a circular state to a state of large (l, m)
NASA Astrophysics Data System (ADS)
Dewangan, D. P.
2005-01-01
The use of cylindrical polar coordinates instead of the conventional spherical polar coordinates enables us to derive compact expressions of the first Born amplitude for some selected sets of transitions from an arbitrary initial circular \\big|\\psi_{n_i,n_i-1,n_i-1}\\big\\rangle state to a final \\big|\\psi_{n_f,l_f,m_f}\\big\\rangle state of large (lf, mf). The formulae for \\big|\\psi_{n_i,n_i-1,n_i-1}\\big\\rangle \\longrightarrow \\big|\\psi_{n_f,n_f-1,n_f-2}\\big\\rangle and \\big|\\psi_{n_i,n_i-1,n_i-1}\\big\\rangle \\longrightarrow \\big|\\psi_{n_f,n_f-1,n_f-3}\\big\\rangle transitions are expressed in terms of the Jacobi polynomials which serve as suitable starting points for constructing complete solutions over the bound energy levels of hydrogen-like atoms. The formulae for \\big|\\psi_{n_i,n_i-1,n_i-1}\\big\\rangle \\longrightarrow \\big|\\psi_{n_f,n_f-1,-(n_f-2)}\\big\\rangle and \\big|\\psi_{n_i,n_i-1,n_i-1}\\big\\rangle \\longrightarrow \\big|\\psi_{n_f,n_f-1,-(n_f-3)}\\big\\rangle transitions are in simple algebraic forms and are directly applicable to all possible values of ni and nf. It emerges that the method can be extended to evaluate the first Born amplitude for many other transitions involving states of large (l, m).
Teaching Beginning Reading Sounds to Head Start Youngsters.
ERIC Educational Resources Information Center
Von Hilsheimer, Catherine
The effectiveness of the Three Owls Reading Method was tested, using 53 children from a Head Start program. The Three Owls system combines sight, phonic, and linguistic reading methods with movement and touch modes of instruction. After a pretest for phonic letter recognition, the students were matched and assigned to one of two classes in a…
A 7.5-Year Dataset of SSM/I-Derived Surface Turbulent Fluxes Over Global Oceans
NASA Technical Reports Server (NTRS)
Chou, Shu-Hsien; Shie, Chung-Lin; Atlas, Robert M.; Adizzone, Joe; Nelkin, Eric; Starr, David OC. (Technical Monitor)
2001-01-01
The global air-sea turbulent fluxes are needed for driving ocean models and validating coupled ocean-atmosphere global models. A method was developed to retrieve surface air humidity from the radiances measured by the Special Sensor Microwave/Imager (SSM/I) Using both SSM/I-retrieved surface wind and air humidity, they computed daily turbulent fluxes over global oceans with a stability-dependent bulk scheme. Based on this method, we have produced Version 1 of Goddard Satellite-Based Surface Turbulent Fluxes (GSSTF) dataset from the SSM/I data and other data. It provides daily- and monthly-mean surface turbulent fluxes and some relevant parameters over global oceans for individual F8, F10, and F11 satellites covering the period July 1987-December 1994. It also provides 1988-94 annual- and monthly-mean climatologies of the same variables, using only F8 and F1 1 satellite data. It has a spatial resolution of 2.0 degrees x 2.5 degrees lat-long and is archived at the NASA/GSFC DAAC. The purpose of this paper is to present an updated assessment of the GSSTF 1.0 dataset.
