Sample records for interstitial acochlidian gastropod

  1. Computer-based three-dimensional reconstruction of the anatomy of Microhedyle remanei (Marcus, 1953), an interstitial acochlidian gastropod from Bermuda.


    Neusser, Timea P; Hess, Martin; Haszprunar, Gerhard; Schrödl, Michael


    Phylogenetic analysis of the highly enigmatic and aberrant acochlidian opisthobranch gastropods is mainly hindered by the lack of reliable anatomical data. Due to their small size, marine interstitial acochlidian species are not suitable for anatomical investigations by dissecting. The tinyness and complexity of, e.g., opisthobranch central nervous and reproductive systems make data derived from older paraffin-based histology and interpretation by hand-based graphical reconstruction questionable. In a former study, a hermaphroditic member of the basal acochlidian genus Hedylopsis ("Hedylopsacea") has been examined in detail. The present study uses the gonochoric Microhedyle remanei (Microhedylidae) as a model organism of the other traditional major acochlidian subgroup, the "Microhedylacea." More than 20 specimens with up to 2 mm body length were extracted from coarse subtidal sand near Castle Roads, Bermuda Islands. Their central nervous, digestive, circulatory, excretory, and genital systems were reconstructed three-dimensionally from serial semithin histological sections using AMIRA software. The radula was analyzed by SEM. Our specimens closely resemble the original description of M. remanei (Marcus, 1953; as Unela) from Brazil; apparent differences regarding the number of visceral loop ganglia or details of male genitalia are assumed to be due to oversights by the former author or because of different ontogenetic stages. Microhedyle remanei differs from all congeners due to the lack (vs. presence) of eyes; further distinguishing features are discussed. In contrast to members of the hedylopsacean Hedylopsidae, Acochlidiidae, and Tantulidae, M. remanei shows a nervous system with numerous precerebral accessory "ganglia" that are not differentiated into cortex and medulla. While all Microhedylidae previously were thought to lack a heart, M. remanei shows a two-chambered heart, as is usual for opisthobranchs. The oocytes of M. remanei are yolky and large in

  2. On the origin of Acochlidia and other enigmatic euthyneuran gastropods, with implications for the systematics of Heterobranchia

    PubMed Central


    Background A robust phylogenetic hypothesis of euthyneuran gastropods, as a basis to reconstructing their evolutionary history, is still hindered by several groups of aberrant, more or less worm-like slugs with unclear phylogenetic relationships. As a traditional "order" in the Opisthobranchia, the Acochlidia have a long history of controversial placements, among others influenced by convergent adaptation to the mainly meiofaunal habitats. The present study includes six out of seven acochlidian families in a comprehensive euthyneuran taxon sampling with special focus on minute, aberrant slugs. Since there is no fossil record of tiny, shell-less gastropods, a molecular clock was used to estimate divergence times within Euthyneura. Results Our multi-locus molecular study confirms Acochlidia in a pulmonate relationship, as sister to Eupulmonata. Previous hypotheses of opisthobranch relations, or of a common origin with other meiofaunal Euthyneura, are clearly rejected. The enigmatic amphibious and insectivorous Aitengidae incerta sedis clusters within Acochlidia, as sister to meiofaunal and brackish Pseudunelidae and limnic Acochlidiidae. Euthyneura, Opisthobranchia and Pulmonata as traditionally defined are non-monophyletic. A relaxed molecular clock approach indicates a late Palaeozoic diversification of Euthyneura and a Mesozoic origin of the major euthyneuran diversity, including Acochlidia. Conclusions The present study shows that the inclusion of small, enigmatic groups is necessary to solve deep-level phylogenetic relationships, and underlines that "pulmonate" and "opisthobranch" phylogeny, respectively, cannot be solved independently from each other. Our phylogenetic hypothesis requires reinvestigation of the traditional classification of Euthyneura: morphological synapomorphies of the traditionally defined Pulmonata and Opisthobranchia are evaluated in light of the presented phylogeny, and a redefinition of major groups is proposed. It is demonstrated that

  3. Interstitial Nephritis


    ... was contributed by: editorial staff Tags: acute tubulointerstitial nephritis, AIN, interstitial nephritis, kidney disorders, kidney failure, renal failure, renal infection Men, Seniors, Women December 2004 ...

  4. Interstitial keratitis


    ... However, interstitial keratitis accounts for 10% of avoidable blindness in the least developed countries worldwide. ... chap 4.17. World Health Organization. Causes of blindness and visual impairment. Prevention of blindness and visual ...

  5. Interstitial thermoradiotherapy.


    Coughlin, C T; Strohbehn, J W


    The more recent engineering and clinical aspects of interstitial hyperthermia are reviewed. The advantages and difficulties of microwave, radiofrequency, and ferromagnetic seeds are evaluated and some future directions for improvements are outlined.

  6. Interstitial nephritis


    Arend LJ. Tubulointerstitial diseases. In: Lager DJ, Abrahams NA, eds. Practical Renal Pathology . Philadelphia, PA: Elsevier Saunders; 2013:chap 7. Nangaku M. Chronic interstitial nephritis. In: Johnson RJ, Feehally J, Floege ...

  7. Evolution of gastropod mitochondrial genome arrangements

    PubMed Central


    Background Gastropod mitochondrial genomes exhibit an unusually great variety of gene orders compared to other metazoan mitochondrial genome such as e.g those of vertebrates. Hence, gastropod mitochondrial genomes constitute a good model system to study patterns, rates, and mechanisms of mitochondrial genome rearrangement. However, this kind of evolutionary comparative analysis requires a robust phylogenetic framework of the group under study, which has been elusive so far for gastropods in spite of the efforts carried out during the last two decades. Here, we report the complete nucleotide sequence of five mitochondrial genomes of gastropods (Pyramidella dolabrata, Ascobulla fragilis, Siphonaria pectinata, Onchidella celtica, and Myosotella myosotis), and we analyze them together with another ten complete mitochondrial genomes of gastropods currently available in molecular databases in order to reconstruct the phylogenetic relationships among the main lineages of gastropods. Results Comparative analyses with other mollusk mitochondrial genomes allowed us to describe molecular features and general trends in the evolution of mitochondrial genome organization in gastropods. Phylogenetic reconstruction with commonly used methods of phylogenetic inference (ME, MP, ML, BI) arrived at a single topology, which was used to reconstruct the evolution of mitochondrial gene rearrangements in the group. Conclusion Four main lineages were identified within gastropods: Caenogastropoda, Vetigastropoda, Patellogastropoda, and Heterobranchia. Caenogastropoda and Vetigastropoda are sister taxa, as well as, Patellogastropoda and Heterobranchia. This result rejects the validity of the derived clade Apogastropoda (Caenogastropoda + Heterobranchia). The position of Patellogastropoda remains unclear likely due to long-branch attraction biases. Within Heterobranchia, the most heterogeneous group of gastropods, neither Euthyneura (because of the inclusion of P. dolabrata) nor Pulmonata

  8. Interstitial hyperthermia.


    Milligan, A J; Dobelbower, R R


    The effectiveness of hyperthermia as a treatment modality for cancer continues to gain popularity in the medical community. One of the disappointing findings has been the inability to deliver uniform thermal doses to tumor volumes. This inability to heat certain tumors is due to a variety of physical and physiologic phenomena. To increase the ability of heating tumors, local interstitial techniques have been developed that are proving to be safe and effective. These techniques employ implanted microwave or radiofrequency antennae for the delivery of local thermal doses. Recently, investigations into the placement of interstitially located ferromagnetic seeds for local hyperthermia have also been conducted. The seeds can be heated by delivery of a high-wattage RF magnetic field to the implanted volume by an external source after implantation. The tissue surrounding the ferromagnetic implant is heated by conduction of heat away from the implanted seeds. While these techniques have been effective, further development of the instrumentation for interstitial therapies is continuing. These developments will include the application of specific control circuitry for delivery of accurate thermal doses.

  9. Fracture Mitigation Strategies in Gastropod Shells

    NASA Astrophysics Data System (ADS)

    Salinas, Christopher; Kisailus, David


    For hundreds of millions of years, gastropods have been evolving, modifying their external calcified shells for defense against shell-breaking and drilling predators. They have evolved primarily to use two different aragonitic microstructures: the evolutionary older Nacre (mother of pearl) structure and the more recently developed crossed-lamellar structure. By using both of these structures, gastropods are able to produce shells that are significantly tougher then geologic aragonite. However, the crossed-lamellar structure allows for a wider variety of shell morphologies, ensuring its increasing presence since the Mesozoic Marine Revolution more than 200 million years ago.

  10. Interstitial Cystitis Association


    ... may have IC. Get The Facts Interstitial Cystitis Association The Interstitial Cystitis Association (ICA) is the only ... events. Please leave this field empty Interstitial Cystitis Association 7918 Jones Branch Drive, Suite 300 McLean, VA ...

  11. Interstitial cystitis - resources


    Resources - interstitial cystitis ... The following organizations are good resources for information on interstitial cystitis : Interstitial Cystitis Association -- National Kidney and Urologic Diseases Information Clearinghouse -- www.kidney.niddk. ...

  12. Interstitial Lung Disease


    ... Conditions Interstitial Lung Disease (ILD)/Pulmonary Fibrosis Interstitial Lung Disease (ILD)/Pulmonary Fibrosis Make an Appointment Refer ... ILD clinical trials and most effective therapies. Interstitial Lung Disease Care at National Jewish Health At National ...

  13. Gastropod Seed Dispersal: An Invasive Slug Destroys Far More Seeds in Its Gut than Native Gastropods

    PubMed Central

    Blattmann, Tamara; Boch, Steffen; Türke, Manfred; Knop, Eva


    Seed dispersal is one of the most important mechanisms shaping biodiversity, and animals are one of the key dispersal vectors. Animal seed dispersal can directly or indirectly be altered by invasive organisms through the establishment of new or the disruption of existing seed dispersal interactions. So far it is known for a few gastropod species that they ingest and defecate viable plant seeds and consequently act as seed dispersers, referred to as gastropodochory. In a multi-species experiment, consisting of five different plant species and four different gastropod species, we tested with a fully crossed design whether gastropodochory is a general mechanism across native gastropod species, and whether it is altered by the invasive alien slug species Arion lusitanicus. Specifically, we hypothesized that a) native gastropod species consume the seeds from all tested plant species in equal numbers (have no preference), b) the voracious invasive alien slug A. lusitanicus – similarly to its herbivore behaviour – consumes a higher amount of seeds than native gastropods, and that c) seed viability is equal among different gastropod species after gut passage. As expected all tested gastropod species consumed all tested plant species. Against our expectation there was a difference in the amount of consumed seeds, with the largest and native mollusk Helix pomatia consuming most seeds, followed by the invasive slug and the other gastropods. Seed damage and germination rates did not differ after gut passage through different native species, but seed damage was significantly higher after gut passage through the invasive slug A. lusitanicus, and their germination rates were significantly reduced. PMID:24086477

  14. Gastropod seed dispersal: an invasive slug destroys far more seeds in its gut than native gastropods.


    Blattmann, Tamara; Boch, Steffen; Türke, Manfred; Knop, Eva


    Seed dispersal is one of the most important mechanisms shaping biodiversity, and animals are one of the key dispersal vectors. Animal seed dispersal can directly or indirectly be altered by invasive organisms through the establishment of new or the disruption of existing seed dispersal interactions. So far it is known for a few gastropod species that they ingest and defecate viable plant seeds and consequently act as seed dispersers, referred to as gastropodochory. In a multi-species experiment, consisting of five different plant species and four different gastropod species, we tested with a fully crossed design whether gastropodochory is a general mechanism across native gastropod species, and whether it is altered by the invasive alien slug species Arion lusitanicus. Specifically, we hypothesized that a) native gastropod species consume the seeds from all tested plant species in equal numbers (have no preference), b) the voracious invasive alien slug A. lusitanicus--similarly to its herbivore behaviour--consumes a higher amount of seeds than native gastropods, and that c) seed viability is equal among different gastropod species after gut passage. As expected all tested gastropod species consumed all tested plant species. Against our expectation there was a difference in the amount of consumed seeds, with the largest and native mollusk Helix pomatia consuming most seeds, followed by the invasive slug and the other gastropods. Seed damage and germination rates did not differ after gut passage through different native species, but seed damage was significantly higher after gut passage through the invasive slug A. lusitanicus, and their germination rates were significantly reduced.

  15. Interstitial cystitis.


    Erickson, D R; Davies, M F


    Interstitial cystitis (IC) is a multifactorial syndrome with symptoms of pelvic or perineal pain, urinary frequency and urgency. The etiologies are unknown, but several theories have been proposed. Diagnosis is often delayed because most of the conventional evaluation is normal. Pelvic examination is normal except for bladder tenderness. Urodynamics are normal except for increased bladder sensitivity and low capacity. Urinalysis, urine culture and office cystoscopy are also normal. The diagnostic test is cystoscopy under anesthesia with bladder distension. Small submucosal hemorrhages (glomerulations) or ulcers appear after distension. Many empiric treatments have been proposed for IC. None is universally effective, and so treatments are tried sequentially until good symptom relief is achieved. Bladder distension gives excellent (but transient) relief in some patients, especially those with severe bladder inflammation (who also tend to be older). A variety of oral, intravesical and adjunctive treatments are also described.

  16. Gastropods slow down succession and maintain diversity in cryptogam communities.


    Boch, Steffen; Prati, Daniel; Fischer, Markus


    Herbivore effects on diversity and succession were often studied in plants, but not in cryptogams. Besides direct herbivore effects on cryptogams, we expected indirect effects by changes in competitive interactions among cryptogams. Therefore, we conducted a long-term gastropod exclusion experiment testing for grazing effects on epiphytic cryptogam communities. We estimated the grazing damage, cover and diversity of cryptogams before gastropods were excluded and three and six years thereafter. Gastropod herbivory pronouncedly affected cryptogams, except for bryophytes, strongly depending on host tree species and duration of gastropod exclusion. On control trees, gastropod grazing regulated the growth of algae and non-lichenized fungi and thereby maintained a high lichen diversity and cover. On European beech, the release from gastropod grazing temporarily increased lichen vitality, cover, and species richness, but later caused rapid succession where algae and fungi overgrew lichens and thereby reduced their cover and diversity compared with the control. On Norway spruce, without gastropods lichen richness decreased and lichen cover increased compared with the control. Our findings highlight the importance of long-term exclusion experiments to disentangle short-term, direct effects from longer-term, indirect effects via changes in competitive relationships between taxa. We further demonstrated that gastropod feeding maintains the diversity of cryptogam communities.

  17. Developmental shifts and species selection in gastropods

    PubMed Central

    Duda, Thomas F.; Palumbi, Stephen R.


    The fossil record of marine gastropods has been used as evidence to support the operation of species selection; namely, that species with limited dispersal differentially increase in numbers because they are more likely to speciate than widely dispersing species. This conclusion is based on a tacit phylogenetic assumption that increases in species with limited dispersal are solely the result of speciation within monophyletic groups with low dispersal. To test this assumption, we reconstructed a phylogeny from nuclear sequence data for 70 species of the marine gastropod genus Conus and used it to map the evolution of developmental mode. All eight species without planktonic life history phases recently and independently evolved this characteristic from ancestors with planktonic larval phases, showing that transitions in developmental mode are common in this group. A simple model of species diversification shows that such shifts can control the relative numbers of species with and without dispersing larval stages, leading to apparent species selection. Such results challenge the conclusion that increases in the number of nonplanktonic species relative to species with planktonic larvae over geologic time is necessarily a result of higher rates of speciation of nonplanktonic lineages and show that demonstration of species selection requires a phylogenetic framework. PMID:10468598

  18. Phylogenomic analyses of deep gastropod relationships reject Orthogastropoda

    PubMed Central

    Zapata, Felipe; Wilson, Nerida G.; Howison, Mark; Andrade, Sónia C. S.; Jörger, Katharina M.; Schrödl, Michael; Goetz, Freya E.; Giribet, Gonzalo; Dunn, Casey W.


    Gastropods are a highly diverse clade of molluscs that includes many familiar animals, such as limpets, snails, slugs and sea slugs. It is one of the most abundant groups of animals in the sea and the only molluscan lineage that has successfully colonized land. Yet the relationships among and within its constituent clades have remained in flux for over a century of morphological, anatomical and molecular study. Here, we re-evaluate gastropod phylogenetic relationships by collecting new transcriptome data for 40 species and analysing them in combination with publicly available genomes and transcriptomes. Our datasets include all five main gastropod clades: Patellogastropoda, Vetigastropoda, Neritimorpha, Caenogastropoda and Heterobranchia. We use two different methods to assign orthology, subsample each of these matrices into three increasingly dense subsets, and analyse all six of these supermatrices with two different models of molecular evolution. All 12 analyses yield the same unrooted network connecting the five major gastropod lineages. This reduces deep gastropod phylogeny to three alternative rooting hypotheses. These results reject the prevalent hypothesis of gastropod phylogeny, Orthogastropoda. Our dated tree is congruent with a possible end-Permian recovery of some gastropod clades, namely Caenogastropoda and some Heterobranchia subclades. PMID:25232139

  19. Invasion of Impatiens glandulifera affects terrestrial gastropods by altering microclimate

    NASA Astrophysics Data System (ADS)

    Ruckli, Regina; Rusterholz, Hans-Peter; Baur, Bruno


    Invasive species can have far-reaching impacts on ecosystems. Invasive plants may be able to change habitat structure and quality. We conducted a field experiment to examine whether the invasive plant Impatiens glandulifera affects native terrestrial gastropods. We also evaluated whether the invasive plant alters forest soil characteristics and microclimate which in turn may influence gastropod abundance. We sampled gastropods in plots installed in patches of I. glandulifera, in plots in which I. glandulifera was regularly removed by hand, and in control plots which were not yet colonized by the invasive plant. The three types of plots were equally distributed over three mixed deciduous forest areas that were slightly, moderately or heavily affected by a wind throw 11 years ago. A total of 33 gastropod species were recorded. Gastropod species richness was not affected by delayed effects of the wind throw, but it was significantly higher in invaded plots than in uninvaded plots. Similarly, gastropod abundance was higher in invaded plots than in the two types of control plots. Canonical correspondence analysis revealed marginally significant shifts of gastropod communities between the three types of plots and indicated that soil moisture, presence of I. glandulifera and cover of woody debris affected gastropod species composition. Field measurements showed that soil moisture was higher and daily soil temperature was more damped in patches of I. glandulifera than in the native ground vegetation. The changed microclimatic conditions may favour certain gastropod species. In particular, ubiquitous species and species with a high inundation tolerance increased in abundance in plots invaded by I. glandulifera. Our field experiment demonstrated that an invasive plant can indirectly affect native organisms by changing soil characteristics and microclimate.

  20. Update on interstitial pneumonia.


    Wilkins, Pamela A; Lascola, Kara M


    Interstitial pneumonias encompass a wide variety of acute and chronic respiratory diseases and include the specific diseases equine multinodular pulmonary fibrosis and acute lung injury and acute respiratory distress. These diseases have been diagnosed in all age groups of horses, and numerous agents have been identified as potential causes of interstitial pneumonia. Despite the varied causes, interstitial pneumonia is uniformly recognized by the severity of respiratory disease and often poor clinical outcome. This article reviews the causal agents that have been associated with the development of interstitial pneumonia in horses. Pathophysiology, clinical diagnosis, and treatment options are discussed. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. Gastropod fauna of the Cameroonian coasts

    NASA Astrophysics Data System (ADS)

    Bandel, K.; Kowalke, T.


    Eighteen species of gastropods were encountered living near and within the large coastal swamps, mangrove forests, intertidal flats and the rocky shore of the Cameroonian coast of the Atlantic Ocean. These represent members of the subclasses Neritimorpha, Caenogastropoda, and Heterostropha. Within the Neritimorpha, representatives of the genera Nerita, Neritina, and Neritilia could be distinguished by their radula anatomy and ecology. Within the Caenogastropoda, representatives of the families Potamididae with Tympano-tonos and Planaxidae with Angiola are characterized by their early ontogeny and ecology. The Pachymelaniidae are recognized as an independent group and are introduced as a new family within the Cerithioidea. Littorinimorpha with Littorina, Assiminea and Potamopyrgus as well as Neogastropoda (Thais) and Heterostropha (Melampus and Onchidium) are described and compared with representatives of the Caribbean and Indo-Pacific province.

  2. Interstitial Lung Diseases


    Interstitial lung disease is the name for a large group of diseases that inflame or scar the lungs. The inflammation and scarring make it hard to ... air is responsible for some types of interstitial lung diseases. Specific types include Black lung disease among ...

  3. Does energy availability predict gastropod reproductive strategies?

    PubMed Central

    McClain, Craig R.; Filler, Ryan; Auld, Josh R.


    The diversity of reproductive strategies in nature is shaped by a plethora of factors including energy availability. For example, both low temperatures and limited food availability could increase larval exposure to predation by slowing development, selecting against pelagic and/or feeding larvae. The frequency of hermaphroditism could increase under low food availability as population density (and hence mate availability) decreases. We examine the relationship between reproductive/life-history traits and energy availability for 189 marine gastropod families. Only larval type was related to energy availability with the odds of having planktotrophic larvae versus direct development decreasing by 1% with every one-unit increase in the square root of carbon flux. Simultaneous hermaphroditism also potentially increases with carbon flux, but this effect disappears when accounting for evolutionary relationships among taxa. Our findings are in contrast to some theory and empirical work demonstrating that hermaphroditism should increase and planktotrophic development should decrease with decreasing productivity. Instead, they suggest that some reproductive strategies are too energetically expensive at low food availabilities, or arise only when energy is available, and others serve to capitalize on opportunities for aggregation or increased energy availability. PMID:25009058

  4. Cretaceous gastropods: contrasts between tethys and the temperate provinces.

    USGS Publications Warehouse

    Sohl, N.F.