WE-FG-202-05: Quantification of Bone Flare On [F-18] NaF PET/CT in Metastatic Prostate Cancer
DOE Office of Scientific and Technical Information (OSTI.GOV)
Weisman, A; Harmon, S; Perk, T
Purpose: Bone flare has been observed on Tc-99m bone scans during early assessment in metastatic Castration-Resistant Prostate Cancer (mCRPC) patients receiving select androgen-signaling pathway (AR) targeted treatments, including CYP17-inhibitor Abiraterone. This study investigates the appearance and potential clinical impact of bone flare in mCRPC patients receiving CYP17-inhibitors using {sup 18}F-NaF PET/CT. Methods: Twenty-three mCRPC patients being treated with CYP17-inhibitors received NaF PET/CT scans at baseline, week 6, and week 12 of treatment. Individual lesions were identified using a SUV>15 threshold within skeletal regions and articulated bone registration was used to track lesions between scans. Standard SUV metrics were extracted globallymore » for each patient (pSUV) and for each individual lesion (iSUV). Differences in metrics across time-points were compared using Wilcoxon signed-rank tests. Cox proportional hazard regression analyses were conducted between global metrics and progression-free survival (PFS). Results: Nineteen patients (83%) showed increasing NaF PET global metrics at week 6, with pSUV{sub total} reflecting consensus change across other global metrics with median increase +33% (range +2 to 205%). Of these patients, 14 showed subsequent decrease in pSUV{sub total}, with a median of −17% (range −76 to −1%), indicating flare phenomenon. Increasing pSUV{sub mean} at week 6 correlated with extended clinical PFS (HR = 0.58, p=0.02). New lesions did not account for the initial increase in global NaF metrics. Lesion-level analysis reveals 316 lesions in the 14 patients exhibiting global flare. On average, 75% (sd: 22%) of lesions follow global trends with iSUV{sub total} increasing at week 6 and 65% (sd: 17%) showing iSUV{sub total} decrease at week 12. Conclusion: Bone flare was detected on NaF PET/CT in the first 6 weeks of treatment for mCRPC patients receiving CYP17-inhibitors, subsiding by week 12. Characterization provided
Minnesota: Early Head Start Initiatiive
ERIC Educational Resources Information Center
Center for Law and Social Policy, Inc. (CLASP), 2012
2012-01-01
Minnesota provides supplemental state funding to existing federal Head Start and Early Head Start (EHS) grantees to increase their capacity to serve additional infants, toddlers, and pregnant women. The initiative was started in 1997 when the state legislature earmarked $1 million of the general state Head Start supplemental funds for children…
Missouri: Early Head Start Initiative
ERIC Educational Resources Information Center
Center for Law and Social Policy, Inc. (CLASP), 2012
2012-01-01
Missouri's Early Head Start/Child Care Partnership Project expands access to Early Head Start (EHS) services for children birth to age 3 by developing partnerships between federal Head Start, EHS contractors, and child care providers. Head Start and EHS contractors that participate in the initiative provide services through community child care…
Palenchar, Daniel J; Gellatly, Kyle J; Yoon, Kyong Sup; Mumcuoglu, Kosta Y; Shalom, Uri; Clark, J Marshall
2015-09-01
Human bed bug infestations have dramatically increased worldwide since the mid-1990s. A similar phenomenon was also observed in Israel since 2005, when infestations were reported from all over the country. Two single nucleotide polymorphisms (V419L and L925I) in the bed bug voltage-sensitive sodium channel confer kdr-type resistance to pyrethroids. Using quantitative sequencing (QS), the resistance allele frequencies of Israeli bed bug populations from across the country were determined. Genomic DNA was extracted from samples of 12 populations of bed bugs collected from Israel and DNA fragments containing the V419L or L925I and I936F mutations sites were PCR amplified. The PCR products were analyzed by QS and the nucleotide signal ratios calculated and used to predict the resistance allele frequencies of the unknown populations. Results of the genetic analysis show that resistant nucleotide signals are highly correlated to resistance allele frequencies for both mutations. Ten of the 12 tested populations had 100% of the L925I mutation and 0% of the V419L mutation. One population was heterogeneous for the L925I mutation and had 0% of the V419L mutation and another population was heterogeneous for the V419L mutation and had 100% of the L925I mutation. I936F occurred only at low levels. These results indicate that bed bugs in Israel are genetically resistant to pyrethroids. Thus, pyrethroids should only be used for bed bug management with caution using effective application and careful monitoring procedures. Additionally, new and novel-acting insecticides and nonchemical means of controlling bed bugs should be explored. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
A novel approach to breast cancer diagnosis via PET imaging of microcalcifications using 18F-NaF
Wilson, George H.; Gore, John C.; Yankeelov, Thomas E.; Barnes, Stephanie; Peterson, Todd E.; True, Jarrod M.; Shokouhi, Sepideh; McIntyre, J. Oliver.; Sanders, Melinda; Abramson, Vandana; Ngyuen, The-Quyen; Mahadevan-Jansen, Anita; Tantawy, Mohammed N.
2015-01-01
Rationale Current radiological methods for diagnosing breast cancer detect specific morphological features of solid tumors and/or any associated calcium deposits. These deposits originate from an early molecular microcalcification process which consists of two types: type 1 is calcium oxylate (CO) and type II is carbonated calcium hydroxyapetite (HAP). Type I microcalcifications are mainly associated with benign tumors while type II have been shown to be produced, internally, by malignant cells. No current non-invasive in vivo techniques are available for detecting intratumoral microcalcifications. Such a technique would have a significant impact on breast cancer diagnosis and prognosis in preclinical and clinical settings. 18F-NaF PET has been solely used for bone imaging by targeting the bone HAP. In this work, we provide preliminary evidence that 18F-NaF PET imaging can be used to detect breast cancer by targeting the HAP lattice within the tumor microenvironment with high specificity and soft-tissue contrast-to-background ratio, while delineating tumors from inflammation. METHODS Mice were injected with approximately 106 MDA-MB-231 cells subcutaneously and imaged with 18F-NaF PET/CT in a 120 min dynamic sequence when the tumors reached a size of ~250 mm3. Regions-of-interest (ROIs) were drawn around the tumor, muscle, and bone. The concentration of the radiotracer within those ROIs were compared to one another. For comparison to inflammation, rats with inflammatory paws were subjected to 18F-NaF PET imaging. RESULTS Tumor uptake of 18F− was significantly higher (p<0.05) than muscle uptake where the tumor-to-muscle ratio was ~3.5. The presence of type II microcalcification in the MDA-MB-231 cell line was confirmed histologically using alizarin red S and von Kossa staining as well as Raman microspectroscopy. No uptake of 18F− was observed in the rat inflamed tissue. Lack of HAP in the inflamed tissue was verified histologically. CONCLUSIONS This study
Method for recovery of actinides from refractory oxides thereof using O.sub. F.sub.2
Asprey, Larned B.; Eller, Phillip G.
1988-01-01
Method for recovery of actinides from nuclear waste material containing sintered and other oxides thereof using O.sub.2 F.sub.2 to generate the hexafluorides of the actinides present therein. The fluorinating agent, O.sub.2 F.sub.2, has been observed to perform the above-described tasks at sufficiently low temperatures that there is virtually no damage to the containment vessels. Moreover, the resulting actinide hexafluorides are not destroyed by high temperature reactions with the walls of the reaction vessel. Dioxygen difluoride is readily prepared, stored and transferred to the place of reaction.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Reed, J. L., E-mail: jlreed2@wisc.edu; Micka, J. A.; Culberson, W. S.
Purpose: To determine the intrinsic energy dependence of LiF:Mg,Ti thermoluminescent dosimeters (TLD-100) for {sup 125}I and {sup 103}Pd brachytherapy sources relative to {sup 60}Co. Methods: LiF:Mg,Ti TLDs were irradiated with low-energy brachytherapy sources and with a {sup 60}Co teletherapy source. The brachytherapy sources measured were the Best 2301 {sup 125}I seed, the OncoSeed 6711 {sup 125}I seed, and the Best 2335 {sup 103}Pd seed. The TLD light output per measured air-kerma strength was determined for the brachytherapy source irradiations, and the TLD light output per air kerma was determined for the {sup 60}Co irradiations. Monte Carlo (MC) simulations were usedmore » to calculate the dose-to-TLD rate per air-kerma strength for the brachytherapy source irradiations and the dose to TLD per air kerma for the {sup 60}Co irradiations. The measured and MC-calculated results for all irradiations were used to determine the TLD intrinsic energy dependence for {sup 125}I and {sup 103}Pd relative to {sup 60}Co. Results: The relative TLD intrinsic energy dependences (relative to {sup 60}Co) and associated uncertainties (k = 1) were determined to be 0.883 ± 1.3%, 0.870 ± 1.4%, and 0.871 ± 1.5% for the Best 2301 seed, OncoSeed 6711 seed, and Best 2335 seed, respectively. Conclusions: The intrinsic energy dependence of TLD-100 is dependent on photon energy, exhibiting changes of 13%–15% for {sup 125}I and {sup 103}Pd sources relative to {sup 60}Co. TLD measurements of absolute dose around {sup 125}I and {sup 103}Pd brachytherapy sources should explicitly account for the relative TLD intrinsic energy dependence in order to improve dosimetric accuracy.« less
NASA Technical Reports Server (NTRS)
Olson, William S.