    During the Cretaceous Period, gastropod faunas show considerable differences in their evolution between the Tethyan Realm (tropical) and the Temperate Realms to the north and south. Like Holocene faunas, prosobranch, gastropods constitute the dominant part of Cretaceous marine snail faunas. Entomotaeneata and opisthobranchs usually form all of the remainder. In Tethyan faunas the Archaeogastropoda form a consistent high proportion of total taxa but less than the Mesogastropoda throughout the period. In contrast, the Temperate faunas beginning in Albian times show a decline in percentages of archaeogastropod taxa and a significant increase in the Neogastropoda, until they constitute over 50 percent of the taxa in some faunas. The neogastropods never attain high diversity in the Cretaceous of the Tethyan Realm and are judged to be of Temperate Realm origin. Cretaceous Tethyan gastropod faunas are closely allied to those of the 'corallien facies' of the Jurassic and begin the period evolutionarily mature and well diversified. Three categories of Tethyan gastropods are analyzed. The first group consists of those of Jurassic ancestry. The second group orginates mainly during the Barremian and Aptian, reaches a climax in diversification during middle Cretaceous time, and usually declines during the latest Cretaceous. The third group originates late in the Cretaceous and consists of taxa that manage to either survive the Cretaceous-Tertiary crisis or give rise to forms of prominence among Tertiary warm water faunas. Temperate Realm gastropod faunas are less diverse than those of Tethys during the Early Cretaceous. They show a steady increase in diversity, primarily among the Mesogastropoda and Neogastropoda. This trend culminates in latest Cretaceous times when the gastropod assemblages of the clastic provinces of the inner shelf contain an abundance of taxa outstripping that of any other part of the Cretaceous of either realm. Extinction at the Cretaceous

  5. Interstitial Lung Disease


    ... of idiopathic interstitial pneumonias, which are tissue-based classifications. Factors that may make you more susceptible to ... the right side of your heart Improve your sleep and sense of well-being You're most ...

  6. Interstitial Lung Disease


    ... Critical Care & Sleep Medicine Interstitial Lung Disease Program Sarcoidosis Program Autoimmune Lung Center Rebecca C. Keith, MD, ... Syndromes Hypersensitivity Pneumonitis LAM Lupus Rheumatoid Arthritis (RA) Sarcoidosis Overview Scleroderma (SSC) Systemic Vasculitis Reasons to Visit ...

  7. Intracranial interstitial radiation

    SciTech Connect

    Willis, D.; Rittenmeyer, H.; Hitchon, P.


    Primary malignant brain tumors are fatal, with 90% of patients having these tumors dying within two years following diagnosis. Cranial interstitial radiation therapy, a technique under investigation to control these tumors, involves implantation of radioactive iodine 125 seeds into the tumor bed by stereotaxic technique. The interstitial radiation technique, monitoring of radiation, and nursing care of patients are discussed. Case histories are presented, along with discussion of results attained using this therapy, and its future.

  8. [Terrestrial gastropods from Misiones Province, Argentina].


    Gregoric, Diego Eduardo Gutiérrez; Núñez, Verónica; Vogler, Roberto Eugenio; Beltramino, Ariel Aníbal; Rumi, Alejandra


    The Atlantic Forest represents one of the global priority eco-regions for biodiversity conservation. In Argentina, this is represented by the Paranense Forest, which occupies much of the Misiones Province. In this paper, an updated list of land mollusks from Misiones Province is presented, and its species richness was evaluated comparing protected and unprotected areas. For this, we reviewed La Plata Museum Mollusk Collection, updated the literature review, and developed some field work between 2009 and 2010. For the areographic work, a grid (50 x 50 km) was applied to a Misiones province map. In this region, large areas of native vegetation constituting the Paranaense Forest still persist, and include protected areas such as the Iguazú National Park and Puerto Peninsula Provincial Park. These areas have been the most explored at the malacological level (both terrestrial and aquatic environments), a fact that is consistent with the greater number of records found, which may also be the explanation for the highest number of species recorded in the region. A database containing 497 records was compiled. The number of species occurring in this Province was increased from 28 to 56; 11 of which were exotic species. A total of 38 of the species occurred in protected areas and 53 in unprotected areas; and 25 species were micro-mollusks. Orthalicidae was the family with the highest species number (10) and the widest distribution, occupying 16/20 sampling units. Megalobulimus was the genus found in a greater number of sampling units (14/20). The highest values of specific richness of land gastropods were found in Northern Misiones (R=32). This richness was similar to that previously reported for the Tucumán Province, although species occurring in both provinces were mostly different. The richness in Misiones Province border areas, as the Republic of Paraguay and the state of Santa Catarina (Brazil), was about twice that found in the province. The present study showed the

  9. Interstitial laser prostatectomy

    NASA Astrophysics Data System (ADS)

    Johnson, Douglas E.; Cromeens, Douglas M.; Price, Roger E.


    Interstitial laser coagulation of the canine prostate using the Sharplan interstitial thermal therapy fiber (Model 25432) was performed in 9 adult dogs and the subsequent gross and histopathologic changes occurring in the prostate were studied at intervals ranging from 1 hour to 5 weeks. A large well-demarcated area of acute coagulative necrosis developed around each fiber tract which in turn was surrounded by a prominent narrow zone of marked tissue disruption and an outer zone of hemorrhage. Liquefaction developed within the coagulative areas within 24 hours and by 4 days, each prostatic lobe contained an irregular cavity which became lined by normal-appearing transitional epithelium and that by 5 weeks, communicated with the prostatic urethra. These changes, similar to those reported following transurethral visual laser ablation of the prostate, suggest that interstitial laser thermal therapy may provide an alternative means for treating selected patients suffering from prostatic enlargement.

  10. [Chronic interstitial pneumonitis].


    Almeida, Rui; Reis, Guilhermina; Ferreira, Cristina; Oliveira, Ma José; Oliveira, Dulce; Fernandes, Paula; Ferreira, Paula; Frutuoso, Simão; Carreira, Luísa; Alves, Valter; Paiva, António; Guedes, Margarida


    Interstitial lung disease includes a group of chronic diseases characterized by alterations in alveolar walls and loss of functional alveolar-capillary units. These are rare diseases in children, mostly with an unknown cause and associated with a high morbidity and mortality due to insufficient therapeutic effectiveness. The authors report a case of a previously healthy 3 years old child who presented with wheezing and severe respiratory insufficiency following a respiratory infection. The investigation performed led to the diagnosis of chronic interstitial pneumonitis. Several treatments have been tried (corticosteroids, hydroxychloroquine, N-acetylcysteine) without any obvious improvement.

  11. Annotated Checklist of the Terrestrial Gastropods of Nepal

    PubMed Central

    Budha, Prem B.; Naggs, Fred; Backeljau, Thierry


    Abstract This is the very first checklist of the terrestrial gastropods of Nepal. It includes 138 species and six subspecies, of which 22 species are endemic and four are introduced. It highlights 34 species recorded for the first time in Nepal and provides new distribution records for another 30 species. PMID:25878541

  12. Transcriptome of the Antarctic brooding gastropod mollusc Margarella antarctica.


    Clark, Melody S; Thorne, Michael A S


    454 RNA-Seq transcriptome data were generated from foot tissue of the Antarctic brooding gastropod mollusc Margarella antarctica. A total of 6195 contigs were assembled de novo, providing a useful resource for researchers with an interest in Antarctic marine species, phylogenetics and mollusc biology, especially shell production.

  13. Pennsylvanian gastropod Pseudozygopleura (Pseudozygopleura) from the Appalachian basin: II

    SciTech Connect

    Hoare, R.E.; Sturgeon, M.T.


    Twenty-five additional taxa to those described by Hoare and Sturgeon (1981) of the gastropod Pseudozygopleura (Pseudozygopleura) are described from the Pennsylvania System of the Appalachian Basin. A key for identification of known Pennsylvanian species from this region is included.

  14. Radiocarbon dating of small terrestrial gastropod shells in North America

    USGS Publications Warehouse

    Pigati, J.S.; Rech, J.A.; Nekola, J.C.


    Fossil shells of small terrestrial gastropods are commonly preserved in wetland, alluvial, loess, and glacial deposits, as well as in sediments at many archeological sites. These shells are composed largely of aragonite (CaCO3) and potentially could be used for radiocarbon dating, but they must meet two criteria before their 14C ages can be considered to be reliable: (1) when gastropods are alive, the 14C activity of their shells must be in equilibrium with the 14C activity of the atmosphere, and (2) after burial, their shells must behave as closed systems with respect to carbon. To evaluate the first criterion, we conducted a comprehensive examination of the 14C content of the most common small terrestrial gastropods in North America, including 247 AMS measurements of modern shell material (3749 individual shells) from 46 different species. The modern gastropods that we analyzed were all collected from habitats on carbonate terrain and, therefore, the data presented here represent worst-case scenarios. In sum, ~78% of the shell aliquots that we analyzed did not contain dead carbon from limestone or other carbonate rocks even though it was readily available at all sites, 12% of the aliquots contained between 5 and 10% dead carbon, and a few (3% of the total) contained more than 10%. These results are significantly lower than the 20-30% dead carbon that has been reported previously for larger taxa living in carbonate terrain. For the second criterion, we report a case study from the American Midwest in which we analyzed fossil shells of small terrestrial gastropods (7 taxa; 18 AMS measurements; 173 individual shells) recovered from late-Pleistocene sediments. The fossil shells yielded 14C ages that were statistically indistinguishable from 14C ages of well-preserved plant macrofossils from the same stratum. Although just one site, these results suggest that small terrestrial gastropod shells may behave as closed systems with respect to carbon over geologic

  15. Idiopathic Interstitial Pneumonias


    ... News) U.S. Medical Groups Sound the Alarm on Climate Change Additional Content Medical News Overview of Idiopathic Interstitial ... HealthDay U.S. Medical Groups Sound the Alarm on Climate Change WEDNESDAY, March 15, 2017 (HealthDay News) -- Climate change ...

  16. Karyomegalic Interstitial Nephritis

    PubMed Central

    Isnard, Pierre; Rabant, Marion; Labaye, Jacques; Antignac, Corinne; Knebelmann, Bertrand; Zaidan, Mohamad


    Abstract Karyomegalic interstitial nephritis is a rare cause of hereditary chronic interstitial nephritis, described for the first time over 40 years ago. A 36-year-old woman, of Turkish origin, presented with chronic kidney disease and high blood pressure. She had a history of recurrent upper respiratory tract infections but no familial history of nephropathy. Physical examination was unremarkable. Laboratory tests showed serum creatinine at 2.3 mg/dL with an estimated glomerular filtration rate of 26 mL/min/1.73m2, and gamma-glutamyl transpeptidase and alkaline phosphatase at 3 and 1.5 times the upper normal limit. Urinalysis showed 0.8 g/day of nonselective proteinuria, microscopic hematuria, and aseptic leukocyturia. Immunological tests and tests for human immunodeficiency and hepatitis B and C viruses were negative. Complement level and serum proteins electrophoresis were normal. Analysis of the renal biopsy showed severe interstitial fibrosis and tubular atrophy. Numerous tubular cells had nuclear enlargement with irregular outlines, hyperchromatic aspect, and prominent nucleoli. These findings were highly suggestive of karyomegalic interstitial nephritis, which was further confirmed by exome sequencing of FAN1 gene showing an identified homozygous frameshift mutation due to a one-base-pair deletion in exon 12 (c.2616delA). The present case illustrates a rare but severe cause of hereditary interstitial nephritis, sometimes accompanied by subtle extrarenal manifestations. Identification of mutations in FAN1 gene underscores recent insights linking inadequate DNA repair and susceptibility to chronic kidney disease. PMID:27196444

  17. Granulomatous interstitial nephritis

    PubMed Central

    Shah, Shivani; Carter-Monroe, Naima; Atta, Mohamed G.


    Granulomatous interstitial nephritis (GIN) is a rare entity detected in ∼0.5–0.9% of all renal biopsies. GIN has been linked to several antibiotics such as cephalosporins, vancomycin, nitrofurantoin and ciprofloxacin. It is also associated with NSAIDs and granulomatous disorders such as sarcoidosis, tuberculosis, fungal infections, and granulomatosis with polyangiitis. Renal biopsy is critical in establishing this diagnosis, and the extent of tubular atrophy and interstitial fibrosis may aid in determining prognosis. Retrospective data and clinical experience suggest that removal of the offending agent in conjunction with corticosteroid therapy often results in improvement in renal function. We describe a patient with a history of multiple spinal surgeries complicated by wound infection who presented with confusion and rash with subsequent development of acute kidney injury. Urinalysis demonstrated pyuria and eosinophiluria, and renal biopsy revealed acute interstitial nephritis with granulomas. These findings were attributed to doxycycline treatment of his wound infection. This review explores the clinical associations, presentation, diagnosis, and treatment of this uncommon cause of acute kidney injury. PMID:26413275

  18. Methanotrophic gastropods from a bathyal hydrocarbon seep, Gulf of Mexico

    SciTech Connect

    Anderson, L.C.; Aharon, P.; Gupta, S. )


    Two gastropods, Neritina sp. and Truncatella sp., collected live from a Gulf of Mexico active gas seep with the submersible Johnson Sea Link in September 1991, apparently incorporate methane-derived carbon in their soft tissues. Flesh of an individual Neritina sp. had a delta C-13 of [minus]50.92 per mil PDB, and that of two coexisting individuals of Truncatella sp. had values of [minus]45.11 and [minus]49.27 per mil. These isotope values are comparable to those reported for the methanotrophic mytilid bivalve Bathymodiolus sp. from other hydrocarbon seeps on the Gulf of Mexico, and are lighter than published isotopic values of chemosynthetic organisms with sulfur-oxidizing symbionts. The anomalously light carbon-isotopic values of Neritina sp. and Truncatella sp. may steam from one of three causes: (1) these gastropods host symbiotic methanotrophic bacteria, (2) their chief food is methane-oxidizing bacteria present at the seep, or (3) they incorporate some carbon from the periostracum of mussels on which they may graze. The presence of abundant juveniles of Bathymodiolus, reported to settle preferentially in areas of active seepage and high methane release, indicates that methane was abundant and supported a community with multiple trophic levels. Generally, studies of hydrocarbon-seep communities have focused on larger community members, especially bivalves and tube worms. The presence of living Neritina and Truncatella at the authors sampling site, however, draws attention to the fact that these gastropods are integral and significant parts of hydrocarbon-seep communities. Both gastropod species are members of genera that characteristically inhabit shallow marine, intertidal, and semiterrestrial environments. The presence of these genera in bathyal hydrocarbon seeps indicates that they have very broad environmental ranges, thus limiting their utility in paleoecologic reconstructions.

  19. Adaptation from restricted geometries: the shell inclination of terrestrial gastropods.


    Okajima, Ryoko; Chiba, Satoshi


    The adaptations that occur for support and protection can be studied with regard to the optimal structure that balances these objectives with any imposed constraints. The shell inclination of terrestrial gastropods is an appropriate model to address this problem. In this study, we examined how gastropods improve shell angles to well-balanced ones from geometrically constrained shapes. Our geometric analysis and physical analysis showed that constantly coiled shells are constrained from adopting a well-balanced angle; the shell angle of such basic shells tends to increase as the spire index (shell height/width) increases, although the optimum angle for stability is 90° for flat shells and 0° for tall shells. Furthermore, we estimated the influences of the geometric rule and the functional demands on actual shells by measuring the shell angles of both resting and active snails. We found that terrestrial gastropods have shell angles that are suited for balance. The growth lines of the shells indicated that this adaptation depends on the deflection of the last whorl: the apertures of flat shells are deflected downward, whereas those of tall shells are deflected upward. Our observations of active snails demonstrated that the animals hold their shells at better balanced angles than inactive snails.

  20. Interstitial duplication 19p

    SciTech Connect

    Stratton, R.F.; DuPont, B.R.; Moore, C.M.


    We report on a 9-month-old girl with an interstitial duplication of 19p, developmental delay, and multiple anomalies including bifrontal prominence, obtuse frontonasal angle, short columella, additional midline philtral pillar, midline ridge on the tongue, vertical midline ridge at the mental symphysis, and a complex congenital heart defect including severe branch pulmonary artery stenosis, secundum atrial septal defect (ASD), and several ventricular septal defects (VSDs). Use of fluorescent in situ hybridization (FISH) with chromosome 19- specific probes showed a direct duplication of bands 19p13.13 and 19p13.2. 6 refs., 1 fig.

  1. Lymphocytic Interstitial Pneumonia.


    Panchabhai, Tanmay S; Farver, Carol; Highland, Kristin B


    Lymphocytic interstitial pneumonia (LIP) is a rare lung disease on the spectrum of benign pulmonary lymphoproliferative disorders. LIP is frequently associated with connective tissue diseases or infections. Idiopathic LIP is rare; every attempt must be made to diagnose underlying conditions when LIP is diagnosed. Computed tomography of the chest in patients with LIP may reveal ground-glass opacities, centrilobular and subpleural nodules, and randomly distributed thin-walled cysts. Demonstrating polyclonality with immunohistochemistry is the key to differentiating LIP from lymphoma. The 5-year mortality remains between 33% and 50% and is likely to vary based on the underlying disease process.

  2. [Idiopathic interstitial pneumonias in 2016].


    Debray, M-P; Borie, R; Danel, C; Khalil, A; Majlath, M; Crestani, B


    Idiopathic interstitial pneumonias comprise 8 clinicopathological entities, most of them with a chronic course and various prognosis. Idiopathic pulmonary fibrosis is the most frequent and most severe of these. Computed tomography has an important role for its diagnosis. It can identify the corresponding pathological pattern of usual interstitial pneumonia in about 50 percent of cases. It can suggest differential diagnosis in other cases, most frequently fibrosing nonspecific interstitial pneumonia and chronic hypersensitivity pneumonitis. Imaging features should be integrated to clinical and available pathologic data during multidisciplinary team meetings involving physicians with a good knowledge of interstitial diseases. Some cases may be unclassifiable, but these could later be reclassified as new data may occur or imaging features may change. Surgical lung biopsy is being less frequently performed and an emerging less invasive technique, lung cryobiopsy, is under evaluation. Pleuroparenchymal fibroelastosis is a distinct entity only recently described, with uncertain prevalence and prognosis that seems being quite often associated to another pattern of interstitial pneumonia.

  3. Phylogeographical disjunction in abundant high-dispersal littoral gastropods.


    Waters, J M; King, T M; O'Loughlin, P M; Spencer, H G


    Abstract Phylogeographical disjunctions in high-dispersal marine taxa are variously ascribed to palaeogeographical conditions or contemporary ecological factors. Associated biogeographical studies, however, seldom incorporate the sampling design required to confidently discriminate among such competing hypotheses. In the current study, over 7800 gastropod specimens were examined for operculum colour, and 129 specimens genetically, to test ecological and historical biogeographical hypotheses relating to biogeographical disjunction in the Southern Hemisphere, and to southern Australia in particular. Mitochondrial DNA sequence analysis of the high-dispersal intertidal gastropod Nerita atramentosa in southern Australia (88 specimens; 18 localities) revealed an east-west phylogeographical split involving two highly divergent clades (26.0 +/- 1.9%) exhibiting minimal geographical overlap in the southeast. The eastern clade of Nerita atramentosa is also widespread in northern New Zealand (43 specimens, 10 localities), but no significant genetic differentiation is explained by the Tasman Sea, a 2000-km-wide oceanic barrier. Spatial genetic structure was not detected within either clade, consistent with the species' dispersive planktotrophic phase lasting for 5-6 months. Digital analysis of operculum colouration revealed substantial differences between eastern (tan) and western (black) specimens. Genetic analysis and visual inspection of 88 Australian specimens revealed a completely nonrandom association between mtDNA data and operculum colouration. Independent examination of a further 7822 specimens from 14 sites in southern Australia revealed both colour morphs at all localities, but reinforced the phylogeographical data by indicating a marked turnover in colour morph abundance associated with a palaeogeographical barrier: Wilsons Promontory. This sharp biogeographical disjunction is in marked contrast to the species' high dispersal abilities. The genetic similarity of

  4. Using microwaves to prepare gastropods for DNA barcoding.


    Galindo, L A; Puillandre, N; Strong, E E; Bouchet, P


    Extracting DNA from gastropods presents particular difficulties due to the capacity of the living animal to retract into the shell, resulting in poor penetration of the ethanol into the tissues. Because the shell is essential to establish the link between sequences and traditional taxonomic identity, cracking the shell to facilitate fixation is not ideal. Several methods are currently in routine use to overcome this difficulty, including chemical relaxation, drilling the shell and boiling. Most of these methods are time-consuming, may be safety hazards and constitute a bottleneck in the preparation of large numbers of specimens in the field. We have experimented with a method traditionally used to clean shells that involves placing the living gastropods in a microwave (MW) oven; the electromagnetic radiation very quickly heats both the animal and the water trapped inside the shell, resulting in separation of the muscles that anchor the animal to the shell. Done properly, the body can be removed intact from the shell and the shell voucher is preserved undamaged. To test the method, the bodies of live-collected specimens from two gastropod species were separated from their shell by microwaving and by anesthetizing/drilling. After identical extraction and PCR procedures, the gels showed no difference in DNA quantity or quality, and the resulting sequences are identical within species. The method was then implemented on a large scale during expeditions, resulting in higher percentage of DNA extraction success. The MWs are also effective for quickly and easily removing other molluscs from their shells, that is, bivalves and scaphopods. Workflows implementing the MW technique show a three- to fivefold increase in productivity compared with other methods. © 2014 John Wiley & Sons Ltd.

  5. Renal Medullary Interstitial Cells

    NASA Astrophysics Data System (ADS)

    Rao, Reena; Hao, Chuan-Ming; Breyer, Matthew D.


    Renal medullary interstitial cells (RMICs) are specialized fibroblast-like cells that reside in the renal medulla among the vasa recta, the thin limbs of Henle's loop, and medullary collecting ducts. These cells are characterized by abundant lipid droplets in the cytoplasm. The lipid droplets are composed of triglycerides, cholesterol esters and free long-chain fatty acids, including arachidonic acid. RMICs are also a major site of cyclooxygenase2 (COX-2) expression, and thus a major site of COX-2 derived prostanoid biosynthesis. RMICs are also a potential target of hormones such as angiotensin II and endothelin. The RMIC COX-2 expression and the abundance of lipid droplets change with salt and water intake. These properties of RMICs are consistent with an important role of these cells in modulating physiologic and pathologic processes of the kidney.