1990-01-01
A physical retrieval method for estimating precipitating water distributions and other geophysical parameters based upon measurements from the DMSP-F8 SSM/I is developed. Three unique features of the retrieval method are (1) sensor antenna patterns are explicitly included to accommodate varying channel resolution; (2) precipitation-brightness temperature relationships are quantified using the cloud ensemble/radiative parameterization; and (3) spatial constraints are imposed for certain background parameters, such as humidity, which vary more slowly in the horizontal than the cloud and precipitation water contents. The general framework of the method will facilitate the incorporation of measurements from the SSMJT, SSM/T-2 and geostationary infrared measurements, as well as information from conventional sources (e.g., radiosondes) or numerical forecast model fields.
F-16 Task Analysis Criterion-Referenced Objective and Objectives Hierarchy Report. Volume 3
1981-03-01
Escribe sibsequent Is~eclitc actions t1ta-Pe in PeTiO-r~Ina DeIAe quafao t vertical cOrversion without terror -. ( F’ae:61?) -- -4 --- Periorm be-m...I irAentxiu areas oi methods for maintaining practices and TACN 3-1. and comunication iA I hignest vulnerability position ThW current I currernt...agency (Poge:993P Perform tactical 1 comunications with ASRT/skuspot (C) J 1.7.10.1.3 Describe the proper faroats for ( comur,ications with ASRT
NbF5 and TaF5: Assignment of 19F NMR resonances and chemical bond analysis from GIPAW calculations
NASA Astrophysics Data System (ADS)
Biswal, Mamata; Body, Monique; Legein, Christophe; Sadoc, Aymeric; Boucher, Florent
2013-11-01
The 19F isotropic chemical shifts (δiso) of two isomorphic compounds, NbF5 and TaF5, which involve six nonequivalent fluorine sites, have been experimentally determined from the reconstruction of 1D 19F MAS NMR spectra. In parallel, the corresponding 19F chemical shielding tensors have been calculated using the GIPAW method for both experimental and DFT-optimized structures. Furthermore, the [M4F20] units of NbF5 and TaF5 being held together by van der Waals interactions, the relevance of Grimme corrections to the DFT optimization processes has been evaluated. However, the semi-empirical dispersion correction term introduced by such a method does not show any significant improvement. Nonetheless, a complete and convincing assignment of the 19F NMR lines of NbF5 and TaF5 is obtained, ensured by the linearity between experimental 19F δiso values and calculated 19F isotropic chemical shielding σiso values. The effects of the geometry optimizations have been carefully analyzed, confirming among other matters, the inaccuracy of the experimental structure of NbF5. The relationships between the fluorine chemical shifts, the nature of the fluorine atoms (bridging or terminal), the position of the terminal ones (opposite or perpendicular to the bridging ones), the fluorine charges, the ionicity and the length of the M-F bonds have been established. Additionally, for three of the 19F NMR lines of NbF5, distorted multiplets, arising from 1J-coupling and residual dipolar coupling between the 19F and 93Nb nuclei, were simulated yielding to values of 93Nb-19F 1J-coupling for the corresponding fluorine sites.
Head Start Impact on Social-Emotional Outcomes for Children with Disabilities
ERIC Educational Resources Information Center
Lee, Kyunghee; Calkins, Andrea; Shin, Tae Seob
2016-01-01
Objective: Using the Head Start Impact Study data, this study examines Head Start's impacts on social-emotional outcomes for children with disabilities. Method: Among 4,442 children, 570 children were reported to have disabilities. Ordinary least squares regression was used to determine whether the number of disabilities, having an individualized…
A Geometric Perspective on the Method of Descent
NASA Astrophysics Data System (ADS)
Wang, Qian
2018-06-01
We derive a first order representation formula for the tensorial wave equation \\Box_g φ^I=F^I in globally hyperbolic Lorentzian spacetimes {(M^{2+1}, g) by giving a geometric formulation of the method of descent which is applicable for any dimension.
Magnetic upconverting fluorescent NaGdF4:Ln3+ and iron-oxide@NaGdF4:Ln3+ nanoparticles
NASA Astrophysics Data System (ADS)
Shrivastava, Navadeep; Rocha, Uéslen; Muraca, Diego; Jacinto, Carlos; Moreno, Sergio; Vargas, J. M.; Sharma, S. K.
2018-05-01
Microwave assisted solvothermal method has been employed to synthesize multifunctional upconverting β-NaGdF4:Ln3+ and magnetic-upconverting Fe3O4/γ-Fe2O3@NaGdF4:Ln3+ (Ln = Yb and Er) nanoparticles. The powder x-ray diffraction data confirms the hexagonal structure of NaGdF4:Ln3+ and high resolution transmission electron microscopy shows the formation of rod shaped NaGdF4:Ln3+ (˜ 20 nm) and ovoid shaped Fe3O4/γ-Fe2O3@NaGdF4:Ln3+ (˜ 15 nm) nanoparticles. The magnetic hysteresis at 300 K for β-NaGdF4:Ln3+ demonstrates paramagnetic features, whereas iron-oxide@β-NaGdF4:Ln3+ exhibits superparamagnetic behavior along with a linear component at large applied field due to paramagnetic NaGdF4 matrix. Both nanoparticle samples provide an excellent green emitting [(2H11/2, 4S3/2)→4I15/2 (˜ 540 nm)] upconversion luminescence emission under excitation at 980 nm. The energy migration between Yb and Er in NaGdF4 matrix has been explored from 300-800 nm. Intensity variation of blue, green and red lines and the observed luminescence quenching due to the presence of Fe3O4/γ-Fe2O3 in the composite has been proposed. These kinds of materials contain magnetic and luminescence characteristics into single nanoparticle open new possibility for bioimaging applications.
Song, Sutao; Zhan, Zhichao; Long, Zhiying; Zhang, Jiacai; Yao, Li
2011-02-16
Support vector machine (SVM) has been widely used as accurate and reliable method to decipher brain patterns from functional MRI (fMRI) data. Previous studies have not found a clear benefit for non-linear (polynomial kernel) SVM versus linear one. Here, a more effective non-linear SVM using radial basis function (RBF) kernel is compared with linear SVM. Different from traditional studies which focused either merely on the evaluation of different types of SVM or the voxel selection methods, we aimed to investigate the overall performance of linear and RBF SVM for fMRI classification together with voxel selection schemes on classification accuracy and time-consuming. Six different voxel selection methods were employed to decide which voxels of fMRI data would be included in SVM classifiers with linear and RBF kernels in classifying 4-category objects. Then the overall performances of voxel selection and classification methods were compared. Results showed that: (1) Voxel selection had an important impact on the classification accuracy of the classifiers: in a relative low dimensional feature space, RBF SVM outperformed linear SVM significantly; in a relative high dimensional space, linear SVM performed better than its counterpart; (2) Considering the classification accuracy and time-consuming holistically, linear SVM with relative more voxels as features and RBF SVM with small set of voxels (after PCA) could achieve the better accuracy and cost shorter time. The present work provides the first empirical result of linear and RBF SVM in classification of fMRI data, combined with voxel selection methods. Based on the findings, if only classification accuracy was concerned, RBF SVM with appropriate small voxels and linear SVM with relative more voxels were two suggested solutions; if users concerned more about the computational time, RBF SVM with relative small set of voxels when part of the principal components were kept as features was a better choice.
The reliability of an instrumented start block analysis system.
Tor, Elaine; Pease, David L; Ball, Kevin A
2015-02-01
The swimming start is highly influential to overall competition performance. Therefore, it is paramount to develop reliable methods to perform accurate biomechanical analysis of start performance for training and research. The Wetplate Analysis System is a custom-made force plate system developed by the Australian Institute of Sport--Aquatic Testing, Training and Research Unit (AIS ATTRU). This sophisticated system combines both force data and 2D digitization to measure a number of kinetic and kinematic parameter values in an attempt to evaluate start performance. Fourteen elite swimmers performed two maximal effort dives (performance was defined as time from start signal to 15 m) over two separate testing sessions. Intraclass correlation coefficients (ICC) were used to determine each parameter's reliability. The kinetic parameters all had ICC greater than 0.9 except the time of peak vertical force (0.742). This may have been due to variations in movement initiation after the starting signal between trials. The kinematic and time parameters also had ICC greater than 0.9 apart from for the time of maximum depth (0.719). This parameter was lower due to the swimmers varying their depth between trials. Based on the high ICC scores for all parameters, the Wetplate Analysis System is suitable for biomechanical analysis of swimming starts.
Disinfecting the iPad: evaluating effective methods.