  6. Phylogenetic and individual variation in gastropod central pattern generators.


    Sakurai, Akira; Katz, Paul S


    Gastropod molluscs provide a unique opportunity to explore the neural basis of rhythmic behaviors because of the accessibility of their nervous systems and the number of species that have been examined. Detailed comparisons of the central pattern generators (CPGs) underlying rhythmic feeding and swimming behaviors highlight the presence and effects of variation in neural circuits both across and within species. The feeding motor pattern of the snail, Lymnaea, is stereotyped, whereas the feeding motor pattern in the sea hare, Aplysia, is variable. However, the Aplysia motor pattern is regularized with operant conditioning or by mimicking learning using the dynamic clamp to change properties of CPG neurons. Swimming evolved repeatedly in marine gastropods. Distinct neural mechanisms underlie dissimilar forms of swimming, with homologous neurons playing different roles. However, even similar swimming behaviors in different species can be produced by distinct neural mechanisms, resulting from different synaptic connectivity of homologous neurons. Within a species, there can be variation in the strength and even valence of synapses, which does not have functional relevance under normal conditions, but can cause some individuals to be more susceptible to lesion of the circuit. This inter- and intra-species variation provides novel insights into CPG function and plasticity.

  7. Carbonate biomineralization in terrestrial gastropods: environmental vs. physiological constraints

    NASA Astrophysics Data System (ADS)

    Mierzwa, D.; Stolarski, J.


    Preservational potential of shells of terrestrial gastropods allows to use them as valuable (paleo)climatic proxies. Despite of the fact, that the elements incorporated in their skeleton derive almost entirely from their diet, details of the ion uptake routes have not been studied in details. This work is a first step in the investigations of element uptake and biomineralization processes in pulmonate gastropod Cepaea vindobonensis (Férussac, 1821). Although phenotypic plasticity in the shell characters of the species appears to be mainly genetic in nature, some differences seem to correlate with availability of ions used in biomineralization. For example, shells of individuals living in marginal parts of flood plains (environment extreme for the species and generally depleted in calcium) have weakened structure and faded color pattern, whereas individuals from the lime substrata form typically developed, pigmented shells with several cross-lamellar layers. Micro- and nanostructural characteristics of shells from different environments are visualized by SEM and AFM imaging techniques and some biogeochemical properties are characterized by spectroscopic and fluorescence methods. Further experiments are required to elucidate the ion/trace elements transfer between the substratum, nutrients, organism, and the shell.

  8. Evolution of corallivory in the gastropod genus Drupella

    NASA Astrophysics Data System (ADS)

    Claremont, M.; Reid, D. G.; Williams, S. T.


    Although muricid gastropods in the genus Drupella are well-known consumers of Indo-Pacific corals, their evolutionary and ecological history is unclear, as is their relationship to the apparently facultative coral-feeder Ergalatax margariticola, which has been reported to feed upon corals in Hong Kong. We use a well resolved molecular phylogeny (reconstructed from one nuclear and two mitochondrial genes) to show that the monophyletic genus Drupella falls into the muricid subfamily Ergalataxinae and that the genus includes ` E. margariticola', which is composed of two cryptic species. We show that genetic structure within the here reassigned ` Drupella margariticola' species complex does not relate to feeding mode, but instead seems to correspond to broad patterns of habitat ecology found in other gastropod taxa. Our analyses suggest that Drupella originated in the late Miocene (approximately 9.6 Ma) and diversified approximately 5.0 Ma, much later than the appearance of modern coral reefs in the early Cenozoic. Thus, it is possible that corallivory in Drupella evolved in response to the major expansion and reorganization of reefs that took place in the early Miocene.

  9. Variation in the diets of hydrothermal vent gastropods

    NASA Astrophysics Data System (ADS)

    Govenar, Breea; Fisher, Charles R.; Shank, Timothy M.


    A prevailing paradigm of hydrothermal vent ecology is that primary consumers feed on chemoautotrophic bacteria. However, for the purposes of reconstructing vent food webs and for tracking energy flow from the generation of rock and fluid chemistry through primary/ secondary productivity and consumption to the overlying water column, it remains unclear which consumers feed on which bacteria. In paired analyses of carbon and nitrogen tissue stable isotope values with unique 16S rRNA sequences from the stomach contents, we determined that two species of gastropod grazers appear to feed on epsilon-proteobacteria, while two other species have more diverse diets, including one species that consumes alpha-proteobacteria, planctomycetes, and non-green sulfur bacteria. Different carbon fixation pathways used by epsilon- and alpha-proteobacteria may account for the variation in the carbon stable isotope values among the consumers. Furthermore, our results indicate that trophic specialization and niche partitioning may contribute to the distribution and abundance of vent-endemic gastropods and support the hypothesis that consumers in the warmer habitats commonly feed on epsilon-proteobacteria that use the rTCA cycle, while in the cooler habitats they feed on additional bacteria that use the CBB cycle. These results suggest that the phylogenetic and metabolic diversity of free-living bacteria may play an important and previously overlooked role in facilitating species coexistence among primary consumers at hydrothermal vents and other chemosynthesis-based ecosystems.

  10. Interstitial lung disease - adults - discharge


    ... lung disease Pulmonary alveolar proteinosis Rheumatoid lung disease Sarcoidosis Patient Instructions Eating extra calories when sick - adults ... team. Related MedlinePlus Health Topics Interstitial Lung Diseases Sarcoidosis Browse the Encyclopedia A.D.A.M., Inc. ...

  11. [Interstitial Pneumonia and Emphysema].


    Sawa, Teiji; Kato, Yuko; Ishii, Sachiyo


    Interstitial pneumonia (IP) and chronic obstructive pulmonary disease (COPD) are representative diseases of restrictive pulmonary dysfunction and obstructive pulmonary dysfunction, respectively. In the preoperative anesthesia clinic, anesthesiologists are frequently asked to assess the anesthesia management of patients with these diseases. In respiratory function tests, IP is detected as a decrease in % vital capacity (< 80%), and COPD as a decrease in % FEV1.0 (< 70%). Other key factors which affect the assessment are; 1) severity assessment that affects the safety of anesthesia management, 2) prognostic evaluation including the acute exacerbation in the postoperative period, and 3) patient-related factors (age, life degree of autonomy, other comorbidities, surgery-related factors, and anesthesia method). In the patients in the disease stage I or II, anesthesia management is relatively safe. On the other hand, the patients in the disease stage IV have no surgical indication except life-saving emergent situation. In another words, anesthesiologists are required to make the judgment for the anesthesia management of the patient in the disease stage III, based on the assessment of patient-related factors, surgery-related factors, and prognosis.

  12. Declining interstitial transsudation in man

    NASA Technical Reports Server (NTRS)

    Demarchin, P.; Lagneaux, D.; Lecomte, J.


    Results and methodology of experimentation dealing with declining interstitial transsudation are discussed. Concepts of the formation of interstitial fluids are in agreement with measurements of calf volume in normal young women, in horizontal recumbency or after horizontal immersion. The volume of the calf is reduced when the hydrostatic pressure of the blood column is diminished under the phlebostatic level and when the external pressure is increased by the hydrostatic pressure of a water bath.

  13. Relationship Between Metabolic Rate and Sea Depth in Bivalves and Gastropods

    NASA Astrophysics Data System (ADS)

    Ruiz, B. R.; Shih, B.; Heim, N.; Payne, J.


    The purpose of this study was to find and observe trends in the metabolic rate of bivalves and gastropod in regards to sea depth in order to see if all organisms follow a general trend for metabolism and to provide data to help future conservation efforts of these keystone organisms. Using geographic data produced by McClain et. al (2012) and body size data from Heim et. al (2015), the metabolic rate and sea depth data were plotted using the `R statistical software'. The Pearson correlation test was performed on each respective graph. Deep sea mollusks were considered those that resided at a water depth of 500 meters or deeper while shallow mollusks resided at a depth less than 500 meters. The gastropods showed positive correlations in the relationship between metabolic rate and ocean depth while bivalves showed a negative trend. When the metabolic rate versus minimum ocean depth was graphed, the graphs for deep bivalves and shallow gastropods returned bad p-values. From this data, it can be seen that water depth and metabolic rate have relationships, although different molluscan classes are adapted to their environments in different ways, as seen by the differences in the relationships between metabolic rates and ocean depth of the gastropods and bivalves. The results indicated that there is a general negative trend between metabolic rate and ocean depth of bivalves, and a positive relationship for gastropods. The difference in relationship in gastropods is thought to be attributed to the size trends of gastropods as they live in deeper waters, which is that gastropods increase in size across the bathyal region, and decrease as gastropods approach the extremely deep water. As displayed by the two different metabolic trends, this study shows the different ways molluscan classes have adapted to different evolutionary selection pressures.

  14. [New records of bacteria-spirochetes in crystalline style of fresh water gastropods].


    Sitnikova, T Ia; Tulupopva, Iu R; Khanaeva, I V; Prozorova, L A


    Freshwater mollusks belonging to 17 species, in 7 families are examined purposely to search for spirochete bacteria in their crystalline style of the digestive system. As result of this study spirochetes are recorded in gastropod families Amnicolidae, Bithyniidae, Baicaliidae and Benedictiidae, represented by 12 species, occupying different habitats. Gastropods belonging to Valvatidae, Lymnaeidae and Planorbidae, characterized by lack of crystalline style did not include spirochetes in their stomachs. Studied gastropods having spirochetes or free of them are grazers or filter-feeders and mainly phyto-detrito-bacteriaphagous.

  15. [Terrestrial gastropods zoogeography in Southern Tamaulipas, México].


    Correa, Alfonso; Martínez, Víctor; Horta, Jorge; Castro, Iván


    Biogeography of Mexican terrestrial mollusks is poorly known, although many studies have described some of their biological aspects. This study aimed to contribute with new information on the distribution of terrestrial mollusks in this region of high altitudinal, topographic and climatic variations of Southern Tamaulipas State, México. For this, terrestrial gastropods were surveyed from December 1990 to November 2006. A total of 525 samples were obtained from 121 localities, characterized with different vegetation types. The primary zoogeographical feature was the presence of many endemic taxa, with 45 species or subspecies, representing the 43%, the highest value for Northeastern México. In addition, a total of 24 species (23%), were of Neotropical and Neartic distributions, and 15 species or subspecies (14%) exhibited Neotropical distributions. Furthermore, the family Spiraxidae showed the largest number of endemic species, with 17 species and two subspecies, and had the largest number of endemic species (27) for Northeastern México.

  16. Mass mortality of the vermetid gastropod Ceraesignum maximum

    NASA Astrophysics Data System (ADS)

    Brown, A. L.; Frazer, T. K.; Shima, J. S.; Osenberg, C. W.


    Ceraesignum maximum (G.B. Sowerby I, 1825), formerly Dendropoma maximum, was subject to a sudden, massive die-off in the Society Islands, French Polynesia, in 2015. On Mo'orea, where we have detailed documentation of the die-off, these gastropods were previously found in densities up to 165 m-2. In July 2015, we surveyed shallow back reefs of Mo'orea before, during and after the die-off, documenting their swift decline. All censused populations incurred 100% mortality. Additional surveys and observations from Mo'orea, Tahiti, Bora Bora, and Huahine (but not Taha'a) suggested a similar, and approximately simultaneous, die-off. The cause(s) of this cataclysmic mass mortality are currently unknown. Given the previously documented negative effects of C. maximum on corals, we expect the die-off will have cascading effects on the reef community.

  17. Europe's Neogene and Quaternary lake gastropod diversity - a statistical approach

    NASA Astrophysics Data System (ADS)

    Neubauer, Thomas A.; Georgopoulou, Elisavet; Harzhauser, Mathias; Mandic, Oleg; Kroh, Andreas


    During the Neogene Europe's geodynamic history gave rise to several long-lived lakes with conspicuous endemic radiations. However, such lacustrine systems are rare today as well as in the past compared to the enormous numbers of "normal" lakes. Most extant European lakes are mainly results of the Ice Ages and are due to their (geologically) temporary nature largely confined to the Pleistocene-Holocene. As glacial lakes are also geographically restricted to glacial regions (and their catchment areas) their preservation potential is fairly low. Also deposits of streams, springs, and groundwater, which today are inhabited by species-rich gastropod assemblages, are rarely preserved. Thus, the pre-Quaternary lacustrine record is biased towards long-lived systems, such as the Late Miocene Lake Pannon, the Early to Middle Miocene Dinaride Lake System, the Middle Miocene Lake Steinheim and several others. All these systems have been studied for more than 150 years concerning their mollusk inventories and the taxonomic literature is formidable. However, apart from few general overviews precise studies on the γ-diversities of the post-Oligocene European lake systems and the shifting biodiversity in European freshwater systems through space and time are entirely missing. Even for the modern faunas, literature on large-scale freshwater gastropod diversity in extant lakes is scarce and lacks a statistical approach. Our preliminary data suggest fundamental differences between modern and pre-Pleistocene freshwater biogeography in central Europe. A rather homogenous central European Pleistocene and Holocene lake fauna is contrasted by considerable provincialism during the early Middle Miocene. Aside from the ancient Dessaretes lakes of the Balkan Peninsula, Holocene lake faunas are dominated by planorbids and lymnaeids in species numbers. This composition differs considerably from many Miocene and Pliocene lake faunas, which comprise pyrgulid-, hydrobiid-, viviparid-, melanopsid

  18. The effects of experimentally induced adelphophagy in gastropod embryos.


    Thomsen, Olaf; Collin, Rachel; Carrillo-Baltodano, Allan


    Adelphophagy, development where embryos grow large by consuming morphologically distinct nutritive embryos or their own normal siblings is widespread but uncommon among animal phyla. Among invertebrates it is particularly common in some families of marine gastropods and segmented worms, but rare or unknown in other closely related families. In calyptraeid gastropods phylogenetic analysis indicates that adelphophagy has arisen at least 9 times from species with planktotrophic larval development. This pattern of frequent parallel evolution of adelphophagy suggests that the embryos of planktotrophic species might be predisposed to evolve adelphophagy. Here we used embryos of three species of planktotrophic calyptraeids, one from each of three major genera in the family (Bostrycapulus, Crucibulum, and Crepidula), to answer the following 3 questions: (1) Can embryos of species with planktotrophic development benefit, in terms of pre-hatching growth, from the ingestion of yolk and tissue from experimentally damaged siblings? (2) Does ingestion of this material from damaged siblings increase variation in pre-hatching size? and (3) Does this experimentally induced adelphophagy alter the allometry between the velum and the shell, increasing morphological similarity to embryos of normally adelphophagic species? We found an overall increase in shell length and velum diameter when embryos feed on damaged siblings within their capsules. There was no detectable increase in variation in shell length or velum diameter, or changes in allometry. The overall effect of our treatment was small compared to the embryonic growth observed in naturally adelphophagic development. However each embryo in our experiment probably consumed less than one sibling on average, whereas natural adelphophages often each consume 10-30 or more siblings. These results suggest that the ability to consume, assimilate, and benefit from yolk and tissue of their siblings is widespread across calyptraeids.

  19. Interstitial Functionalization in elemental Si

    NASA Astrophysics Data System (ADS)

    Kiefer, Boris; Fohtung, Edwin

    Societies in the 21st century will face many challenges. Materials science and materials design will be essential to address and master some if not all of these challenges. Semiconductors are among the most important technological material classes. Properties such as electrical transport are strongly affected by defects and a central goal continues to be the reduction of defect densities as much as possible in these compounds. Here we present results of interstitial Fe doping in elemental Si using first-principles DFT calculations. The preliminary results show that Fe will only occupy octahedral interstitial sites. The analysis of the electronic structure shows that the compounds are ferromagnetic and that a bandgap opens as interstitial Fe concentrations decrease, with a possible intermittent semi-metallic phase. The formation energy for interstitial Fe is unfavorable, as expected, by ~1.5 eV but becomes favorable as the chemical potential of Fe increases. Therefore, we expect that biasing the system with an external electrical field will lead to the formation of these materials. Thus, our results show that interstitial defects can be beneficial for the design of functionalities that differ significantly from those of the host material.

  20. Terrestrial gastropod succession in a late Holocene stream deposit in South Texas

    NASA Astrophysics Data System (ADS)

    Neck, Raymond W.


    Investigation of snail-bearing alluvium from the Smyth Crossing site in Uvalde County, Texas, indicates that the terrestrial gastropod fauna of this area has been stable for at least 3000 yr. However, relative proportions and presence/absence variations indicate changes in the relative occurrence of preferred microhabitats of certain snails. Gastropods from an excavated soil column reveal a succession of gastropod associations in response to succession of the plant community of the site from a riverside gravel bar to an upland savannah/grassland. Human impact on the gastropods is mostly contemporary, with apparent local extirpations of some species having occurred. The recovered paleofaunas provide no evidence for regional climatic change since 3000 yr B.P.

  1. Mitochondrial genome of the endangered marine gastropod Strombus gigas Linnaeus, 1758 (Mollusca: Gastropoda).


    Márquez, Edna J; Castro, Erick R; Alzate, Juan F


    The queen conch Strombus gigas is an endangered marine gastropod of significant economic importance across the Greater Caribbean region. This work reports for the first time the complete mitochondrial genome of S. gigas, obtained by FLX 454 pyrosequencing. The mtDNA genome encodes for 13 proteins, 22 tRNAs and 2 ribosomal RNAs. In addition, the coding sequences and gene synteny were similar to other previously reported mitogenomes of gastropods.

  2. Prior exposure influences the behavioural avoidance by an intertidal gastropod, Bembicium auratum, of acidified waters

    NASA Astrophysics Data System (ADS)

    Amaral, Valter; Cabral, Henrique N.; Bishop, Melanie J.


    Phenotypic plasticity may be critical to the maintenance of viable populations under future environmental change. Here we examined the role of behavioural avoidance of sub-optimal conditions in enabling the intertidal gastropod, Bembicium auratum, to persist in mangrove forests affected by the low pH runoff from acid sulphate soils (ASS). Behaviourally, the gastropod may be able to avoid periods of particularly high acidity by using pneumatophores and/or mangrove trunks to vertically migrate above the water line or by retreating into its shell. We hypothesised that (1) B. auratum would display greater and more rapid vertical migration out of acidified than reference estuarine waters, and (2) responses would be more pronounced in gastropods collected from acidified than reference sites. Gastropods from acidified sites showed significantly higher activity in and more rapid migration out of acidified waters of pH 6.2-7.0, than reference waters or waters of pH < 5.0. Gastropods from reference locations showed a significantly weaker response to acidified water than those from acidified waters, and which did not significantly differ from their response to reference water. At extremely low pHs, <5.0, a higher proportion of both acidified and reference gastropods retreated into their shell than at higher pHs. Both the migration of gastropods out of acidified waters and retraction into their shells serves to reduce exposure time to acidified waters and may reduce the impact of this stressor on their populations. The stronger response to acidification of gastropods from populations previously exposed to this stressor suggests that the response may be learned, inherited or induced over multiple exposures. Our study adds to growing evidence that estuarine organisms may exhibit considerable physiological and behaviour adaptive capacity to acidification. The potential for such adaptive capacity should be incorporated into studies seeking to forecast impacts to marine organisms

  3. Drug Induced Interstitial Lung Disease

    PubMed Central

    Schwaiblmair, Martin; Behr, Werner; Haeckel, Thomas; Märkl, Bruno; Foerg, Wolfgang; Berghaus, Thomas


    With an increasing number of therapeutic drugs, the list of drugs that is responsible for severe pulmonary disease also grows. Many drugs have been associated with pulmonary complications of various types, including interstitial inflammation and fibrosis, bronchospasm, pulmonary edema, and pleural effusions. Drug-induced interstitial lung disease (DILD) can be caused by chemotherapeutic agents, antibiotics, antiarrhythmic drugs, and immunosuppressive agents. There are no distinct physiologic, radiographic or pathologic patterns of DILD, and the diagnosis is usually made when a patient with interstitial lung disease (ILD) is exposed to a medication known to result in lung disease. Other causes of ILD must be excluded. Treatment is avoidance of further exposure and systemic corticosteroids in patients with progressive or disabling disease. PMID:22896776

  4. Pathology of Idiopathic Interstitial Pneumonias

    PubMed Central

    Hashisako, Mikiko; Fukuoka, Junya


    The updated classification of idiopathic interstitial pneumonias (IIPs) in 2013 by American Thoracic Society/European Respiratory Society included several important revisions to the categories described in the 2002 classification. In the updated classification, lymphoid interstitial pneumonia (LIP) was moved from major to rare IIPs, pleuroparenchymal fibroelastosis (PPFE) was newly included in the rare IIPs, acute fibrinous and organizing pneumonia (AFOP) and interstitial pneumonias with a bronchiolocentric distribution are recognized as rare histologic patterns, and unclassifiable IIP (UCIP) was classified as an IIP. However, recent reports indicate the areas of concern that may require further evaluation. Here, we describe the histopathologic features of the updated IIPs and their rare histologic patterns and also point out some of the issues to be considered in this context. PMID:26949346

  5. Interstitial brines in playa sediments

    USGS Publications Warehouse

    Jones, B.F.; Van Denburgh, A.S.; Truesdell, A.H.; Rettig, S.L.


    Study of several closed drainages in the Great Basin has shown that the interstitial solutions of shallow, fine-grained playa deposits store a large quantity of dissolved solids and are often more concentrated than associated lakes and ponds, except in peripheral zones of stream or ground-water inflow. These interstitial fluids, when compared with local runoff, impoundments, or spring waters, commonly have a distinctive ionic composition which sometimes cannot be explained by either simple mixing of surface and subsurface inflow or by evaporative concentration. At Abert Lake, Oregon, the interstitial solute concentrations increased with depth to values as much as five times greater than the lake, except where springs indicate significant ground-water input. Where Na+, Cl, and CO2 species constitute more than 90% of the solutes, Na+ Cl- ratios in the lake water are lower than in interstitial solutions of bottom cores and higher than in playa fluids. At the same time, Na+ K+ ratios are highest in the fluids of lake bottom muds and lowest in playa interstitials. In deeper playa profiles, interstitial Na+ Cl- tended to decrease with depth (5 ft. maximum). In the Abert Lake area, as in other parts of the western Great Basin, Na+ Cl- ratios are indicative of total CO2 in solution and the effects of organic decay in surficial sediments. These ratios, coupled with data on silica and bulk density, show that higher PCO2 accompanying decay promotes silicate dissolution and hydrogen ion exchange, stripping alkalis from sediment which had preferentially adsorbed K+ when entering the lake. On subsequent loss of pore fluid in the playa regime, silica initially released to solution in the lake environment is readsorbed on dissolution products. ?? 1969.

  6. Do terrestrial gastropods use olfactory cues to locate and select food actively?


    Kiss, Tibor


    Having been investigated for over 40 years, some aspects of the biology of terrestrial gastropod's olfactory system have been challenging and highly contentious, while others still remain unresolved. For example, a number of terrestrial gastropod species can track the odor of food, while others have no strong preferences toward food odor; rather they find it by random encounter. Here, while assessing the most recent findings and comparing them with earlier studies, the aspects of the food selection based on olfactory cues are examined critically to highlight the speculations and controversies that have arisen. We analyzed and compared the potential role of airborne odors in the feeding behavior of several terrestrial gastropod species. The available results indicate that in the foraging of most of the terrestrial gastropod species odor cues contribute substantially to food finding and selection. The results also suggest, however, that what they will actually consume largely depends on where they live and the species of gastropod that they are. Due to the voluminous literature relevant to this object, this review is not intended to be exhaustive. Instead, I selected what I consider to be the most important or critical in studies regarding the role of the olfaction in feeding of terrestrial gastropods.

  7. Interstitial nephritis. A brief review.

    PubMed Central

    Heptinstall, R. H.


    Interstitial nephritis is a common condition, which in spite of a relatively constant pathologic picture has different etiologic agents and pathogenetic mechanisms. Failure to appreciate this, particularly in the chronic group, has led to considerable confusion and has been largely responsible for the overdiagnosis of chronic pyelonephritis. Although we are still largely ignorant of the causes of interstitial nephritis, it is now possible to define many of them. While experimental studies have not made spectacular contributions to our understanding, an attempt is now being made to develop appropriate models, and we hope these will enable us to still further clarify our understanding of other entities. PMID:776003

  8. How Is Childhood Interstitial Lung Disease Treated?


    ... the NHLBI on Twitter. How Is Childhood Interstitial Lung Disease Treated? Childhood interstitial lung disease (chILD) is ... prevent acid reflux, which can lead to aspiration. Lung Transplant A lung transplant may be an option ...

  9. Shell color polymorphism in the marine gastropod Mitrella fusiformis

    NASA Astrophysics Data System (ADS)

    Jones, M. J.


    Gastropod mollusks are extremely important in marine ecosystems as predators and prey, especially in coral reefs. It is important to understand where and how these benthic organisms interact with their communities and with the physical aspects of their ecosystems. Our project is to study polymorphism among shallow water columbellids, a common and diverse family of marine neogastropod snail. Columbellids are small (most are less than 10 mm in length) and can be very common epibenthic carnivores in shallow marine systems. A number of nearshore species in this group are polymorphic for shell color and pattern, a factor that may correlate to their individual survival by making them more or less visible to predators and prey. Our objective is to investigate correlations between polymorphism, environment and sex in common local epibenthic marine gastropods. This study will focus on Mitrella fusiformis (Pease, 1868), one of the most common local columbellid species. Last year, we determined that there were trends for different morphs on the leeward and windward sides of Hawaii Island but our sample size was not large enough to show statistical significance. Thus, this year our project focuses on increasing sample size to better elucidate trends. In addition, further emphasis will be placed on collecting environmental data with the hopes of correlating environmental factors with certain polymorphisms. Common environmental factors to be recorded are salinity, temperature, food source and habitat. To study these organisms, we will make collections in several locations around the Island of Hawai`i, where they are found typically in 1m depth or less. Individual adult animals will be sexed, measured, and their shell color and pattern documented photographically using a dissecting stereomicroscope with camera. Most animals will be returned alive to their original habitat after data are collected. The resulting data set will allow us to investigate correlations between shell

  10. Ultrasound in Rheumatologic Interstitial Lung Disease: A Case Report of Nonspecific Interstitial Pneumonia in Rheumatoid Arthritis

    PubMed Central

    Laria, A.; Lurati, A.; Scarpellini, M.


    According to the American Thoracic Society (ATS)/European Respiratory Society consensus classification, idiopathic interstitial pneumonias (IIPs) include several clinic-radiologic-pathologic entities: idiopathic pulmonary fibrosis (IPF), usual interstitial pneumonia (UIP), nonspecific interstitial pneumonia (NSIP), cryptogenic organizing pneumonia, acute interstitial pneumonia, respiratory bronchiolitis-associated ILD, desquamative interstitial pneumonia, and lymphoid interstitial pneumonia. Ultrasound Lung Comets (ULCs) are an echographic chest-sonography hallmark of pulmonary interstitial fibrosis. We describe the ultrasound (US) findings in the follow-up of a NSIP's case in rheumatoid arthritis (RA). PMID:26240772

  11. Daily activity rhythms in the intertidal gastropod Hydrobia ulvae (Pennant)

    NASA Astrophysics Data System (ADS)

    Barnes, R. S. K.


    The intertidal gastropod Hydrobia ulvae was subjected experimentally in undisturbed core samples to different combinations of the presence or absence of light and of cover by seawater. As displayed in the field, a greater proportion of snails were active in the dark than in the light, and when covered by water as opposed to being provided only with a damp sediment surface. A slight, but significant, rhythmic change in activity levels, with a period averaging 24·5 h, was shownby animals maintained under conditions of constant darkness and of damp sediment surface. Peak activity in this rhythm, which is equivalent to only 1·3-1·6 times minimum levels, did not coincide with the peaks of activity displayed during the more marked rhythmic response of H. ulvae to natural fluctuations in light intensity and tidal water cover, however, and this presumed endogenous rhythm does not appear to contribute to such rhythmic activity in the field. Increased proportional activity in nature is suggested to be most likely a direct response to changes in ambient light intensity and to the presence or absence of water cover.

  12. Characterization of a Venom Peptide from a Crassispirid Gastropod

    PubMed Central

    Cabang, April B.; Imperial, Julita S.; Gajewiak, Joanna; Watkins, Maren; Corneli, Patrice Showers; Olivera, Baldomero M.; Concepcion, Gisela P.


    The crassispirids are a large branch of venomous marine gastropods whose venoms have not been investigated previously. We demonstrate that crassispirids comprise a major group of toxoglossate snails in a clade distinct from all turrids whose venoms have been analyzed. The isolation and biochemical definition of the first venom component from any crassispirid is described. Crassipeptide cce9a from Crassispira cerithina (Anton, 1838) was purified from crude venom by following biological activity elicited in young mice, lethargy and a lack of responsiveness to external stimuli. Using Edman sequencing and mass spectrometry, the purified peptide was shown to be 29 amino acid residues long, with the sequence: GSCGLPCHENRRCGWACYCDDGICKPLRV. The sequence assignment was verified through the analysis of a cDNA clone encoding the peptide. The peptide was chemically synthesized and folded; the synthetic peptide was biologically active and coelution with the native venom peptide was demonstrated. When injected into mice of various ages, the peptide elicited a striking shift in behavioral phenotype between 14 and 16 days, from lethargy to hyperactivity. PMID:21939682

  13. Angiostrongylus cantonensis in Introduced Gastropods in Southern Florida.


    Stockdale-Walden, Heather D; Slapcinsky, John; Qvarnstrom, Yvonne; McIntosh, Antoinette; Bishop, Henry S; Rosseland, Brent


    Angiostrongylus cantonensis , the rat lungworm, is a zoonotic, parasitic nematode that uses the rat as a definitive host and gastropods as intermediate hosts. It is prevalent in parts of Asia, the Pacific islands, and the Caribbean. In the United States, A. cantonensis is established in Hawaii and in recent years has been reported in Alabama, California, Louisiana, and Florida, where it has been found in the reintroduced Lissachatina fulica (also known as Achatina fulica), the giant African snail that was once eradicated from the state. Since 2004, A. cantonensis has been identified as the causative agent for 2 non-human primate deaths in Florida, one attributed to ingestion of the snail Zachrysia provisoria. Our study further supports the presence of A. cantonensis in Z. provisoria in Florida and identifies 2 additional introduced terrestrial snails, Bradybaena similaris and Alcadia striata, that serve as intermediate hosts for A. cantonensis , as well as evidence of rat infection, in southern Florida. The finding of both definitive and intermediate hosts suggests that A. cantonensis may be established in south Florida.

  14. Model of naticid gastropod predator-prey coevolution

    SciTech Connect

    DeAngelis, D.L.; Kitchell, J.A.; Post, W.M.; Travis, C.C.


    Size change over evolutionary time between two interacting species, a predatory naticid gastropod and its bivalve prey, is analyzed. We show that two simultaneous, maximizing algorithms (the predator maximizes energy intake; the prey maximizes reproductive output) result in an endogenous, coevolutionary size increase, to a stable attracting point. In particular, we show that selection for delayed reproduction in a predatorpreay system that is highly size-selective due to the predatory strategy of cost-benefit prey selection, coupled with the relative allometries of cost (prey shell thickness) and benefit (prey biomass) with prey size, and the highly size-dependent probability of successful predation, lead to a coevolutionary size increase for both predator and prey, up to a limit condition dictated by predatory respiration costs. In the absence of predation, the prey species attains a smaller size than in the presence of predation. Addition of the predator results in a delay in the timing of reproduction by the prey, thereby facilitating a size response.

  15. A Method for Quantifying, Visualising, and Analysing Gastropod Shell Form

    PubMed Central

    Liew, Thor-Seng; Schilthuizen, Menno


    Quantitative analysis of organismal form is an important component for almost every branch of biology. Although generally considered an easily-measurable structure, the quantification of gastropod shell form is still a challenge because many shells lack homologous structures and have a spiral form that is difficult to capture with linear measurements. In view of this, we adopt the idea of theoretical modelling of shell form, in which the shell form is the product of aperture ontogeny profiles in terms of aperture growth trajectory that is quantified as curvature and torsion, and of aperture form that is represented by size and shape. We develop a workflow for the analysis of shell forms based on the aperture ontogeny profile, starting from the procedure of data preparation (retopologising the shell model), via data acquisition (calculation of aperture growth trajectory, aperture form and ontogeny axis), and data presentation (qualitative comparison between shell forms) and ending with data analysis (quantitative comparison between shell forms). We evaluate our methods on representative shells of the genera Opisthostoma and Plectostoma, which exhibit great variability in shell form. The outcome suggests that our method is a robust, reproducible, and versatile approach for the analysis of shell form. Finally, we propose several potential applications of our methods in functional morphology, theoretical modelling, taxonomy, and evolutionary biology. PMID:27280463

  16. Species, Diaspore Volume and Body Mass Matter in Gastropod Seed Feeding Behavior

    PubMed Central

    Türke, Manfred; Weisser, Wolfgang W.


    Background Seed dispersal of ant-dispersed plants (myrmecochores) is a well studied ecosystem function. Recently, slugs have been found to act as seed dispersers of myrmecochores. The aim of our study was to (1) further generalize the finding that gastropods feed on seeds of myrmecochores and hence may act as seed dispersers, (2) to test whether gastropod body mass and the volume of diaspores have an influence on the seed dispersal potential. Methodology and Principal Findings We assessed the seed dispersal potential of four slug and snail species with a set of seven myrmecochorous plant species from seven different plant families common to Central European beech forests. Diaspores differed in shape and size. Gastropods differed in their readiness to feed on diaspores and in the proportion of seeds that were swallowed as a whole, and this readiness generally decreased with increasing diaspore size. Smaller Arionid slugs (58 mm body length; mean) mostly fed on the elaiosome but also swallowed small diaspores and therefore not only act as elaiosome consumers, a nutrient rich appendage on myrmecochorous diaspores, but may also disperse seeds. Large Arionid slugs (>100 mm body length) swallowed diaspores of all sizes. Diaspores swallowed by gastropods were defecated without damage. Within-species variability in body size also affect seed dispersal potential, as larger individuals of the red slug (Arion rufus) swallowed more diaspores of wood anemone (Anemone nemorosa) than smaller ones. Conclusions and Significance Our results help to generalize the finding that gastropods consume and potentially disperse seeds of myrmecochores. The dispersal potential of gastropods is strongly influenced by diaspore size in relation to gastropod size. PMID:23844239

  17. Species, diaspore volume and body mass matter in gastropod seed feeding behavior.


    Türke, Manfred; Weisser, Wolfgang W


    Seed dispersal of ant-dispersed plants (myrmecochores) is a well studied ecosystem function. Recently, slugs have been found to act as seed dispersers of myrmecochores. The aim of our study was to (1) further generalize the finding that gastropods feed on seeds of myrmecochores and hence may act as seed dispersers, (2) to test whether gastropod body mass and the volume of diaspores have an influence on the seed dispersal potential. We assessed the seed dispersal potential of four slug and snail species with a set of seven myrmecochorous plant species from seven different plant families common to Central European beech forests. Diaspores differed in shape and size. Gastropods differed in their readiness to feed on diaspores and in the proportion of seeds that were swallowed as a whole, and this readiness generally decreased with increasing diaspore size. Smaller Arionid slugs (58 mm body length; mean) mostly fed on the elaiosome but also swallowed small diaspores and therefore not only act as elaiosome consumers, a nutrient rich appendage on myrmecochorous diaspores, but may also disperse seeds. Large Arionid slugs (>100 mm body length) swallowed diaspores of all sizes. Diaspores swallowed by gastropods were defecated without damage. Within-species variability in body size also affect seed dispersal potential, as larger individuals of the red slug (Arion rufus) swallowed more diaspores of wood anemone (Anemone nemorosa) than smaller ones. Our results help to generalize the finding that gastropods consume and potentially disperse seeds of myrmecochores. The dispersal potential of gastropods is strongly influenced by diaspore size in relation to gastropod size.

  18. Assessing open-system behavior of 14C in terrestrial gastropod shells

    USGS Publications Warehouse

    Rech, Jason A.; Pigati, Jeffrey S.; Lehmann, Sophie B.; McGimpsey, Chelsea N.; Grimley, David A.; Nekola, Jeffrey C.


    In order to assess open-system behavior of radiocarbon in fossil gastropod shells, we measured the 14C activity on 10 aliquots of shell material recovered from Illinoian (~190-130 ka) and pre-Illinoian (~800 ka) loess and lacustrine deposits in the Midwestern USA. Eight of the 10 aliquots yielded measurable 14C activities that ranged from 0.25 to 0.53 percent modern carbon (pMC), corresponding to apparent 14C ages between 48.2 and 42.1 ka. This small level of open-system behavior is common in many materials that are used for 14C dating (e.g. charcoal), and typically sets the upper practical limit of the technique. Two aliquots of gastropod shells from the Illinoian-aged Petersburg Silt (Petersburg Section) in central Illinois, USA, however, yielded elevated 14C activities of 1.26 and 1.71 pMC, which correspond to apparent 14C ages of 35.1 and 32.7 ka. Together, these results suggest that while many fossil gastropods shells may not suffer from major (>1%) open-system problems, this is not always the case. We then examined the mineralogy, trace element chemistry, and physical characteristics of a suite of fossil and modern gastropod shells to identify the source of contamination in the Petersburg shells and assess the effectiveness of these screening techniques at identifying samples suitable for 14C dating. Mineralogical (XRD) and trace element analyses were inconclusive, which suggests that these techniques are not suitable for assessing open-system behavior in terrestrial gastropod shells. Analysis with scanning electron microscopy (SEM), however, identified secondary mineralization (calcium carbonate) primarily within the inner whorls of the Petersburg shells. This indicates that SEM examination, or possibly standard microscope examination, of the interior of gastropod shells should be used when selecting fossil gastropod shells for 14C dating.

  19. Assessing open-system behavior of 14C in terrestrial gastropod shells

    USGS Publications Warehouse

    Rech, J.A.; Pigati, J.S.; Lehmann, S.B.; McGimpsey, C.N.; Grimley, D.A.; Nekola, J.C.


    In order to assess open-system behavior of radiocarbon in fossil gastropod shells, we measured the 14C activity on 10 aliquots of shell material recovered from Illinoian (~190-130 ka) and pre-Illinoian (~800 ka) loess and lacustrine deposits in the Midwestern USA. Eight of the 10 aliquots yielded measurable 14C activities that ranged from 0.25 to 0.53 percent modern carbon (pMC), corresponding to apparent 14C ages between 48.2 and 42.1 ka. This small level of open-system behavior is common in many materials that are used for 14C dating (e.g. charcoal), and typically sets the upper practical limit of the technique. Two aliquots of gastropod shells from the Illinoian-aged Petersburg Silt (Petersburg Section) in central Illinois, USA, however, yielded elevated 14C activities of 1.26 and 1.71 pMC, which correspond to apparent 14C ages of 35.1 and 32.7 ka. Together, these results suggest that while many fossil gastropods shells may not suffer from major (>1%) open-system problems, this is not always the case. We then examined the mineralogy, trace element chemistry, and physical characteristics of a suite of fossil and modern gastropod shells to identify the source of contamination in the Petersburg shells and assess the effectiveness of these screening techniques at identifying samples suitable for 14C dating. Mineralogical (XRD) and trace element analyses were inconclusive, which suggests that these techniques are not suitable for assessing open-system behavior in terrestrial gastropod shells. Analysis with scanning electron microscopy (SEM), however, identified secondary mineralization (calcium carbonate) primarily within the inner whorls of the Petersburg shells. This indicates that SEM examination, or possibly standard microscope examination, of the interior of gastropod shells should be used when selecting fossil gastropod shells for 14C dating. ?? 2011 by the Arizona Board of Regents on behalf of the University of Arizona.

  20. Radiocarbon dating loess deposits in the Mississippi Valley using terrestrial gastropod shells (Polygyridae, Helicinidae, and Discidae)

    NASA Astrophysics Data System (ADS)

    Pigati, Jeffrey S.; McGeehin, John P.; Muhs, Daniel R.; Grimley, David A.; Nekola, Jeffrey C.


    Small terrestrial gastropod shells (mainly Succineidae) have been used successfully to date late Quaternary loess deposits in Alaska and the Great Plains. However, Succineidae shells are less common in loess deposits in the Mississippi Valley compared to those of the Polygyridae, Helicinidae, and Discidae families. In this study, we conducted several tests to determine whether shells of these gastropods could provide reliable ages for loess deposits in the Mississippi Valley. Our results show that most of the taxa that we investigated incorporate small amounts (1-5%) of old carbon from limestone in their shells, meaning that they should yield ages that are accurate to within a few hundred years. In contrast, shells of the genus Mesodon (Mesodon elevatus and Mesodon zaletus) contain significant and variable amounts of old carbon, yielding ages that are up to a couple thousand 14C years too old. Although terrestrial gastropod shells have tremendous potential for 14C dating loess deposits throughout North America, we acknowledge that accuracy to within a few hundred years may not be sufficient for those interested in developing high-resolution loess chronologies. Even with this limitation, however, 14C dating of terrestrial gastropod shells present in Mississippi Valley loess deposits may prove useful for researchers interested in processes that took place over multi-millennial timescales or in differentiating stratigraphic units that have significantly different ages but similar physical and geochemical properties. The results presented here may also be useful to researchers studying loess deposits outside North America that contain similar gastropod taxa.

  1. Conservation status of freshwater gastropods of Canada and the United States

    USGS Publications Warehouse

    Johnson, Paul D.; Bogan, Arthur E.; Brown, Kenneth M.; Burkhead, Noel M.; Cordeiro, James R.; Garner, Jeffrey T.; Hartfield, Paul D.; Lepitzki, Dwayne A.; Mackie, Gerry L.; Pip, Eva; Tarpley, Thomas A.; Tiemann, Jeremy S.; Whelan, Nathan V.; Strong, Ellen E.


    This is the first American Fisheries Society conservation assessment of freshwater gastropods (snails) from Canada and the United States by the Gastropod Subcommittee (Endangered Species Committee). This review covers 703 species representing 16 families and 93 genera, of which 67 species are considered extinct, or possibly extinct, 278 are endangered, 102 are threatened, 73 are vulnerable, 157 are currently stable, and 26 species have uncertain taxonomic status. Of the entire fauna, 74% of gastropods are imperiled (vulnerable, threatened, endangered) or extinct, which exceeds imperilment levels in fishes (39%) and crayfishes (48%) but is similar to that of mussels (72%). Comparison of modern to background extinction rates reveals that gastropods have the highest modern extinction rate yet observed, 9,539 times greater than background rates. Gastropods are highly susceptible to habitat loss and degradation, particularly narrow endemics restricted to a single spring or short stream reaches. Compilation of this review was hampered by a paucity of current distributional information and taxonomic uncertainties. Although research on several fronts including basic biology, physiology, conservation strategies, life history, and ecology are needed, systematics and curation of museum collections and databases coupled with comprehensive status surveys (geographic limits, threat identification) are priorities.

  2. Digenean-gastropod host associations inform on aspects of specific immunity in snails

    PubMed Central

    Adema, C.M.; Loker, E.S.


    Gastropod immunology is informed importantly by the study of the frequent encounters snails endure with digeneans (digenetic trematodes). One of the hallmarks of gastropod-digenean associations is their specificity: any particular digenean parasite species is transmitted by a limited subset of snail taxa. We discuss the nature of this specificity, including its immunological basis. We then review studies of the model gastropod Biomphalaria glabrata indicating that the baseline responses of snails to digeneans can be elevated in a specific manner. Studies incorporating molecular and functional approaches are then highlighted, and are further suggestive of the capacity for specific gastropod immune responses. These studies have led to the compatibility polymorphism hypothesis: the interactions between diversified fibrinogen-related proteins (FREPs) and diverse carbohydrate-decorated polymorphic parasite antigens determine recognition and trigger specific immunity. Complex glycan structures are also likely to play a role in the host specificity typifying snail-digenean interactions. We conclude by noting the dynamic and consequential interactions between snails and digeneans can be considered as drivers of diversification of digenean parasites and in the development and maintenance of specific immunity in gastropods. PMID:25034871

  3. Estrogen receptor genes in gastropods: phylogenetic divergence and gene expression responses to a synthetic estrogen.


    Hultin, Cecilia L; Hallgren, Per; Hansson, Maria C


    Endocrine disrupting chemicals (EDCs) have the potential to affect development and reproduction in gastropods. However, one is today lacking basic understanding of the Molluscan endocrine system and one can therefore not fully explain these EDC-induced affects. Furthermore, only a few genes that potentially may be connected to the endocrine system have been sequenced in gastropods. An example is the estrogen receptor gene (er) that have been identified in a restricted number of freshwater and marine gastropods. Here, we have identified a new partial coding sequence of an estrogen receptor gene (er) in the European common heterobranch Radix balthica. The following phylogenetic analysis divided the ers of heterobranchs and ceanogastropods in two branches. Furthermore, exposure to the synthetic estrogen 17α-ethinylestradiol (EE2) showed that exposure could significantly affect er expression level in the heterobranch R. balthica. This paper is the first that phylogenetically compares gastropods' er, basal er expression profiles, and transcriptional estrogenic responses in gastropods from two different evolutionary groups.