Howell, V; Thoppil, A; Mariyaselvam, M; Jones, R; Young, H; Sharma, S; Blunt, M; Young, P
2014-06-01
Tablet computers are increasingly used in healthcare, but they may carry nosocomial pathogens. There are few data available on how to clean an iPad effectively for use in the clinical setting. We aimed to identify the most effective method of decontaminating the Apple iPad, without causing damage, and establish the duration of any residual effect. Following contamination with a microbial broth (meticillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant enterococcus (VRE) and Clostridium difficile), we examined efficacy of iPad disinfection in the laboratory using six different disinfectant wipes: Sani-Cloth CHG 2% (chlorhexidine 2%/alcohol 70%), Clorox, Tristel, Trigene, soap and water, and plain cloth. Following cleaning, iPads were recontaminated to examine residual activity. After 480 Sani-Cloth CHG 2% disinfecting episodes, functional and visual analysis of iPads was performed by blinded subjects. With the exception of Clostridium difficile, Sani-Cloth CHG 2% and Clorox wipes were most effective against MRSA and VRE, and they were significantly better than the Apple-recommended plain cloth (P ≤ 0.001). A substantial residual antimicrobial effect was seen for >6h after wiping the iPad with Sani-Cloth CHG 2% despite repeated recontamination and without further disinfection. The functionality or visual appearance of the iPad was not damaged by repeated use of Sani-Cloth CHG 2% wipes. Sani-Cloth CHG 2% wipes effectively disinfect the iPad against MRSA and VRE, with a residual antibacterial effect and without causing damage. Copyright © 2014 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.
CHClF2 (F-22) in the Earth's atmosphere
NASA Astrophysics Data System (ADS)
Rasmussen, R. A.; Khalil, M. A. K.; Penkett, S. A.; Prosser, N. J. D.
1980-10-01
Recent global measurements of CHClF2 (F-22) are reported. Originally, GC/MS techniques were used to obtain these data. Since then, significant advances using an O2-doped electron capture detector have been made in the analytical techniques, so that F-22 can be measured by EC/GC methods at ambient concentrations. The atmospheric burden of F-22 calculated from these measurements (average mixing ratio, mid-1979, ˜45 pptv) is considerably greater than that expected from the estimates of direct industrial emissions (average mixing ratio, mid-1979, ˜30 pptv). This difference is probably due to underestimates of F-22 emissions.
CHClF2 /F-22/ in the earth's atmosphere
NASA Technical Reports Server (NTRS)
Rasmussen, R. A.; Khalil, M. A. K.; Penkett, S. A.; Prosser, N. J. D.
1980-01-01
Recent global measurements of CHClF2 (F-22) are reported. Originally, GC/MS techniques were used to obtain these data. Since then, significant advances using an O2-doped electron capture detector have been made in the analytical techniques, so that F-22 can be measured by EC/GC methods at ambient concentrations. The atmospheric burden of F-22 calculated from these measurements (average mixing ratio, mid-1979, approximately 45 pptv) is considerably greater than that expected from the estimates of direct industrial emissions (average mixing ratio, mid-1979, approximately 30 pptv). This difference is probably due to underestimates of F-22 emissions.
Geometrical and Topological Methods in Time Domain Antenna Synthesis
1994-04-30
94 4. TITLE AND SUBTITLE 5. FUNDING NUMBERS GEOMETRICAL & TOPOLOGICAL METHODS IN TIME DOMAIN ANTENNA SYNTHESIS (U) 6. AUTHOR(S) j 61102F i 2304/BS...34 UNCLASSIFIED UNCLASSIFIED j UNCLASSIFIED SAR(SAME AS REPORT) -. Final Technical Report Grant F49620-92-J-0056 Geometrical and Topological Methods in Time...Morse theory, we may try to relate Witten’s proof of the Morse inequalities[92’, the heat equation method for harmonic forms[30], in the context of
F-16 Media Selection and Utilization Plan Report.