  4. Checklist of Gastropods from the Exclusive Economic Zone (EEZ), Sarawak, Malaysia

    PubMed Central

    Morni, Wan Zabidii Wan; Rahim, Siti Akmar Khadijah Ab; Rumpet, Richard; Musel, Jamil; Hassan, Ruhana


    This study provides the first marine gastropod checklist from the Sarawak Exclusive Economic Zone (EEZ). Gastropod samples were collected from selected stations in the Sarawak EEZ using an otter trawl net with a stretched mesh size of 38 mm at the cod end. The trawling operations were conducted more than 12 nautical miles from the coast, and the area was divided into three depth strata: I) 20–50 m, II) 50–100 m and III) 100–200 m. A total of 23 gastropod species were identified during the two-month sampling period from 16 August until 6 October 2015, representing 8 superfamilies, 15 families and 20 genera. Superfamily Tonnoidea was represented by 7 species, followed by Muricoidea (5 species), Cypraeoidea (4 species), and Buccinoidea and Conoidea (both with 2 species). Other superfamilies were represented by a single species. Only 3 species were obtained in 2 depth strata, namely Melo melo, Murex aduncospinosus and Tonna galea. In addition, 9, 13 and 4 species of gastropods were found in strata I, II and III, respectively. The information on gastropod distributions at different depth strata in the Sarawak EEZ could be useful in updating the Malaysian species diversity database. PMID:28228920

  5. Ancient lakes as evolutionary reservoirs: evidence from the thalassoid gastropods of Lake Tanganyika.


    Wilson, Anthony B; Glaubrecht, Matthias; Meyer, Axel


    Ancient lakes are often collectively viewed as evolutionary hot spots of diversification. East Africa's Lake Tanganyika has long been the subject of scientific interest owing to dramatic levels of endemism in species as diverse as cichlid fishes, paludomid gastropods, decapod and ostracod crustaceans and poriferans. It is the largest and deepest of the African rift lakes, and its endemic fauna has been presented with a stable inland environment for over 10 Myr, offering unique opportunities for within-lake diversification. Although astonishing diversification has been documented in the endemic cichlid fauna of the lake, similar patterns of rapid diversification have long been assumed for other groups. In contrast to this hypothesis of rapid speciation, we show here that there has been no acceleration in the rate of speciation in the thalassoid gastropods of the lake following lake colonization. While limited within-lake speciation has occurred, the dramatic conchological diversity of gastropods presently found within the lake has evolved from at least four major lineages that pre-date its formation by as much as 40 Myr. At the same time, a widespread group of African gastropods appears to have evolved from taxa presently found in the lake. While Lake Tanganyika has been a cradle of speciation for cichlid fishes, it has also been an important evolutionary reservoir of gastropod lineages that have been extirpated outside the basin.

  6. Checklist of Gastropods from the Exclusive Economic Zone (EEZ), Sarawak, Malaysia.


    Morni, Wan Zabidii Wan; Rahim, Siti Akmar Khadijah Ab; Rumpet, Richard; Musel, Jamil; Hassan, Ruhana


    This study provides the first marine gastropod checklist from the Sarawak Exclusive Economic Zone (EEZ). Gastropod samples were collected from selected stations in the Sarawak EEZ using an otter trawl net with a stretched mesh size of 38 mm at the cod end. The trawling operations were conducted more than 12 nautical miles from the coast, and the area was divided into three depth strata: I) 20-50 m, II) 50-100 m and III) 100-200 m. A total of 23 gastropod species were identified during the two-month sampling period from 16 August until 6 October 2015, representing 8 superfamilies, 15 families and 20 genera. Superfamily Tonnoidea was represented by 7 species, followed by Muricoidea (5 species), Cypraeoidea (4 species), and Buccinoidea and Conoidea (both with 2 species). Other superfamilies were represented by a single species. Only 3 species were obtained in 2 depth strata, namely Melo melo, Murex aduncospinosus and Tonna galea. In addition, 9, 13 and 4 species of gastropods were found in strata I, II and III, respectively. The information on gastropod distributions at different depth strata in the Sarawak EEZ could be useful in updating the Malaysian species diversity database.

  7. Interstitial microwave hyperthermia treatment investigations

    NASA Astrophysics Data System (ADS)

    Siauve, N.; Lormel, C.


    Microwave ablation also called interstitial hyperthermia is a medical procedure used in the treatment of many cancers, cardiac arrhythmias and other medical conditions. With this medical therapy, an electromagnetic source (antenna) is directly positioned in the target tissue and a sufficient power is injected to necrosis the tissue. The aim of this study is to propose a design procedure and develop the associated tools, for determining the optimal shape, dimensions, type and operating frequency of antenna according to the target volume. In this context, a 3D numerical predictive model of temperature elevation induced by the electric fields and two benches for thermal and electrical tissues properties characterization have been developed. To validate the procedure and the different tools, an experimental bench test which includes interstitial antenna, external microwave generator, phantom that represents the target tissue and measurement system of temperature and electric field has been elaborated.

  8. Phentermine induced acute interstitial nephritis.


    Shao, Emily Ximin; Wilson, Gregory John; Ranganathan, Dwarakanathan


    Acute interstitial nephritis (AIN) has a number of medication-related aetiologies. Antibiotics, proton pump inhibitors and non-steroidal anti-inflammatory drugs are common causes; however, any medication has the potential to cause drug-induced AIN. We report the first case of phentermine-induced AIN. A Caucasian woman aged 43 years presented with a 5-week history of lethargy, left-sided lower abdominal pain, nausea and vomiting. She had been taking phentermine for weight loss for 9 months and had recently ceased the medication. The patient underwent a renal biopsy that showed a predominantly lymphohistiocytic interstitial infiltrate with a moderate number of eosinophils consistent with AIN. Phentermine is increasingly used for weight loss in obese patients. This is the first case implicating phentermine as the causative agent for drug-induced AIN. While rare, phentermine-induced AIN is a possible adverse reaction of phentermine. Physicians and patients need to be aware of this risk.

  9. Interstitial lung disease in children.


    Cazzato, Salvatore; di Palmo, Emanuela; Ragazzo, Vincenzo; Ghione, Silvia


    Children's interstitial lung disease (ILD) includes a wide range of rare respiratory disorders associated with high morbidity and mortality. Genetic factors, systemic disease processes, nonspecific inflammatory or fibrotic patterns of repair seen in a number of clinical settings are involved in the ILD pathogenesis. Specific disorders more prevalent in young children include diffuse developmental disorders, alveolar growth abnormalities, genetic surfactant disorders, pulmonary interstitial glycogenosis and neuroendocrine cell hyperplasia of infancy. It may be difficult to recognize these entities and this can lead to delayed treatment. The diagnostic approach is based on a combination of history/physical examinations, imaging studies, pulmonary function testing, genetic testing, bronchoalveolar lavage (BAL) and in most cases an open lung biopsy. Although some disease types overlap with those seen in adults, in this review emphasis is placed on entities unique to the pediatric population focusing on clinical characteristics, histologic definitions, radiologic-pathologic correlation and therapeutic strategies. © 2013.

  10. Smoking and interstitial lung diseases.


    Margaritopoulos, George A; Vasarmidi, Eirini; Jacob, Joseph; Wells, Athol U; Antoniou, Katerina M


    For many years has been well known that smoking could cause lung damage. Chronic obstructive pulmonary disease and lung cancer have been the two most common smoking-related lung diseases. In the recent years, attention has also focused on the role of smoking in the development of interstitial lung diseases (ILDs). Indeed, there are three diseases, namely respiratory bronchiolitis-associated ILD, desquamative interstitial pneumonia and pulmonary Langerhans cell histiocytosis, that are currently considered aetiologically linked to smoking and a few others which are more likely to develop in smokers. Here, we aim to focus on the most recent findings regarding the role of smoking in the pathogenesis and clinical behaviour of ILDs. Copyright ©ERS 2015.

  11. Pulmonary gas conducting interstitial pathway

    PubMed Central

    Eklund, Gunnar; Jorulf, Håkan; Farkas, Árpád; Eden-Strindberg, Jerker; Gennser, Mikael; Jókay, Ágnes; Krebsz, Ádám


    In spite of the growing efforts oriented towards revealing different aspects of emphysema, the persistence of the emphysematous or emphysema-like changes (ELCs) is not explored yet in the open literature. In this study we demonstrate the persistence of an ELC for 22 years in a spontaneous pneumothorax (SP) patient which indicates a hitherto unknown gas supply to the ELC. For this purpose we used high resolution computed tomography (HRCT) images processed into three-dimensional (3D) geometry. By the same token, not only a long persistence but also the volume increase of this ELC between 2002 and 2010 was demonstrated. The 3D geometry visualized an aerated interstitial structure between the sites of supposed gas leakage at the wall of the third generation airways and the ELC. This potential gas conducting interstitial pathway is not a continuation and has neither the form nor the structure of a bronchus. The finding suggests that in this patient the intrabronchial gas passes through the bronchial wall and via a gas conducting interstitial pathway reaches the ELC. Despite the availability of the presently employed techniques for at least 15 years, such case and phenomenon have not been described previously. The retrieval of the patient suggests that the findings could be relevant for a considerable proportion of the population. PMID:26500785

  12. At the limits of a successful body plan – 3D microanatomy, histology and evolution of Helminthope (Mollusca: Heterobranchia: Rhodopemorpha), the most worm-like gastropod

    PubMed Central


    Background Gastropods are among the most diverse animal clades, and have successfully colonized special habitats such as the marine sand interstitial. Specialized meiofaunal snails and slugs are tiny and worm-shaped. They combine regressive features – argued to be due to progenetic tendencies – with convergent adaptations. Microscopic size and concerted convergences make morphological examination non-trivial and hamper phylogenetic reconstructions. The enigmatic turbellarian-like Rhodopemorpha are a small group that has puzzled systematists for over a century. A preliminary molecular framework places the group far closer to the root of Heterobranchia – one of the major gastropod groups – than previously suggested. The poorly known meiofaunal Helminthope psammobionta Salvini-Plawen, 1991 from Bermuda is the most worm-shaped free-living gastropod and shows apparently aberrant aspects of anatomy. Its study may give important clues to understand the evolution of rhodopemorphs among basal heterobranchs versus their previously thought origin among ‘higher’ euthyneuran taxa. Results We describe the 3D-microanatomy of H. psammobionta using three-dimensional digital reconstruction based on serial semithin histological sections. The new dataset expands upon the original description and corrects several aspects. Helminthope shows a set of typical adaptations and regressive characters present in other mesopsammic slugs (called ‘meiofaunal syndrome’ herein). The taxonomically important presence of five separate visceral loop ganglia is confirmed, but considerable further detail of the complex nervous system are corrected and revealed. The digestive and reproductive systems are simple and modified to the thread-like morphology of the animal; the anus is far posterior. There is no heart; the kidney resembles a protonephridium. Data on all organ systems are compiled and compared to Rhodope. Conclusions Helminthope is related to Rhodope sharing unique apomorphies

  13. The Environmental Context of Gastropods on Western Laurentia (Basin and Range Province) during the Great Ordovician Biodiversification Event

    ERIC Educational Resources Information Center

    Dahl, Robyn Mieko


    Gastropods are a major component of modern marine ecosystems and can be found in nearly every type of marine ecosystem. They experienced their first notable radiation during the Great Ordovician Biodiversification Event (~470 Ma), during which their diversity tripled. This study examines the gastropod assemblage preserved in the Basin and Range…

  14. The Environmental Context of Gastropods on Western Laurentia (Basin and Range Province) during the Great Ordovician Biodiversification Event

    ERIC Educational Resources Information Center

    Dahl, Robyn Mieko


    Gastropods are a major component of modern marine ecosystems and can be found in nearly every type of marine ecosystem. They experienced their first notable radiation during the Great Ordovician Biodiversification Event (~470 Ma), during which their diversity tripled. This study examines the gastropod assemblage preserved in the Basin and Range…

  15. Antimicrobial secondary metabolites from marine gastropod egg capsules and egg masses

    PubMed Central

    Kaviarasan, T; Siva, Sankar R; Yogamoorthi, A


    Marine organisms have attracted special attention in the last three decades for their ability to produce interesting pharmacological active compounds. Even though all marine organisms have the potential to produce antimicrobial secondary metabolites, the gastropod has the vital sources of secondary metabolites particularly their egg capsule which has the promising antimicrobial secondary metabolites. In the present review, we intend to focus on marine secondary metabolites from marine gastropod egg capsule. The following compounds i.e. Kabiramid C, Aplysianin E, Aplysianin A, Thisaplysianin E and Tyrian purple have been documented in egg capsule of various gastropod and most of the antimicrobial secondary metabolites have not been isolated from the egg capsule because of the odious, and complex chemical structure. Stability of the compounds is unknown. PMID:23569871

  16. Bioaccumulation of 210Po in common gastropod and bivalve species from the northern Gulf.


    Uddin, S; Bebhehani, M


    This study sets the baseline for the concentration of the natural-series radionuclide polonium-210 in two species of gastropods and four species of bivalves that are common to the Northern Arabian/Persian Gulf. (210)Po is primarily absorbed from water and via ingestion of detrital material by gastropoda and bivalves. This concentrated (210)Po can then be passed along to the next trophic level of the marine food web. The lowest (210)Po concentration was measured in the gastropod Stomatella auricular (10.36-12.39Bq kg(-1)dry) and the highest in the bivalve Marica marmorata (193.51-215.60Bq kg(-1)dry). The measured concentration factor for these molluscs in the northern Gulf varied between 4.8 and 115×10(3), values very similar to the IAEA recommended value for bivalves and gastropods of 2×10(4). Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Antimicrobial secondary metabolites from marine gastropod egg capsules and egg masses.


    Kaviarasan, T; Siva, Sankar R; Yogamoorthi, A


    Marine organisms have attracted special attention in the last three decades for their ability to produce interesting pharmacological active compounds. Even though all marine organisms have the potential to produce antimicrobial secondary metabolites, the gastropod has the vital sources of secondary metabolites particularly their egg capsule which has the promising antimicrobial secondary metabolites. In the present review, we intend to focus on marine secondary metabolites from marine gastropod egg capsule. The following compounds i.e. Kabiramid C, Aplysianin E, Aplysianin A, Thisaplysianin E and Tyrian purple have been documented in egg capsule of various gastropod and most of the antimicrobial secondary metabolites have not been isolated from the egg capsule because of the odious, and complex chemical structure. Stability of the compounds is unknown.

  18. Cheсklist of gastropod molluscs in mangroves of Khanh Hoa province, Vietnam.


    Zvonareva, Sofya; Kantor, Yuri


    Gastropod molluscs are one of the most important components of mangrove ecosystem. Mangroves in Central Vietnam have a rather limited distribution due to peculiarities of the coastline morphology and presently their fauna remains understudied. Extensive surveys were conducted in both natural vegetation and artificial mangrove plantations in several localities in Nha Trang Bay from 2005 to 2015. In total 65 species of gastropod molluscs were found alive, 17 of which can be considered as predominantly mangrove-associated. An illustrated guide is provided, with short synonymies and data on ecology and distribution. The recorded molluscan diversity is compared with published data on mangrove gastropods in different regions of the Indo-Pacific. Total species number and the proportion of mangrove-associated species are similar to studied faunas in Hong Kong, Malaysia and Thailand, but the diversity is much lower than that of the mangal fauna of the Philippines.

  19. Gastropod-Borne Helminths: A Look at the Snail-Parasite Interplay.


    Giannelli, Alessio; Cantacessi, Cinzia; Colella, Vito; Dantas-Torres, Filipe; Otranto, Domenico


    More than 300 million people suffer from a range of diseases caused by gastropod-borne helminths, predominantly flatworms and roundworms, whose life cycles are characterized by a diversified ecology and epidemiology. Despite the plethora of data on these parasites, very little is known of the fundamental biology of their gastropod intermediate hosts, or of the interactions occurring at the snail-helminth interface. In this article, we focus on schistosomes and metastrongylids of human and animal significance, and review current knowledge of snail-parasite interplay. Future efforts aimed at elucidating key elements of the biology and ecology of the snail intermediate hosts, together with an improved understanding of snail-parasite interactions, will aid to identify, plan, and develop new strategies for disease control focused on gastropod intermediate hosts.

  20. Host-symbiont relationships in hydrothermal vent gastropods of the genus Alviniconcha from the Southwest Pacific.


    Suzuki, Yohey; Kojima, Shigeaki; Sasaki, Takenori; Suzuki, Masae; Utsumi, Takashi; Watanabe, Hiromi; Urakawa, Hidetoshi; Tsuchida, Shinji; Nunoura, Takuro; Hirayama, Hisako; Takai, Ken; Nealson, Kenneth H; Horikoshi, Koki


    Hydrothermal vent gastropods of the genus Alviniconcha are unique among metazoans in their ability to derive their nutrition from chemoautotrophic gamma- and epsilon-proteobacterial endosymbionts. Although host-symbiont relationships in Alviniconcha gastropods from the Central Indian Ridge in the Indian Ocean and the Mariana Trough in the Western Pacific have been studied extensively, host-symbiont relationships in Alviniconcha gastropods from the Southwest Pacific remain largely unknown. Phylogenetic analysis using mitochondrial cytochrome c oxidase subunit I gene sequences of host gastropods from the Manus, North Fiji, and Lau Back-Arc Basins in the Southwest Pacific has revealed a new host lineage in a Alviniconcha gastropod from the Lau Basin and the occurrence of the host lineage Alviniconcha sp. type 2 in the Manus Basin. Based on 16S rRNA gene sequences of bacterial endosymbionts, two gamma-proteobacterial lineages and one epsilon-proteobacterial lineage were identified in the present study. The carbon isotopic compositions of the biomass and fatty acids of the gastropod tissues suggest that the gamma- and epsilon-proteobacterial endosymbionts mediate the Calvin-Benson cycle and the reductive tricarboxylic acid cycle, respectively, for their chemoautotrophic growth. Coupling of the host and symbiont lineages from the three Southwest Pacific basins revealed that each of the Alviniconcha lineages harbors different bacterial endosymbionts belonging to either the gamma- or epsilon-Proteobacteria. The host specificity exhibited in symbiont selection provides support for the recognition of each of the host lineages as a distinct species. The results from the present study also suggest the possibility that Alviniconcha sp. types 1 and 2 separately inhabit hydrothermal vent sites approximately 120 m apart in the North Fiji Basin and 500 m apart in the Manus Basin.

  1. Gastropod ontogenetic torsion: developmental remnants of an ancient evolutionary change in body plan.


    Page, Louise R


    A dramatic morphogenetic movement ('ontogenetic torsion') during the development of gastropods has been proposed as a recapitulation of the original developmental departure that established the novel gastropod body plan. Nevertheless, speculative literature about ontogenetic torsion and its evolutionary significance has far outstripped empirical observations and recent results suggest that the developmental process may be somewhat different than the traditional description. I used scanning electron microscopy, immunohistochemistry, phalloidin labeling, and histological sections to monitor displacements of five components of the visceropallium with respect to axial coordinates of the cephalopodium in developing embryos of the caenogastropod, Trichotropis cancellata. Embryos of this species achieve a transient stage of anatomical organization that also arises during development of a vetigastropod (Haliotis kamtschatkana), although morphogenetic processes that generate this stage are different in these two species. At the stage of similarity, the embryonic shell has achieved its definitive orientation with respect to the cephalopodium, but the developing mantle cavity, sensory osphradium, and anus are confined to the right side. I also show that this stage of anatomical organization is recognizable during the development of other gastropods, which collectively represent three major gastropod clades. I propose that ontogenetic torsion should be viewed as a conserved stage of anatomical organization during development, rather than a conserved process of 180 degrees rotation between the visceropallium and cephalopodium. The results lead to the suggestion that the mantle cavity of extant gastropods evolved by enlargement of the right side of the mantle cavity in a monoplacophoran-like ancestor. Under this interpretation, there is no need for a hypothetical pre-gastropod with a mantle cavity that was restricted to the posterior end.

  2. Chemical cues released by an alien invasive aquatic gastropod drive its invasion success.


    Raw, Jacqueline L; Miranda, Nelson A F; Perissinotto, Renzo


    Chemical cues provide aquatic organisms with sensory information that guides behavioural responses and thus interactions among themselves, each other and the environment. Chemical cues are considered important for predator avoidance, foraging, larval settlement and broadcast spawning in aquatic environments. However, the significance of their role as drivers of direct interactions between heterospecifics has been largely overlooked. A video camera and a demarcated arena were used in situ to record behavioural responses of three native gastropod species, Assiminea cf. capensis, Melanoides tuberculata and Coriandria durbanensis, exposed to treatments representing chemical cues released by a non-native invasive gastropod, Tarebia granifera. The responses were measured quantitatively as displacement and orientation of movement at locations in St Lucia Estuary, within the iSimangaliso Wetland Park, a UNESCO World Heritage Site on the east coast of South Africa. All native gastropods exhibited a negative taxis response to chemical cues released by T. granifera, while T. granifera individuals responded randomly to conspecifics. Displacement was measured relative to the source of the extract, the number of steps taken were determined with path analysis and orientation was determined from the mean (±95% CIs) turning angles, with significant negative turning angles representing negative taxis. Responses to treatments corresponding to the environment and conspecifics were random and undirected, indicating kinesis. This study presents evidence for interactions driven by chemical cues between a non-native invasive gastropod and several gastropods native to South Africa. The results indicate that chemical cues can facilitate invasion success as the behavioural response of native gastropods is to move away allowing additional food and space resources to become available to T. granifera.

  3. Chemical Cues Released by an Alien Invasive Aquatic Gastropod Drive Its Invasion Success

    PubMed Central

    Raw, Jacqueline L.; Miranda, Nelson A. F.; Perissinotto, Renzo


    Background Chemical cues provide aquatic organisms with sensory information that guides behavioural responses and thus interactions among themselves, each other and the environment. Chemical cues are considered important for predator avoidance, foraging, larval settlement and broadcast spawning in aquatic environments. However, the significance of their role as drivers of direct interactions between heterospecifics has been largely overlooked. Methodology/Principal Findings A video camera and a demarcated arena were used in situ to record behavioural responses of three native gastropod species, Assiminea cf. capensis, Melanoides tuberculata and Coriandria durbanensis, exposed to treatments representing chemical cues released by a non-native invasive gastropod, Tarebia granifera. The responses were measured quantitatively as displacement and orientation of movement at locations in St Lucia Estuary, within the iSimangaliso Wetland Park, a UNESCO World Heritage Site on the east coast of South Africa. All native gastropods exhibited a negative taxis response to chemical cues released by T. granifera, while T. granifera individuals responded randomly to conspecifics. Displacement was measured relative to the source of the extract, the number of steps taken were determined with path analysis and orientation was determined from the mean (±95% CIs) turning angles, with significant negative turning angles representing negative taxis. Responses to treatments corresponding to the environment and conspecifics were random and undirected, indicating kinesis. Conclusion/Significance This study presents evidence for interactions driven by chemical cues between a non-native invasive gastropod and several gastropods native to South Africa. The results indicate that chemical cues can facilitate invasion success as the behavioural response of native gastropods is to move away allowing additional food and space resources to become available to T. granifera. PMID:23691151

  4. [Smoking-related interstitial lung diseases].