1981-03-01
F0260A-79-C-887S Eommhhmhhhhhmu EmhEmhEEohhhEE Efl ~fflflEfl EN 11111 ~ ~ 111 5_______ III mi o - ~ I I . I 1 N I t 1 , I F16 AIRCREW TRAININgN...two to three objectives per segment, and the types of objective (and thus the type of instructional strategy required to teach it) will not be mixed... teaching of a given objective can be identified. Since the medium is the device for presenting displays and handling all interactions between the student
Impact of chemical plant start-up emissions on ambient ozone concentration
NASA Astrophysics Data System (ADS)
Ge, Sijie; Wang, Sujing; Xu, Qiang; Ho, Thomas
2017-09-01
Flare emissions, especially start-up flare emissions, during chemical plant operations generate large amounts of ozone precursors that may cause highly localized and transient ground-level ozone increment. Such an adverse ozone impact could be aggravated by the synergies of multiple plant start-ups in an industrial zone. In this paper, a systematic study on ozone increment superposition due to chemical plant start-up emissions has been performed. It employs dynamic flaring profiles of two olefin plants' start-ups to investigate the superposition of the regional 1-hr ozone increment. It also summaries the superposition trend by manipulating the starting time (00:00-10:00) of plant start-up operations and the plant distance (4-32 km). The study indicates that the ozone increment induced by simultaneous start-up emissions from multiple chemical plants generally does not follow the linear superposition of the ozone increment induced by individual plant start-ups. Meanwhile, the trend of such nonlinear superposition related to the temporal (starting time and operating hours of plant start-ups) and spatial (plant distance) factors is also disclosed. This paper couples dynamic simulations of chemical plant start-up operations with air-quality modeling and statistical methods to examine the regional ozone impact. It could be helpful for technical decision support for cost-effective air-quality and industrial flare emission controls.
ERIC Educational Resources Information Center
Beardslee, William R.; Avery, Mary Watson; Ayoub, Catherine; Watts, Caroline L.
2009-01-01
Early Head Start/Head Start teachers and staff encounter parents who have wrestled with depression and other adversities every day. This article describes an innovative program of trainings for and consultation to Early Head Start/Head Start staff to help them effectively deal with mental heath challenges faced by parents and children. The program…
Shiina, Takashi; Yamada, Yukiho; Aarnink, Alice; Suzuki, Shingo; Masuya, Anri; Ito, Sayaka; Ido, Daisuke; Yamanaka, Hisashi; Iwatani, Chizuru; Tsuchiya, Hideaki; Ishigaki, Hirohito; Itoh, Yasushi; Ogasawara, Kazumasa; Kulski, Jerzy K; Blancher, Antoine
2015-10-01
Although the low polymorphism of the major histocompatibility complex (MHC) transplantation genes in the Filipino cynomolgus macaque (Macaca fascicularis) is expected to have important implications in the selection and breeding of animals for medical research, detailed polymorphism information is still lacking for many of the duplicated class I genes. To better elucidate the degree and types of MHC polymorphisms and haplotypes in the Filipino macaque population, we genotyped 127 unrelated animals by the Sanger sequencing method and high-resolution pyrosequencing and identified 112 different alleles, 28 at cynomolgus macaque MHC (Mafa)-A, 54 at Mafa-B, 12 at Mafa-I, 11 at Mafa-E, and seven at Mafa-F alleles, of which 56 were newly described. Of them, the newly discovered Mafa-A8*01:01 lineage allele had low nucleotide similarities (<86%) with primate MHC class I genes, and it was also conserved in the Vietnamese and Indonesian populations. In addition, haplotype estimations revealed 17 Mafa-A, 23 Mafa-B, and 12 Mafa-E haplotypes integrated with 84 Mafa-class I haplotypes and Mafa-F alleles. Of these, the two Mafa-class I haplotypes, F/A/E/B-Hp1 and F/A/E/B-Hp2, had the highest haplotype frequencies at 10.6 and 10.2%, respectively. This suggests that large scale genetic screening of the Filipino macaque population would identify these and other high-frequency Mafa-class I haplotypes that could be used as MHC control animals for the benefit of biomedical research.
Clinical Application of Standardized Cognitive Assessment Using fMRI. I. Matrix Reasoning
Allen, Mark D.; Fong, Alina K.
2008-01-01
Functional MRI is increasingly recognized for its potential as a powerful new tool in clinical neuropsychology. This is likely due to the fact that, with some degree of innovation, it is possible to convert practically any familiar cognitive test into one that can be performed in the MRI scanning environment. However, like any assessment approach, meaningful interpretation of fMRI data for the purpose of patient evaluation crucially requires normative data derived from a sample of unimpaired persons, against which individual patients may be compared. Currently, no such normative data are available for any fMRI-based cognitive testing protocol. In this paper, we report the first of a series of fMRI-compatible cognitive assessment protocols, a matrix reasoning test (f-MRT), for which normative samples of functional activation have been collected from unimpaired control subjects and structured in a manner that makes individual patient evaluation possible in terms of familiar z-score distributions. Practical application of the f-MRT is demonstrated via a contrastive case-study of two individuals with cognitive impairment in which fMRI data identifies subtleties in patient deficits otherwise missed by conventional measures of performance. PMID:19641250
Type I and Type II error concerns in fMRI research: re-balancing the scale
Cunningham, William A.
2009-01-01
Statistical thresholding (i.e. P-values) in fMRI research has become increasingly conservative over the past decade in an attempt to diminish Type I errors (i.e. false alarms) to a level traditionally allowed in behavioral science research. In this article, we examine the unintended negative consequences of this single-minded devotion to Type I errors: increased Type II errors (i.e. missing true effects), a bias toward studying large rather than small effects, a bias toward observing sensory and motor processes rather than complex cognitive and affective processes and deficient meta-analyses. Power analyses indicate that the reductions in acceptable P-values over time are producing dramatic increases in the Type II error rate. Moreover, the push for a mapwide false discovery rate (FDR) of 0.05 is based on the assumption that this is the FDR in most behavioral research; however, this is an inaccurate assessment of the conventions in actual behavioral research. We report simulations demonstrating that combined intensity and cluster size thresholds such as P < 0.005 with a 10 voxel extent produce a desirable balance between Types I and II error rates. This joint threshold produces high but acceptable Type II error rates and produces a FDR that is comparable to the effective FDR in typical behavioral science articles (while a 20 voxel extent threshold produces an actual FDR of 0.05 with relatively common imaging parameters). We recommend a greater focus on replication and meta-analysis rather than emphasizing single studies as the unit of analysis for establishing scientific truth. From this perspective, Type I errors are self-erasing because they will not replicate, thus allowing for more lenient thresholding to avoid Type II errors. PMID:20035017
Fully automated synthesis of 4-[18F]fluorobenzylamine based on borohydride/NiCl2 reduction.
Way, Jenilee; Wuest, Frank
2013-04-01
4-[(18)F]Fluorobenzylamine ([(18)F]FBA) is an important building block for the synthesis of (18)F-labeled compounds. Synthesis of [(18)F]FBA usually involves application of strong reducing agents like LiAlH4 which is challenging to handle in automated synthesis units (ASUs). Therefore, alternative methods for the preparation of [(18)F]FBA compatible with remotely-controlled syntheses in ASUs are needed. (18)F]FBA was prepared in a remotely-controlled synthesis unit (GE TRACERlab™ FX) based on Ni(II)-mediated borohydride exchange resin (BER) reduction of 4-[(18)F]fluorobenzonitrile ([(18)F]FBN). [(18)F]FBA was used for the synthesis of novel thiol-reactive prosthetic group 4-[(18)F]fluorobenzyl)maleimide [(18)F]FBM and Hsp90 inhibitor 17-(4-[(18)F]fluorobenzylamino)-17-demethoxy-geldanamycin [(18)F] GA. [(18)F]FBA could be prepared in high radiochemical yield greater than 80% (decay-corrected) within 60min. In a typical experiment, 7.4GBq of [(18)F]FBA could be obtained in high radiochemical purity of greater than 95% starting from 10GBq of cyclotron-produced n.c.a. [(18)F]fluoride. [(18)F]FBA was used for the preparation of 4-[(18)F]fluorobenzyl)maleimide as a novel prosthetic group for labeling of thiol groups as demonstrated with tripeptide glutathione. [(18)F]FBA was also used as building block for the syntheses of small molecules as exemplified by the preparation of Hsp90 inhibitor 17-(4-[(18)F]fluorobenzylamino)-17-demethoxy-geldanamycin. The described remotely-controlled synthesis of [(18)F]FBA will significantly improve the availability of [(18)F]FBA as an important and versatile building block for the development of novel (18)F-labeled compounds containing a fluorobenzylamine moiety. Copyright © 2013 Elsevier Inc. All rights reserved.
/Start technology conserves energy by shutting off the gasoline engine when the vehicle is at rest, such as at a traffic light, and automatically re-starting it when the driver pushes the gas pedal to go engine when pulling out from a stop and generating electricity which is stored in the battery. Main stage