    Marten, Katharina


    The most important smoking-related interstitial lung diseases (ILD) are respiratory bronchiolitis, respiratory bronchiolitis-associated interstitial lung disease, desquamative interstitial pneumonia, and Langerhans' cell histiocytosis. Although traditionally considered to be discrete entities, smoking-related ILDs often coexist, thus accounting for the sometimes complex patterns encountered on high-resolution computed tomography (HRCT). Further studies are needed to elucidate the causative role of smoking in the development of pulmonary fibrosis.

  5. Late Mississippian gastropods of the Chainman Shale, west-central Utah

    USGS Publications Warehouse

    Gordon, Mackenzie; Yochelson, Ellis L.


    The Chainman Shale of Mississippian (Osagean to late Chesterian) age, well exposed in the Confusion Range of western Utah, has yielded a profusion of fossils during investigations conducted by the U.S. Geological Survey in the past 30 years. Conspicuous among these fossils are gastropods, which range in age from latest Meramecian to late Chesterian. In west-central Utah, not far from the State boundary, the Chainman outcrop belt stretches from Granite Mountain south to the northern part of the Needle Range, a distance of69 miles (110 km). The Chainman thickens from north to south; the section at Granite Mountain is 1,315 feet (401 m) thick and that at Jensen Wash in the Burbank Hills, 2,203 feet (671 m). The rocks of the Chainman Shale record a general though irregular shallowing of the area from moderate depths of 330 feet (100 m) or so to quite shallow depths of perhaps locally little more than 3-6 feet (1-2 m). Most of the gastropods occur with ammonoids in a facies of shale or shale containing phosphatic limestone concretions, In this lutaceous facies, Glabrocingulum is predominant and Lunulazona and Retispira are common; these genera are represented by a succession of species. A thick limestone unit is present in some areas in the upper part of the formation, particularly in the vicinity of Skunk Spring, where it is 318 feet (97 m) thick. This limestone unit represents a calcareous shoal facies having an entirely different gastropod fauna, characterized by Catazona and species of Naticopsis. The Chainman Shale could be easily zoned by gastropods, but we are not proposing such azonation. A framework of ammonoid and foraminiferal zones already is available, and we prefer to regard the gastropod assemblages as part of this framework. The assemblages are confined to the major ammonoid and foraminiferal zones, and only three of the gastropod species seem to range across major zonal boundaries. These species are Bellerophon (Bellerophon vespertinus Gordon and

  6. Granulomatous interstitial nephritis and Crohn's disease

    PubMed Central

    Timmermans, Sjoerd A.M.E.G.; Christiaans, Maarten H.L.; Abdul-Hamid, Myrurgia A.; Stifft, Frank; Damoiseaux, Jan G.M.C.; van Paassen, Pieter


    Granulomatous interstitial nephritis has been observed in <1% of native renal biopsies. Here, we describe two patients with granulomatous interstitial nephritis in relation to Crohn's disease. Circulating helper and cytotoxic T cells were highly activated, and both cell types predominated in the interstitial infiltrate, indicating a cellular autoimmune response. After immunosuppressive treatment, renal function either improved or stabilized in both patients. In conclusion, granulomatous interstitial nephritis is a genuine extraintestinal manifestation of Crohn's disease, the treatment of which should include immunosuppressive agents. PMID:27478596

  7. Contribution of interstitial solute strengthening in aluminum

    NASA Astrophysics Data System (ADS)

    Matsui, Isao; Ono, Satoshi; Hanaoka, Yudai; Uesugi, Tokuteru; Takigawa, Yorinobu; Higashi, Kenji


    Enthalpies of solutions and misfit strains for the Al-X (X = H, B, C, N, and O) binary alloys were determined by first-principles calculations to estimate the strengthening of solid solutions caused by interstitial atoms. The results indicate that interstitial solute atoms produced large misfit strains. Electrodeposited Al containing 0.12-1.32 at.% C was used to assess the validity of solid-solution strengthening by interstitial solute atoms. The role that interstitial carbon plays in strengthening electrodeposited Al is discussed.

  8. Smoking-related interstitial lung diseases.


    Caminati, A; Graziano, P; Sverzellati, N; Harari, S


    In pulmonary pathology, a wide spectrum of morphological changes is related to the consequences of smoking, and recognizing them on surgical specimens and on small transbronchial biopsies represents a challenge for the pathologist. Respiratory bronchiolitis, also referred to as smoker's bronchiolitis, is a common histologic feature found in the lung tissue of cigarette smokers. When identified as the sole histopathologic finding in the clinical setting of symptomatic interstitial lung disease, a diagnosis of respiratory bronchiolitis-interstitial lung disease is made. Since smoking is recognized to cause a variety of histologic patterns encompassing respiratory bronchiolitis, respiratory bronchiolitis-interstitial lung disease, desquamative interstitial pneumonia and pulmonary Langerhans cell hystiocytosis, smoking-related interstitial lung disease may be a useful concept to keep in mind for the pathologists. The relationship of smoking with each of these entities has been largely established on the basis of epidemiologic evidence. Although they have been retained as distinct and separate conditions in various classifications of interstitial lung diseases, these entities share a number of clinical, radiologic, and pathologic features suggesting that they represent a spectrum of patterns of interstitial lung disease occurring in predisposed individuals who smoke. Evaluation of histologic features, particularly in surgical lung biopsy samples, is important in making the distinction between these disorders. However, even after tissue biopsy, it may sometimes be difficult to clearly separate these entities. Recently, respiratory bronchiolitis-interstitial lung disease with fibrosis has been described and postulated that this is a smoking-related condition distinct from fibrotic non-specific interstitial pneumonia.

  9. Interstitial leukocyte migration in vivo

    PubMed Central

    Lam, Pui-ying; Huttenlocher, Anna


    Rapid leukocyte motility is essential for immunity and host defense. There has been progress in understanding the molecular signals that regulate leukocyte motility both in vitro and in vivo. However, a gap remains in understanding how complex signals are prioritized to result in directed migration, which is critical for both adaptive and innate immune function. Here we focus on interstitial migration and how external cues are translated into intracellular signaling pathways that regulate leukocyte polarity, directional sensing and motility in three-dimensional spaces. PMID:23797028

  10. Paleobiogeographic affinities of emsian (late early devonian) gastropods from farewell terrane (west-central Alaska)

    USGS Publications Warehouse

    Fryda, J.; Blodgett, R.B.


    The vast majority of Emsian gastropods from Limestone Mountain, Medfra B-4 quadrangle, west-central Alaska (Farewell terrane) belong to species with lecithotrophic larval strategy. The present data show that there is no significant difference in the paleobiogeo-graphic distribution of Emsian gastropod genera with lecithotrophic and planktotrophic larval strategies. Numerical analysis of the faunal affinities of the Emsian gastropod fauna from the Farewell terrane reveals that this terrane has much stronger faunal connections to regions like Variscan Europe, eastern Australia, and the Alexander terrane of southeast Alaska than to cratonic North America (Laurentia). The Canadian Arctic Islands is the only region of cratonic North America (Laurentia) that shows significant faunal affinities to the Emsian gastropod faunas of the Farewell terrane. The analysis also indicates a close faunal link between the Farewell and Alexander terranes. Published paleontological and geological data suggest that the Farewell and Alexander terranes represents tectonic entities that have been rifted away from the Siberia, Baltica, or the paleo-Pacific margin of Australia. The results of the present numerical analysis are not in conflict with any of these possibilities. However, the principle of spatial continuity of the wandering path prefers Siberia as the most probable "parental" paleocontinent for the derivation of both the Farewell and Alexander terranes. ?? 2008 The Geological Society of America.

  11. Determination of tetramine in marine gastropods by liquid chromatography/electrospray ionization-mass spectrometry.


    Kawashima, Yoko; Nagashima, Yuji; Shiomi, Kazuo


    Tetramine (tetramethylammonium ion) is found at high levels (several mg/g) in the salivary gland of buccinid gastropods and has been involved in numerous poisoning incidents after ingestion of those gastropods. A sensitive and selective determination method for tetramine, which is based on a combination of liquid chromatography (LC) and electrospray ionization-single quadrupole mass spectrometry (ESI-MS), was developed. Following separation by LC on a cation-exchange column, tetramine was easily detected by simultaneous monitoring of a molecular ion (m/z 74) at a cone voltage of 30 V and a fragment ion (m/z 58) at 70 V. A linear calibration curve was obtained in the range of 0.1-100 ng by plotting the peak areas of the molecular ion versus the amounts of tetramine. Spiking experiments demonstrated that tetramine in gastropod tissues can be determined by the LC/ESI-MS method, without being affected by sample matrices as well as the extration procedure. Applications of the new method to gastropod samples revealed that a small amount of tetramine is contained even in mid-gut gland and muscle and that tetramine in the salivary gland diffuses to other tissues during boiling and slow thawing.

  12. Terrestrial gastropods of Srebarna Nature Reserve, North-Eastern Bulgaria (Gastropoda)

    PubMed Central

    Antonova, Vera


    Abstract We give the results from the first investigation focused on the land snail fauna in Srebarna Nature Reserve in Bulgaria. A total of 23 localities were studied and 27 species of terrestrial gastropods were found, 23 of which were new observations for the Reserve. PMID:25632262

  13. Riparian-associated gastropods in western Washington: community composition and the effects of forest management


    Alex D. Foster; Joan. Ziegltrum


    We evaluated the abundance of riparian gastropod communities along headwater streams and their response to logging in southwestern Washington State. Terrestrial mollusks near logged streams with ~15 m fixed-width buffers were compared to logged streams with no buffers and to unlogged controls. Mollusk communities varied among sites relative to vegetative composition,...

  14. Types of Childhood Interstitial Lung Disease


    ... from the NHLBI on Twitter. Types of Childhood Interstitial Lung Disease The broad term "childhood interstitial lung disease" (chILD) ... therapeutic intervention Lung and bone marrow transplant-associated lung diseases Diffuse alveolar damage of unknown cause The various types ...

  15. Radiocarbon dating loess deposits in the Mississippi Valley using terrestrial gastropod shells (Polygyridae, Helicinidae, and Discidae)

    USGS Publications Warehouse

    Pigati, Jeffery S.; McGeehin, John P.; Muhs, Daniel; Grimley, David A.; Nekola, Jeffery C.


    Small terrestrial gastropod shells (mainly Succineidae) have been used successfully to date late Quaternary loess deposits in Alaska and the Great Plains. However, Succineidae shells are less common in loess deposits in the Mississippi Valley compared to those of the Polygyridae, Helicinidae, and Discidae families. In this study, we conducted several tests to determine whether shells of these gastropods could provide reliable ages for loess deposits in the Mississippi Valley. Our results show that most of the taxa that we investigated incorporate small amounts (1–5%) of old carbon from limestone in their shells, meaning that they should yield ages that are accurate to within a few hundred years. In contrast, shells of the genus Mesodon(Mesodon elevatus and Mesodon zaletus) contain significant and variable amounts of old carbon, yielding ages that are up to a couple thousand 14C years too old. Although terrestrial gastropod shells have tremendous potential for 14C dating loess deposits throughout North America, we acknowledge that accuracy to within a few hundred years may not be sufficient for those interested in developing high-resolution loess chronologies. Even with this limitation, however, 14C dating of terrestrial gastropod shells present in Mississippi Valley loess deposits may prove useful for researchers interested in processes that took place over multi-millennial timescales or in differentiating stratigraphic units that have significantly different ages but similar physical and geochemical properties. The results presented here may also be useful to researchers studying loess deposits outside North America that contain similar gastropod taxa..

  16. Large-Scale Spatial Distribution Patterns of Gastropod Assemblages in Rocky Shores

    PubMed Central

    Miloslavich, Patricia; Cruz-Motta, Juan José; Klein, Eduardo; Iken, Katrin; Weinberger, Vanessa; Konar, Brenda; Trott, Tom; Pohle, Gerhard; Bigatti, Gregorio; Benedetti-Cecchi, Lisandro; Shirayama, Yoshihisa; Mead, Angela; Palomo, Gabriela; Ortiz, Manuel; Gobin, Judith; Sardi, Adriana; Díaz, Juan Manuel; Knowlton, Ann; Wong, Melisa; Peralta, Ana C.


    Gastropod assemblages from nearshore rocky habitats were studied over large spatial scales to (1) describe broad-scale patterns in assemblage composition, including patterns by feeding modes, (2) identify latitudinal pattern of biodiversity, i.e., richness and abundance of gastropods and/or regional hotspots, and (3) identify potential environmental and anthropogenic drivers of these assemblages. Gastropods were sampled from 45 sites distributed within 12 Large Marine Ecosystem regions (LME) following the NaGISA (Natural Geography in Shore Areas) standard protocol ( A total of 393 gastropod taxa from 87 families were collected. Eight of these families (9.2%) appeared in four or more different LMEs. Among these, the Littorinidae was the most widely distributed (8 LMEs) followed by the Trochidae and the Columbellidae (6 LMEs). In all regions, assemblages were dominated by few species, the most diverse and abundant of which were herbivores. No latitudinal gradients were evident in relation to species richness or densities among sampling sites. Highest diversity was found in the Mediterranean and in the Gulf of Alaska, while highest densities were found at different latitudes and represented by few species within one genus (e.g. Afrolittorina in the Agulhas Current, Littorina in the Scotian Shelf, and Lacuna in the Gulf of Alaska). No significant correlation was found between species composition and environmental variables (r≤0.355, p>0.05). Contributing variables to this low correlation included invasive species, inorganic pollution, SST anomalies, and chlorophyll-a anomalies. Despite data limitations in this study which restrict conclusions in a global context, this work represents the first effort to sample gastropod biodiversity on rocky shores using a standardized protocol across a wide scale. Our results will generate more work to build global databases allowing for large-scale diversity comparisons of rocky intertidal assemblages. PMID

  17. Abundance, diversity, and latitudinal gradients of southeastern Atlantic and Antarctic abyssal gastropods

    NASA Astrophysics Data System (ADS)

    Schrödl, M.; Bohn, J. M.; Brenke, N.; Rolán, E.; Schwabe, E.


    Mollusca are widely used for deriving concepts on deep-sea biology and biodiversity, yet abyssal collections are limited to only a few regions of the world ocean and biased toward the northern Atlantic. The present study compares gastropod molluscs sampled along a transect through the southern Atlantic from the equator to Antarctica. The DIVA I and II expeditions concentrated on the hardly explored Guinea, Angola, and Cape Basins. Of the 145 deep-sea deployments (5025-5656 m depth) analyzed to date, 20 have yielded 68 specimens of benthic gastropods, representing 27 species. Only five abyssal species were previously known, four of them from the northern Atlantic deep sea; the remainder appear to be undescribed. Interestingly, there is no faunal overlap with the nearby Antarctic deep-sea. Most of these DIVA species (63%) are represented by single individuals, or limited to one or two stations. The rarity (i.e. 0.55 specimens m -2 calculated from quantitative corers) and still undetectable patchiness of southeastern Atlantic abyssal gastropods may indicate "source-sink" dynamics, but comparison is needed with thus far hardly explored regional bathyal faunas. The BRENKE-epibenthic sledge (EBS) may be efficient at surveying the abyssal gastropod species richness, but is shown to drastically underestimate true abundances. Low diversity values throughout the three southern Atlantic ocean basins do further challenge earlier estimates of a hyperdiverse global abyssal macrofauna. Comparative EBS data available from the southern hemisphere indicate a gradient from the equatorial Guinea Basin towards higher gastropod abundances and diversity in Antarctica. This is in clear contrast to the paradigm of a globally strongly decreasing marine diversity from lower to higher latitudes, highlighting the importance of further exploring the southern fauna from the tropics to Antarctica.

  18. The “Island Rule” and Deep-Sea Gastropods: Re-Examining the Evidence

    PubMed Central

    Welch, John J.


    Background One of the most intriguing patterns in mammalian biogeography is the “island rule”, which states that colonising species have a tendency to converge in body size, with larger species evolving decreased sizes and smaller species increased sizes. It has recently been suggested that an analogous pattern holds for the colonisation of the deep-sea benthos by marine Gastropoda. In particular, a pioneering study showed that gastropods from the Western Atlantic showed the same graded trend from dwarfism to gigantism that is evident in island endemic mammals. However, subsequent to the publication of the gastropod study, the standard tests of the island rule have been shown to yield false positives at a very high rate, leaving the result open to doubt. Methodology/Principal Findings The evolution of gastropod body size in the deep sea is reexamined. Using an extended and updated data set, and improved statistical methods, it is shown that some results of the previous study may have been artifactual, but that its central conclusion is robust. It is further shown that the effect is not restricted to a single gastropod clade, that its strength increases markedly with depth, but that it applies even in the mesopelagic zone. Conclusions/Significance The replication of the island rule in a distant taxonomic group and a partially analogous ecological situation could help to uncover the causes of the patterns observed—which are currently much disputed. The gastropod pattern is evident at intermediate depths, and so cannot be attributed to the unique features of abyssal ecology. PMID:20098740

  19. Large-scale spatial distribution patterns of gastropod assemblages in rocky shores.


    Miloslavich, Patricia; Cruz-Motta, Juan José; Klein, Eduardo; Iken, Katrin; Weinberger, Vanessa; Konar, Brenda; Trott, Tom; Pohle, Gerhard; Bigatti, Gregorio; Benedetti-Cecchi, Lisandro; Shirayama, Yoshihisa; Mead, Angela; Palomo, Gabriela; Ortiz, Manuel; Gobin, Judith; Sardi, Adriana; Díaz, Juan Manuel; Knowlton, Ann; Wong, Melisa; Peralta, Ana C


    Gastropod assemblages from nearshore rocky habitats were studied over large spatial scales to (1) describe broad-scale patterns in assemblage composition, including patterns by feeding modes, (2) identify latitudinal pattern of biodiversity, i.e., richness and abundance of gastropods and/or regional hotspots, and (3) identify potential environmental and anthropogenic drivers of these assemblages. Gastropods were sampled from 45 sites distributed within 12 Large Marine Ecosystem regions (LME) following the NaGISA (Natural Geography in Shore Areas) standard protocol ( A total of 393 gastropod taxa from 87 families were collected. Eight of these families (9.2%) appeared in four or more different LMEs. Among these, the Littorinidae was the most widely distributed (8 LMEs) followed by the Trochidae and the Columbellidae (6 LMEs). In all regions, assemblages were dominated by few species, the most diverse and abundant of which were herbivores. No latitudinal gradients were evident in relation to species richness or densities among sampling sites. Highest diversity was found in the Mediterranean and in the Gulf of Alaska, while highest densities were found at different latitudes and represented by few species within one genus (e.g. Afrolittorina in the Agulhas Current, Littorina in the Scotian Shelf, and Lacuna in the Gulf of Alaska). No significant correlation was found between species composition and environmental variables (r≤0.355, p>0.05). Contributing variables to this low correlation included invasive species, inorganic pollution, SST anomalies, and chlorophyll-a anomalies. Despite data limitations in this study which restrict conclusions in a global context, this work represents the first effort to sample gastropod biodiversity on rocky shores using a standardized protocol across a wide scale. Our results will generate more work to build global databases allowing for large-scale diversity comparisons of rocky intertidal assemblages.

  20. Gastropods and bivalves of commercial interest from the continental shelf of Jalisco and Colima, México.


    Ríos-Jara, E; Pérez-Peña, M; Beas-Luna, R; López-Uriarte, E; Juárez-Carrillo, E


    The distribution and abundance with respect to depth and type of substratum of 20 species of gastropods and four species of bivalves of economic importance were examined in the continental shelf of Jalisco and Colima, México. These species were taken with net trawls at depths from 24 to 83 m in August, 1988. Most individuals and species of gastropods were collected in stations with sandy silt substratum. Bivalves were collected in sandy silt and medium sand substrata. The six most abundant species represented 81.2% of all gastropods and bivalves collected. These species are: Cantharus pallidus, Fusinus dupetittouarsi, Ficus ventricosa, Hexaplex brassica, Harpa conoidalis and Arca pacifica.

  1. Cough in interstitial lung disease.


    Garner, Justin; George, Peter M; Renzoni, Elisabetta


    Cough in the context of interstitial lung disease (ILD) has not been the focus of many studies. However, chronic cough has a major impact on quality of life in a significant proportion of patients with ILD. For the purpose of this review, we have chosen to highlight some of the more frequently encountered diffuse lung diseases including idiopathic pulmonary fibrosis, sarcoidosis, hypersensitivity pneumonitis and systemic sclerosis associated ILD. Many of the underlying mechanisms remain speculative and further research is now required to elucidate the complex pathways involved in the pathogenesis of chronic cough in ILD. This will hopefully pave the way for the identification of new therapeutic agents to alleviate this distressing and often intractable symptom. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Interstitial Lung Disease in Scleroderma

    PubMed Central

    Schoenfeld, Sara R.; Castelino, Flavia V.


    Synopsis Systemic sclerosis (SSc) is a heterogeneous disease of unknown etiology and with limited effective therapies. It is characterized by autoimmunity, vasculopathy and fibrosis and is clinically manifested by multi-organ involvement. Interstitial lung disease (ILD) is a common complication of the disease and is associated with significant morbidity and mortality. The diagnosis of ILD hinges upon careful clinical evaluation as well as pulmonary function tests (PFTs) and high resolution computed tomography (HRCT). A number of pro-inflammatory and pro-fibrotic mediators are involved in the pathogenesis of SSc-ILD, with transforming growth factor-beta (TGF-β) playing a key role in the development of fibrosis. Despite recent advances in the understanding of the mechanisms of disease initiation and progression, effective therapeutic options are still limited. A number of experimental therapies are currently in early phase clinical trials and show promise. PMID:25836640

  3. Chylothorax in dermatomyositis complicated with interstitial pneumonia.


    Isoda, Kentaro; Kiboshi, Takao; Shoda, Takeshi


    Chylothorax is a disease in which chyle leaks and accumulates in the thoracic cavity. Interstitial pneumonia and pneumomediastinum are common thoracic manifestations of dermatomyositis, but chylothorax complicated with dermatomyositis is not reported. We report a case of dermatomyositis with interstitial pneumonia complicated by chylothorax. A 77-year-old woman was diagnosed as dermatomyositis with Gottron's papules, skin ulcers, anti-MDA5 antibody and rapid progressive interstitial pneumonia. Treatment with betamethasone, tacrolimus and intravenous high-dose cyclophosphamide was initiated, and her skin symptoms and interstitial pneumonia improved once. However, right-sided chylothorax began to accumulate and gradually increase, and at the same time, her interstitial pneumonia began to exacerbate, and skin ulcers began to reappear on her fingers and auricles. Although her chylothorax improved by fasting and parenteral nutrition, she died due to further exacerbations of dermatomyositis and interstitial pneumonia in spite of steroid pulse therapy, increase in the betamethasone dosage, additional intravenous high-dose cyclophosphamide and plasma pheresis. An autopsy showed no lesions such as malignant tumors in the thoracic cavity. This is the first report of chylothorax complicated by dermatomyositis with interstitial pneumonia.

  4. Grazing damage to plants and gastropod and grasshopper densities in a CO 2-enrichment experiment on calcareous grassland

    NASA Astrophysics Data System (ADS)

    Ledergerber, Stephan; Thommen, G. Heinrich; Baur, Bruno

    Plant-herbivore interactions may change as atmospheric CO 2 concentrations continue to rise. We examined the effects of elevated atmospheric CO 2 and CO 2-exposure chambers on the grazing damage to plants, and on the abundances of potential herbivores (terrestrial gastropods and grasshoppers) in a calcareous grassland in the Jura mountains of Switzerland (village of Nenzlingen). Individuals of most plant species examined showed slight grazing damage. However, plots with CO 2 enrichment and plots with ambient atmosphere did not differ in the extent of grazing damage. Similarly, plots with CO 2 enrichment and plots with ambient atmosphere did not differ in either gastropod or grasshopper density. Experimental plots with and without chambers did not differ in the number of gastropods. However, the densities of gastropods and grasshoppers and extent of grazing damage to plants were generally lower in the experimental area than in the grassland outside the experimental field.

  5. Radiocarbon dating late Quaternary loess deposits using small terrestrial gastropod shells

    USGS Publications Warehouse

    Pigati, Jeff S.; McGeehin, John P.; Muhs, Daniel R.; Bettis, E. Arthur


    Constraining the ages and mass accumulation rates of late Quaternary loess deposits is often difficult because of the paucity of organic material typically available for 14C dating and the inherent limitations of luminescence techniques. Radiocarbon dating of small terrestrial gastropod shells may provide an alternative to these methods as fossil shells are common in loess and contain ∼12% carbon by weight. Terrestrial gastropod assemblages in loess have been used extensively to reconstruct past environmental conditions but have been largely ignored for dating purposes. Here, we present the results of a multi-faceted approach to understanding the potential for using small terrestrial gastropod shells to date loess deposits in North America. First, we compare highly resolved 14C ages of well-preserved wood and gastropod shells (Succineidae) recovered from a Holocene loess section in Alaska. Radiocarbon ages derived from the shells are nearly identical to wood and plant macrofossil ages throughout the section, which suggests that the shells behaved as closed systems with respect to carbon for at least the last 10 ka (thousands of calibrated 14C years before present). Second, we apply 14C dating of gastropod shells to late Pleistocene loess deposits in the Great Plains using stratigraphy and independent chronologies for comparison. The new shell ages require less interpretation than humic acid radiocarbon ages that are commonly used in loess studies, provide additional stratigraphic coverage to previous dating efforts, and are in correct stratigraphic order more often than their luminescence counterparts. Third, we show that Succineidae shells recovered from historic loess in the Matanuska River Valley, Alaska captured the 20th century 14C bomb spike, which suggests that the shells can be used to date late Holocene and historic-aged loess. Finally, results from Nebraska and western Iowa suggest that, similar to other materials, shell ages approaching ∼40 ka should

  6. Combined treatment with interstitial hyperthermia and interstitial radiotherapy in an animal tumor model.


    Ruifrok, A C; Levendag, P C; Lakeman, R F; Deurloo, I K; Visser, A G


    An interstitial hyperthermia system operating at 27 MHz has been developed at the Dr. Daniel den Hoed Cancer Center. To test this system in combination with interstitial radiotherapy and to study the interactions of interstitial radiotherapy and interstitial hyperthermia, animal experiments were performed using rhabdomyosarcoma type R1 transplanted in the flanks of female Wag/Rij rats. Using the 27 MHz system, it appeared feasible to obtain hyperthermic temperatures. In this experiment a thermal dose of 44 degrees C for 30 minutes was delivered by controlling the temperature at the periphery of the tumor to 44 degrees C. The interstitial heating applicators were inserted in four standard afterloading catheters implanted with a fixed spacing of 7 mm; the same catheters were used for the radioactive sources for interstitial radiotherapy treatment following the interstitial hyperthermia sessions. Interstitial radiotherapy was given by means of four Ir192 wires with an average activity of 4.5.10(7) Bq/cm. Minimum tumor doses of 20 to 115 Gy with a mean dose rate of 47 cGy/hour were applied. Interstitial hyperthermia alone resulted in a growth delay (GD1) of 6 +/- 2 days without significant reduction of tumor volume. The 50% tumor cure dose after interstitial radiotherapy alone was 95 +/- 9 Gy. Combination of interstitial hyperthermia and interstitial radiotherapy resulted in reduction of the 50% tumor cure dose to 48 +/- 13 Gy. The dose-effect data for cure for these modalities are compared to existing data for external irradiation and external hyperthermia in the same tumor model. It was found that the addition of hyperthermia to different modes of irradiation, that is, either to single dose or protracted radiotherapy, results in a common level of radiosensitivity through impaired repair of sublethal damage. This study demonstrates the feasibility of the 27 MHz heating system in achieving hyperthermic temperatures; in the combined modality experiments a thermal

  7. Does Height to Width Ratio Correlate with Mean Volume in Gastropods?

    NASA Astrophysics Data System (ADS)

    Barriga, R.; Seixas, G.; Payne, J.


    Marine organisms' shell shape and size show important biological information. For example, shape and size can dictate how the organism ranges for food and escapes predation. Due to lack of data and analysis, the evolution of shell size in marine gastropods (snails) remains poorly known. In this study, I attempt to find the relationship between height to width ratio and mean volume. I collected height and width measurements from primary literature sources and calculated volume from these measurements. My results indicate that there was no correlation between height to width ratio and mean volume between 500 to 200 Ma, but there was a correlation between 200 Ma to present where there is a steady increase in both height to width ratio and mean volume. This means that shell shape was not an important factor at the beginning of gastropod evolution but after 200 Ma body size evolution was increasingly driven by the height to width ratio.

  8. Anatomy of and patterns of water currents through the mantle cavities of pleurotomariid gastropods.


    Voltzow, Janice; Morris, Paul J; Linsley, Robert M


    The paired pallial organs of pleurotomariids (slit shells) are generally interpreted as representing the primitive gastropod condition. Relatively few individual pleurotomariids have been observed alive; most anatomical descriptions have been based on retracted, preserved material. In this study, live animals were observed in still and moving water, videotaped, photographed, and relaxed prior to anatomical description. The pleurotomariid Perotrochus maureri formed a siphon with its mantle at the posterior end of the slit in the shell. As expected, water was expelled from the mantle cavity through this siphon. Dye released along the aperture, the area traditionally considered to be the incurrent window, was never observed to enter the mantle cavity. Instead, water entered through the slit just anterior to the siphon. A similar pattern was observed in the deep-slit pleurotomariid Entemnotrochus adansonianus. Thus the "anal" slit provided the sites for the incurrent as well as the excurrent windows. This surprising flow pattern is inconsistent with the traditional scenario of early gastropod evolution.

  9. Organotins (TBT and DBT) in water, sediments, and gastropods of the southern Venice lagoon (Italy).


    Berto, D; Giani, M; Boscolo, R; Covelli, S; Giovanardi, O; Massironi, M; Grassia, L


    The release of tributyltin (TBT) from maritime traffic represents one of the main problems of direct, diffuse, and continued contamination of the marine environment. In the present survey, the concentrations of TBT and dibultytin (DBT) in brackish waters, sediments, and the gastropods Nassarius nitidus were evaluated in order to estimate the contamination of the southern part of the Venice lagoon. TBT and DBT were determined by GC-MS/MS. Recent contamination of TBT was found in brackish waters near marinas, whereas the highest concentrations of TBT and DBT were observed in surface sediments at dockyards and harbours. High content of organotin in the gastropods sampled near the dockyards, harbours, and marinas showed a mobilisation from the sediments through the food web. The present study allowed assessment of whether, despite the ban on the use of TBT paints, waters, sediments, and biota were still being contaminated by organotin compounds in the southern Venice lagoon.

  10. Paralytic toxins in three new gastropod (Olividae) species implicated in food poisoning in southern Taiwan.


    Hwang, Pai-An; Tsai, Yung-Hsiang; Lu, Ya-Hui; Hwang, Deng-Fwu


    The toxins in the new gastropods Oliva miniacea, O. mustelina and O. nirasei implicated in a food paralytic poisoning incident in South Taiwan in February 2002 were studied. It was found that the three species of gastropods contained moderate amounts of toxin in edible portion only, and the highest toxicity score was 18 MU/g for O. miniacea, 10 MU/g for O. mustelina, and 27 MU/g for O. nirasei. The toxin was partially purified from the toxic specimens of each species by ultrafiltration using a YM-1 membrane, followed by chromatography on Bio-Gel P-2 column. Analyses by HPLC, GC-MS and LC-MS showed that the toxin from O. miniacea, O. nirasei and O. mustelina contained TTX, and related compounds 4-epi TTX and anhydro-TTX. The paralytic shellfish poisons were not found.

  11. The connection between oxidative stress and estivation in gastropods and anurans.


    Ferreira-Cravo, Marlize; Welker, Alexis F; Hermes-Lima, Marcelo


    In situations of food and water deprivation associated with unfavorable environmental conditions, a number of animal species undergo estivation. This state of locomotor inactivity involves a drastic reduction in the metabolic rate, allowing the estivator to survive long periods of adverse situations. However, the arousal from dormancy causes a rapid increase in oxygen consumption, which may elevate the production of oxygen radicals. Thus, it is expected that animals that arouse from estivation suffer a physiological oxidative stress. The reported mechanisms that protect estivators (anurans and gastropods) from the potential dangers of increased oxyradical formation are discussed. This includes the modulation of endogenous antioxidant defenses (enzymes and glutathione) of gastropods during dormancy, preparing them for arousal. A different strategy used for estivating anurans is also discussed.

  12. [Chemotherapy in Patients Complicated with Interstitial Pneumonia].


    Sata, Masafumi; Kato, Terufumi


    Interstitial pneumonia has high risk for chemotherapy-related exacerbation. Chemotherapy-related exacerbation is often fatal with respiratory failure. When we treat the cancer patient with interstitial pneumonia, it is necessary for us to regard of the efficacy of chemotherapy, and the frequency and mortality of chemotherapy-related exacerbation. All anti-cancer drugs has the possibilities of chemotherapy-related exacerbation. The incidence of chemotherapy-related exacerbation was higher in patients with target therapy agent or immune-checkpoint therapy agent, though there is not an interstitial pneumonia patient. In patients complicated with interstitial pneumonia, you should not use of these drugs, such as target therapy agent or immune-checkpoint therapy agent.

  13. Imaging of Childhood Interstitial Lung Disease

    PubMed Central


    The aphorism that children are not little adults certainly applies for the imaging of interstitial lung disease. Acquiring motion-free images of fine pulmonary structures at desired lung volumes is much more difficult in children than in adults. Several forms of interstitial lung disease are unique to children, and some forms of interstitial lung disease encountered in adults rarely, if ever, occur in children. Meticulous attention to imaging technique and specialized knowledge are required to properly perform and interpret chest imaging studies obtained for the evaluation of childhood interstitial lung disease (chILD). This review will address technique recommendations for imaging chILD, the salient imaging findings in various forms of chILD, and the efficacy of imaging in the diagnosis and management of chILD. PMID:22332031

  14. Diffuse interstitial lung disease: overlaps and uncertainties.


    Walsh, Simon L F; Hansell, David M


    Histopathological analysis of lung biopsy material allows the diagnosis of idiopathic interstitial pneumonias; however, the strength of this diagnosis is sometimes subverted by interobserver variation and sampling. The American Thoracic Society and European Respiratory Society recommendations of 2002 provide a framework for the diagnosis of interstitial lung disease (ILD) and proposed an integrated clinical, radiological and histopathological approach. These recommendations represent a break with tradition by replacing the 'gold standard' of histopathology with the combined 'silver standards' of clinical, imaging and histopathological information. One of the pitfalls of a rigid classification system for the diagnosis of interstitial lung disease is its failure to accommodate the phenomenon of overlapping disease patterns. This article reviews the various ways that interstitial lung disease may be classified and discusses their applicability. In addition the issue of overlap disease patterns is considered in the context of histopathological interobserver variation and sampling error and how a pigeonhole approach to disease classification may overlook these hybrid entities.

  15. Etiology, Pathogenesis, and Diagnosis of Interstitial Cystitis

    PubMed Central

    Sant, Grannum R


    Interstitial cystitis (IC) is a bladder syndrome of unknown etiology. The cause of IC is most likely multifactorial and includes genetic and environmental factors. Various pathophysiological changes in the bladder, pelvis, and peripheral and central nervous systems have been identified, and this has led to the emergence of biologically specific treatment modalities. Interstitial cystitis is being diagnosed with increasing frequency; however, current diagnostic criteria are non-uniform, and there is significant overlap between chronic pelvic pain syndromes in men and women, interstitial cystitis, recurrent “cystitis,” and the overactive bladder syndrome. The diagnosis of interstitial cystitis can be made clinically and by cystoscopy and hydrodistension. The sensitivity and specificity of urinary markers and the potassium sensitivity test have not been prospectively studied. PMID:16986036

  16. Interstitial lung diseases in children

    PubMed Central


    Interstitial lung disease (ILD) in infants and children comprises a large spectrum of rare respiratory disorders that are mostly chronic and associated with high morbidity and mortality. These disorders are characterized by inflammatory and fibrotic changes that affect alveolar walls. Typical features of ILD include dyspnea, diffuse infiltrates on chest radiographs, and abnormal pulmonary function tests with restrictive ventilatory defect and/or impaired gas exchange. Many pathological situations can impair gas exchange and, therefore, may contribute to progressive lung damage and ILD. Consequently, diagnosis approach needs to be structured with a clinical evaluation requiring a careful history paying attention to exposures and systemic diseases. Several classifications for ILD have been proposed but none is entirely satisfactory especially in children. The present article reviews current concepts of pathophysiological mechanisms, etiology and diagnostic approaches, as well as therapeutic strategies. The following diagnostic grouping is used to discuss the various causes of pediatric ILD: 1) exposure-related ILD; 2) systemic disease-associated ILD; 3) alveolar structure disorder-associated ILD; and 4) ILD specific to infancy. Therapeutic options include mainly anti-inflammatory, immunosuppressive, and/or anti-fibrotic drugs. The outcome is highly variable with a mortality rate around 15%. An overall favorable response to corticosteroid therapy is observed in around 50% of cases, often associated with sequelae such as limited exercise tolerance or the need for long-term oxygen therapy. PMID:20727133

  17. Interstitial fibrosis and growth factors.

    PubMed Central

    Lasky, J A; Brody, A R


    Interstitial pulmonary fibrosis (IPF) is scarring of the lung caused by a variety of inhaled agents including mineral particles, organic dusts, and oxidant gases. The disease afflicts millions of individuals worldwide, and there are no effective therapeutic approaches. A major reason for this lack of useful treatments is that few of the molecular mechanisms of disease have been defined sufficiently to design appropriate targets for therapy. Our laboratory has focused on the molecular mechanisms through which three selected peptide growth factors could play a role in the development of IPF. Hundreds of growth factors and cytokines could be involved in the complex disease process. We are studying platelet-derived growth factor because it is the most potent mesenchymal cell mitogen yet described, transforming growth factor beta because it is a powerful inducer of extracellular matrix (scar tissue) components by mesenchymal cells, and tumor necrosis factor alpha because it is a pleiotropic cytokine that we and others have shown is essential for the development of IPF in animal models. This review describes some of the evidence from studies in humans, in animal models, and in vitro, that supports the growth factor hypothesis. The use of modern molecular and transgenic technologies could elucidate those targets that will allow effective therapeutic approaches. Images Figure 1 Figure 2 PMID:10931794

  18. [The Littorina species of the European coasts: No model for the evolution of terrestrial gastropods].


    Remmert, Hermann


    The Littorina-species of the European coasts are completely isoosmotic with their environment.Small specimens (species) have very small gills; with increasing size the gills grow rapidly. The gills of different species of identical size show no difference. The reproduction does not trend towards direct development parallel to the habitat of the species.Therefore the Littorina species are no model for the evolution of terrestrial gastropods, their characteristics are merely those of intertidal animals.

  19. Treatment Approaches for Interstitial Cystitis: Multimodality Therapy

    PubMed Central

    Evans, Robert J


    Interstitial cystitis is an increasingly common disease characterized by urgency, frequency, and pelvic pain. Its etiology is poorly understood but is likely to be multifactorial. A proposed pathophysiology describing a cascade of events, including epithelial dysfunction, mast cell activation, and neurogenic inflammation, is presented. Using this model, multimodality therapy regimens have been developed that treat all components of this cascade. Multimodality therapy appears more effective than single agents in the treatment of interstitial cystitis. PMID:16986029

  20. Interstitial twin pregnancy: A unique case presentation.


    Garretto, Diana; Lee, Lan Na; Budorick, Nancy E; Figueroa, Reinaldo


    Early recognition and timely treatment of an interstitial pregnancy is imperative to avoid the high morbidity and mortality of this type of ectopic pregnancy. We report a case of twin interstitial pregnancy that was initially missed on initial sonogram and was subsequently recognized at our institution by transvaginal sonography. The patient underwent open laparoscopic surgery with cornual wedge resection but suffered infundibulopelvic ligament hemorrhage and subsequently required ipsilateral salpingo-oophorectomy. She did well and was discharged home a day later.

  1. Geometric analysis and estimation of the growth rate gradient on gastropod shells.


    Noshita, Koji; Shimizu, Keisuke; Sasaki, Takenori


    The morphology of gastropod shells provides a record of the growth rate at the aperture of the shell, and molecular biological studies have shown that the growth rate gradient along the aperture of a gastropod shell can be closely related to gene expression at the aperture. Here, we develop a novel method for deriving microscopic growth rates from the macroscopic shapes of gastropod shells. The growth vector map of a shell provides information on the growth rate gradient as a vector field along the aperture, over the growth history. However, it is difficult to estimate the growth vector map directly from the macroscopic shape of a specimen, because the degree of freedom of the growth vector map is very high. In order to overcome this difficulty, we develop a method of estimating the growth vector map based on a growing tube model, where the latter includes fewer parameters to be estimated. In addition, we calculate an aperture map specifying the magnitude of the growth vector at each location, which can be compared with the expression levels of several genes or proteins that are important in morphogenesis. Finally, we show a concrete example of how macroscopic shell shapes evolve in a morphospace when microscopic growth rate gradient changes.

  2. New gastropods from deep-sea hydrocarbon seeps off West Africa

    NASA Astrophysics Data System (ADS)

    Warén, Anders; Bouchet, Philippe


    Thirteen new species of gastropods are described from the Zairov 1-2 and Biozaire 1-3 cruises to the methane seeps off the Congo River: Patellogastropoda: Paralepetopsis sasakii sp. nov. (Neolepetopsidae); Cocculiniformia: Pyropelta oluae sp. nov. and P. sibuetae sp. nov. (Pyropeltidae); Tentaoculus granulatus sp. nov. (Pseudococculinidae); Neomphalina: Leptogyra costellata sp. nov. (Family uncertain); Vetigastropoda: Puncturella similis sp. nov. (Fissurellidae); Lepetodrilus shannonae sp. nov. (Lepetodrilidae); Caenogastropoda: Provanna reticulata sp. nov. and P. chevalieri sp. nov., Cordesia provannoides gen. et sp. nov. (Provannidae); Phymorhynchus coseli sp. nov. and P. cingulata sp. nov. (Conidae); Heterobranchia: Hyalogyrina rissoella sp. nov. (Hyalogyrinidae). All species except T. granulatus (from a settlement trap) belong to groups known from cold seeps and the entire seep fauna here is new to science. Biogeographical affinity of this gastropod fauna is to the West Atlantic seeps, not to the Mediterranean seeps or Mid-Atlantic vents. Fragments of the autecology of the species are presented. The evolution of the seep gastropod fauna is briefly discussed and a continuous immigration of taxa is supported. The oldest verified occurrences of modern taxa in the seeps date back to Cenomanian (Cretaceous) time, while some taxa seem not to appear until very late Tertiary.

  3. Chemical mediation as a structuring element in marine gastropod predator-prey interactions.


    Bornancin, L; Bonnard, I; Mills, S C; Banaigs, B


    Covering: up to 2017Chemical mediation regulates behavioral interactions between species and thus affects population structure, community organization and ecosystem function. Among marine taxa that have developed chemical mediation strategies, gastropods belong to a diverse group of molluscs found worldwide, including species with a coiled, reduced or absent shell. Most gastropods use natural products to mediate a wide range of behaviors such as defense, prey location or interactions with con- and hetero-geners. Their chemically defended diet, such as cyanobacteria, algae, sponges, bryozoans and tunicates, provides them with a considerable opportunity either as shelter from predators, or as a means to enhance their own chemical defense. In addition to improving their defenses, molluscs also use prey secondary metabolites in complex chemical communication including settlement induction, prey detection and feeding preferences. The assimilation of prey secondary metabolites further provides the opportunity for interactions with conspecifics via diet-derived chemical cues or signals. This review intends to provide an overview on the sequestration, detoxification, and biotransformation of diet-derived natural products, as well as the role of these compounds as chemical mediators in gastropod-prey interactions.

  4. How does life adapt to a gravitational environment? The outline of the terrestrial gastropod shell.


    Okajima, Ryoko; Chiba, Satoshi


    How do several characteristics adapt to gravity while mutually influencing each other? Our study addresses this issue by focusing on the terrestrial gastropod shell. The geometric relationship between the spire index (shell height/diameter) and outline (cylindricality) is theoretically estimated. When the shell grows isometrically, a high-spired shell becomes conical in shape and a low-spired shell becomes cylindrical in shape. A physical model shows that the lowest- and highest-spired shells are the most balanced. In addition, a cone shape is the most balanced for a low-spired shell, and a column shape is the most balanced for a high-spired shell. Spire index and cylindricality measured for freshwater gastropods follow the relationship estimated by the model, whereas those for terrestrial gastropods deviate from this relationship. This translates to a high shell being more cylindrical than a flat shell, except in the case of extremely high or low shells. This suggests that the shape of the most balanced shells (lowest and highest shell heights) is constrained by coiling geometry but that relatively unbalanced shells (intermediate shell heights) do not follow a coiling geometry, as a result of adaptation to enable the snail to carry its shell more effectively.

  5. Cassiopidae gastropods, influence of Tethys Sea of the Romualdo Formation (Aptian-Albian), Araripe Basin, Brazil

    NASA Astrophysics Data System (ADS)

    Pereira, Priscilla Albuquerque; Cassab, Rita de Cassia Tardin; Barreto, Alcina Magnólia Franca


    The Cassiopidae family belongs to a group of gastropods of the Tethyan Realm, whose origin and dispersion are related a transgression of the Tethys Sea during the Early Cretaceous. The Romualdo Formation in the Araripe Basin, located in Northeast Brazil, presents fossil assemblages with echinoids, bivalves and cassiopid gastropods, indicating a marine sedimentation at the top of the formation. This research reveals three new species of this fauna: Gymnentome (Craginia) beurleni sp. nov., 'Pseudomesalia' ('Pseudomesalia') mennessieri sp. nov and 'Pseudomesalia' ('Pseudomesalia') santanensis sp. nov. We also review two other species: Craginia araripensisBeurlen, 1964 and Gymnentome romualdoiBeurlen, 1964, which we reclassify taxonomically as Paraglauconia (Diglauconia) araripensis and Gymnentome (Gymnentome) romualdoi, respectively; Paraglauconia (Diglauconia) lyrica Maury, 1936 and Gymnentome (Gymnentome) carregozica Maury, 1936 were the first recorded species in the Araripe Basin. The occurrence of these cassiopid gastropod fauna in other basins, such as Sergipe, Potiguar and Parnaíba, indicate the influence of waters coming from the north through the Tethys Sea in the Aptian-Albian and in the marginal continental basins of the Brazilian Northeast.

  6. Increased plastic litter cover affects the foraging activity of the sandy intertidal gastropod Nassarius pullus.


    Aloy, Alexander B; Vallejo, Benjamin M; Juinio-Meñez, Marie Antonette


    This study analyzed the foraging behavior of the gastropod Nassarius pullus on garbage-impacted sandy shores of Talim Bay, Batangas, Philippines. The effect of different levels of plastic garbage cover on foraging efficiency was investigated. Controlled in situ baiting experiments were conducted to quantify aspects of foraging behavior as affected by the levels of plastic litter cover in the foraging area. The results of the study indicated that the gastropod's efficiency in locating and in moving towards a food item generally decreased as the level of plastic cover increased. Prolonged food searching time and increased self-burial in sand were highly correlated with increased plastic cover. The accuracy of orientation towards the actual position of the bait decreased significantly when the amount of plastic cover increased to 50%. These results are consistent with the significant decreases in the abundance of the gastropod observed during periods of deposition of large amounts of plastic and other debris on the shore. Copyright © 2011 Elsevier Ltd. All rights reserved.

  7. In vivo indirect measurement of cytochrome P450-associated activities in freshwater gastropod molluscs.


    Gagnaire, Beatrice; Geffard, Olivier; Noury, Patrice; Garric, Jeanne


    The cytochrome P450 (CYP) system is widely distributed across phyla and plays a key role in the metabolism of xenobiotic compounds. However, most studies on CYP system were developed on vertebrates and among invertebrates, gastropod molluscs are rarely used. In this context, ethoxycoumarin-O-deethylase (ECOD), ethoxyresorufin-O-deethylase (EROD), and pentoxyresorufin-O-dealkylase (PROD) activities, which are indirect measurements of CYP system, were characterized in two freshwater gastropod molluscs, Potamopyrgus antipodarum, and Valvata piscinalis, to ascertain their potential interest as biomarkers of exposure to chemicals. Activities were measured using an in vivo non lethal method based on the measurement of formed product (resorufin or hydroxycoumarin). This in vivo assay allowed to measure the three activities in P. antipodarum and two of them (ECOD and PROD) in V. piscinalis. The detection of activities and the optimization of experimental design were carried out first and allowed to measure the selected activities for one individual. The modulation of the detected activities was secondly assessed using a polycyclic aromatic hydrocarbon (Benzo(a)pyrene). Based on this non destructive measurement, effect of BaP exposure could be detected on ECOD and EROD activity in P. antipodarum, as well on PROD activity of V. piscinalis after 96 h of exposure. Such an in vivo assay must be further developed to be valuably used to screen the exposure of gastropod species to CYP inducer chemicals and its consequences in terms of fitness of the organisms and of the population.

  8. The key role of the surface membrane in why gastropod nacre grows in towers

    PubMed Central

    Checa, Antonio G.; Cartwright, Julyan H. E.; Willinger, Marc-Georg


    The nacre of gastropod molluscs is intriguingly stacked in towers. It is covered by a surface membrane, which protects the growing nacre surface from damage when the animal withdraws into its shell. The surface membrane is supplied by vesicles that adhere to it on its mantle side and secretes interlamellar membranes from the nacre side. Nacre tablets rapidly grow in height and later expand sideways; the part of the tablet formed during this initial growth phase is here called the core. During initial growth, the tips of the cores remain permanently submerged within the surface membrane. The interlamellar membranes, which otherwise separate the nacre tablet lamellae, do not extend across cores, which are aligned in stacked tablets forming the tower axis, and thus towers of nacre tablets are continuous along the central axis. We hypothesize that in gastropod nacre growth core formation precedes that of the interlamellar membrane. Once the core is complete, a new interlamellar membrane, which covers the area of the tablet outside the core, detaches from the surface membrane. In this way, the tower-like growth of gastropod nacre becomes comprehensible. PMID:19116274

  9. Avoidance of drilled gastropod shells by the hermit crab Pagurus longicarpus at Nahant, Massachusetts.


    Pechenik; Lewis


    Most hermit crabs depend on empty gastropod shells for shelter; competition for appropriate shells is often severe. This study determined whether shells that have been drilled by naticid gastropods are suitable for occupancy by the hermit crab Pagurus longicarpus. Differences in the characteristics of empty shells and those occupied by hermit crabs were assessed at two adjacent field sites in Nahant, Massachusetts. Drilling damage was far more frequent in empty gastropod shells than in shells occupied by hermit crabs, suggesting that individuals of P. longicarpus avoid drilled shells. They did not appear to avoid shells with other forms of damage. Laboratory experiments confirmed that these hermit crabs preferentially chose intact shells over drilled shells, even when the intact shells offered were most suitable for crabs half the weight of those tested. Final shell choices were generally made within 1 h. The hermit crabs apparently discriminated between intact and drilled shells based on tactile cues, since crabs kept in the dark showed the same preference for intact shells. The hermit crabs strongly avoided, to nearly the same extent, artificially drilled shells, naturally drilled shells, and shells with holes artificially drilled on the opposite side of the shell from where they would normally be located. Possible selective forces causing P. longicarpus to show such strong behavioral avoidance of drilled shells include increased vulnerability of crabs in drilled shells to osmotic stress, predation, and eviction by conspecifics.

  10. Acute exacerbations of fibrotic interstitial lung disease.


    Churg, Andrew; Wright, Joanne L; Tazelaar, Henry D


    An acute exacerbation is the development of acute lung injury, usually resulting in acute respiratory distress syndrome, in a patient with a pre-existing fibrosing interstitial pneumonia. By definition, acute exacerbations are not caused by infection, heart failure, aspiration or drug reaction. Most patients with acute exacerbations have underlying usual interstitial pneumonia, either idiopathic or in association with a connective tissue disease, but the same process has been reported in patients with fibrotic non-specific interstitial pneumonia, fibrotic hypersensitivity pneumonitis, desquamative interstitial pneumonia and asbestosis. Occasionally an acute exacerbation is the initial manifestation of underlying interstitial lung disease. On biopsy, acute exacerbations appear as diffuse alveolar damage or bronchiolitis obliterans organizing pneumonia (BOOP) superimposed upon the fibrosing interstitial pneumonia. Biopsies may be extremely confusing, because the acute injury pattern can completely obscure the underlying disease; a useful clue is that diffuse alveolar damage and organizing pneumonia should not be associated with old dense fibrosis and peripheral honeycomb change. Consultation with radiology can also be extremely helpful, because the fibrosing disease may be evident on old or concurrent computed tomography scans. The aetiology of acute exacerbations is unknown, and the prognosis is poor; however, some patients survive with high-dose steroid therapy. © 2010 Blackwell Publishing Limited.

  11. Interstitial cystitis. Etiology, diagnosis, and treatment.

    PubMed Central

    Nickel, J. C.


    OBJECTIVE: To review current knowledge about the epidemiology, etiology, diagnosis, and treatment of interstitial cystitis, with special emphasis on management of this condition by family physicians. QUALITY OF EVIDENCE: Articles were identified through MEDLINE and review of abstracts presented at Urology and Interstitial Cystitis meetings during the last decade. Recent reviews were further searched for additional studies and trials. Data were summarized from large epidemiologic studies. Etiologic theories were extracted from current concepts and reviews of scientific studies. Diagnostic criteria described in this review are based on clinical interpretation of National Institutes of Health (NIH) research guidelines, interpretation of data from the NIH Interstitial Cystitis Cohort Study, and recent evidence on use of the potassium sensitivity test. Treatment suggestions are based on six randomized placebo-controlled clinical treatment trials and best available clinical data. MAIN MESSAGE: Interstitial cystitis affects about 0.01% to 0.5% of women. Its etiology is unknown, but might involve microbiologic, immunologic, mucosal, neurogenic, and other yet undefined agents. The diagnosis of interstitial cystitis is a diagnosis of exclusion. It is impossible to provide a purely evidence-based treatment strategy, but review of available evidence suggests that conservative supportive therapy (including diet modification); oral treatment with pentosan polysulfate, amitriptyline, or hydroxyzine; and intravesical treatments with heparinlike medications, dimethyl sulfoxide, or BCG vaccine could benefit some patients. CONCLUSION: Family physicians should have an understanding of interstitial cystitis and be able to make a diagnosis and formulate an evidence-based treatment strategy for their patients. PMID:11153410

  12. Urine markers of interstitial cystitis.


    Erickson, D R


    This article describes the current state of the art with regard to urine markers of interstitial cystitis (IC), and describes the areas that need continuing research. Articles referenced in MEDLINE that describe urine alterations in IC were reviewed. Additional articles were identified by cross-referencing. The different marker alterations were tabulated. The relevant articles were discussed, considering different purposes for urine markers including: (1) diagnosing IC; (2) confirming a specific pathophysiology for IC; and (3) predicting or following response to a specific treatment. Currently, 2 markers (glycoprotein-51 and antiproliferative factor [APF]) clearly separate IC and control subjects, with minimal overlap. Markers that correlate with specific bladder biopsy features include 1,4-methylimidazole acetic acid and eosinophil cationic protein (ECP), which correlate with mast cell density, and interleukin (IL)-6, which correlates with mononuclear inflammation. Markers that changed after treatment were as follows: (1) nitric oxide synthase and cyclic guanosine monophosphate increased with oral L-arginine; (2) ECP decreased with subcutaneous heparin; (3) prostaglandin E(2) and kallikrein decreased after bladder distention; (4) neutrophil chemotactic activity decreased after dimethyl sulfoxide; (5) IL-2 inhibitor decreased after oral nifedipine; (6) IL-2, IL-6, and IL-8 decreased after bacille Calmette-Guérin (BCG) vaccine; and (7) APF and heparin-binding epidermal growth factor changed to or toward normal levels after bladder distention or sacral nerve stimulation. A larger number of urine alterations have been reported, and a few are being pursued further by correlating with bladder biopsy findings or treatment responses. Further research is needed.

  13. How does interstitial cystitis begin?

    PubMed Central


    Background Interstitial cystitis (IC) does not start as an endstage disease, it has a beginning when symptoms are milder, intermittent and the disease is misdiagnosed. To determine how IC develops patients were interviewed on when their symptoms began, what they were and are now as well as the various diagnoses that they received before they were determined to have IC. Methods One hundred female IC patients were screened. They filled out a questionnaire asking about the age their disease presented, their initial and current symptoms, what their original diagnoses were, effect of the menstrual cycle and sexual activity on their symptoms and about any relatives with bladder symptoms or a current diagnosis of IC. Results By age 30, 81% of patients had bladder symptoms, 21% before age 10. The first symptom was frequency in 81%, pain present in 59% and the symptoms were intermittent in 64%. Most common early misdiagnosis was UTI in 74% with 93% reporting negative urine cultures. Sex was painful and causes symptom flares in 82%, symptoms flared the week before the menses in 75%. Most common gynecologic diagnosis was yeast vaginitis, 42%. Urge incontinence was present in 33%. There were 51% that reported bladder symptoms in a first degree female relative. Conclusions IC begins primarily with frequency and is intermittent in most patients with symptom flares associated with sexual activity. Pain and urgency incontinence tend to be a later symptoms. When IC flares the most common misdiagnosis is UTI. Symptoms begin before age 30 in most but an IC diagnosis is often not made until age 40. Genetics appear to play a significant role. It is important to consider these facts when evaluating women with “early IC” because correct diagnosis will result in proper therapy and reduced health care costs. PMID:26816860

  14. Evaluation of impairment of DNA in marine gastropod, Morula granulata as a biomarker of marine pollution.


    Sarkar, A; Bhagat, Jacky; Sarker, Subhodeep


    The impairment of DNA in marine gastropod Morula granulata was evaluated in terms of the loss of DNA integrity in the species as a measure of the impact of genotoxic contaminants prevalent in the marine environment along the coast of Goa, India. The extent of DNA damage occurred in the marine gastropods collected from different sampling sites such as Arambol, Anjuna, Sinquerim, Dona Paula, Bogmalo, Hollant, Velsao, Betul and Palolem along the coast of Goa was measured following the technique of partial alkaline unwinding as well as comet assays. The highest DNA integrity was observed at Arambol (F, 0.75), identified as the reference site, whereas the lowest DNA integrity at Hollant (F, 0.33) situated between the two most contaminated sites at Bogmalo and Velsao. The impact of genotoxic contaminants on marine gastropods was pronounced by their low DNA integrity at Sinquerim (F, 0.40) followed by Betul (F, 0.47), Velsao (F, 0.51), Anjuna (F, 0.54), Bogmalo (F, 0.55), Dona Paula (F, 0.67) and Palolem (F, 0.70). The extent of DNA damage occurred in M. granulata due to ecotoxicological impact of the prevailing marine pollutants along the coast of Goa was further substantiated by comet assay and expressed in terms of %head-DNA, %tail DNA, tail length and Olive tail moment. The single cell gel electrophoresis of M. granulata clearly showed relatively higher olive tail moment in the marine gastropod from the contaminated sites, Anjuna, Hollant, Velsao and Betul. The variation in the mean %head DNA at different sampling sites clearly indicated that the extent of DNA damage in marine gastropod increases with the increase in the levels of contamination at different sampling sites along the coast. The stepwise multiple regression analysis of the water quality parameters showed significant correlation between the variation in DNA integrity and PAH in combination with NO3, salinity and PO4 (R¯(2), 0.90). The measurement of DNA integrity in M. granulata thus provides an early

  15. The Significance of Interstitial Cells in Neurogastroenterology

    PubMed Central

    Blair, Peter J; Rhee, Poong-Lyul; Sanders, Kenton M; Ward, Sean M


    Smooth muscle layers of the gastrointestinal tract consist of a heterogeneous population of cells that include enteric neurons, several classes of interstitial cells of mesenchymal origin, a variety of immune cells and smooth muscle cells (SMCs). Over the last number of years the complexity of the interactions between these cell types has begun to emerge. For example, interstitial cells, consisting of both interstitial cells of Cajal (ICC) and platelet-derived growth factor receptor alpha-positive (PDGFRα+) cells generate pacemaker activity throughout the gastrointestinal (GI) tract and also transduce enteric motor nerve signals and mechanosensitivity to adjacent SMCs. ICC and PDGFRα+ cells are electrically coupled to SMCs possibly via gap junctions forming a multicellular functional syncytium termed the SIP syncytium. Cells that make up the SIP syncytium are highly specialized containing unique receptors, ion channels and intracellular signaling pathways that regulate the excitability of GI muscles. The unique role of these cells in coordinating GI motility is evident by the altered motility patterns in animal models where interstitial cell networks are disrupted. Although considerable advances have been made in recent years on our understanding of the roles of these cells within the SIP syncytium, the full physiological functions of these cells and the consequences of their disruption in GI muscles have not been clearly defined. This review gives a synopsis of the history of interstitial cell discovery and highlights recent advances in structural, molecular expression and functional roles of these cells in the GI tract. PMID:24948131

  16. Interstitial Cells: Regulators of Smooth Muscle Function

    PubMed Central

    Sanders, Kenton M.; Ward, Sean M.; Koh, Sang Don


    Smooth muscles are complex tissues containing a variety of cells in addition to muscle cells. Interstitial cells of mesenchymal origin interact with and form electrical connectivity with smooth muscle cells in many organs, and these cells provide important regulatory functions. For example, in the gastrointestinal tract, interstitial cells of Cajal (ICC) and PDGFRα+ cells have been described, in detail, and represent distinct classes of cells with unique ultrastructure, molecular phenotypes, and functions. Smooth muscle cells are electrically coupled to ICC and PDGFRα+ cells, forming an integrated unit called the SIP syncytium. SIP cells express a variety of receptors and ion channels, and conductance changes in any type of SIP cell affect the excitability and responses of the syncytium. SIP cells are known to provide pacemaker activity, propagation pathways for slow waves, transduction of inputs from motor neurons, and mechanosensitivity. Loss of interstitial cells has been associated with motor disorders of the gut. Interstitial cells are also found in a variety of other smooth muscles; however, in most cases, the physiological and pathophysiological roles for these cells have not been clearly defined. This review describes structural, functional, and molecular features of interstitial cells and discusses their contributions in determining the behaviors of smooth muscle tissues. PMID:24987007

  17. [Modern Views on Children's Interstitial Lung Disease].


    Boĭtsova, E V; Beliashova, M A; Ovsiannikov, D Iu


    Interstitial lung diseases (ILD, diffuse lung diseases) are a heterogeneous group of diseases in which a pathological process primarily involved alveoli and perialveolar interstitium, resulting in impaired gas exchange, restrictive changes of lung ventilation function and diffuse interstitial changes detectable by X-ray. Children's interstitial lung diseases is an topical problem ofpediatricpulmonoogy. The article presents current information about classification, epidemiology, clinical presentation, diagnostics, treatment and prognosis of these rare diseases. The article describes the differences in the structure, pathogenesis, detection of various histological changes in children's ILD compared with adult patients with ILD. Authors cite an instance of registers pediatric patients with ILD. The clinical semiotics of ILD, the possible results of objective research, the frequency of symptoms, the features of medical history, the changes detected on chest X-rays, CT semiotics described in detail. Particular attention was paid to interstitial lung diseases, occurring mainly in newborns and children during the first two years of life, such as congenital deficiencies of surfactant proteins, neuroendocrine cell hyperplasia of infancy, pulmonary interstitial glycogenosis. The diagnostic program for children's ILD, therapy options are presented in this article.

  18. Interstitial cells: regulators of smooth muscle function.


    Sanders, Kenton M; Ward, Sean M; Koh, Sang Don


    Smooth muscles are complex tissues containing a variety of cells in addition to muscle cells. Interstitial cells of mesenchymal origin interact with and form electrical connectivity with smooth muscle cells in many organs, and these cells provide important regulatory functions. For example, in the gastrointestinal tract, interstitial cells of Cajal (ICC) and PDGFRα(+) cells have been described, in detail, and represent distinct classes of cells with unique ultrastructure, molecular phenotypes, and functions. Smooth muscle cells are electrically coupled to ICC and PDGFRα(+) cells, forming an integrated unit called the SIP syncytium. SIP cells express a variety of receptors and ion channels, and conductance changes in any type of SIP cell affect the excitability and responses of the syncytium. SIP cells are known to provide pacemaker activity, propagation pathways for slow waves, transduction of inputs from motor neurons, and mechanosensitivity. Loss of interstitial cells has been associated with motor disorders of the gut. Interstitial cells are also found in a variety of other smooth muscles; however, in most cases, the physiological and pathophysiological roles for these cells have not been clearly defined. This review describes structural, functional, and molecular features of interstitial cells and discusses their contributions in determining the behaviors of smooth muscle tissues.

  19. [Methods and clinical results of interstitial thermoradiotherapy].


    Seegenschmiedt, M H; Sauer, R


    Besides percutaneous hyperthermia techniques, some new interstitial procedures have been developed and included into the arsenal of radiotherapists. As compared to percutaneous techniques, considerable benefits are offered by interstitial methods: a more homogeneous distribution of therapeutical temperatures, a better sparing of normal tissue, the possibility to treat deep tumors, and better therapy control and evaluation by extensive "thermal mapping" within the target volume. This study presents the technical principles and the clinical possibilities of the interstitial hyperthermia methods developed hitherto: resistive radiofrequency hyperthermia, radiative microwave hyperthermia, inductive ferromagnetic seed hyperthermia, and conductive hot-water perfusion hyperthermia. Until now, interstitial thermo-radiotherapy was only performed during some phase I/II studies. It was applied for palliative reasons in persisting and recurrent tumors accessible for implantation and situated in superficial to semi-deep locations with no or insufficient response to differently combined treatment modalities (surgery, radiotherapy, or chemotherapy). The preliminary clinical results obtained in almost 300 patients are quite promising: complete remission rates up to 70% have been achieved. Interstitial hyperthermia represents an effective and safe therapy modality, especially when combined with radiotherapy in palliative tumor therapy. At present, several prospective randomized multicentric studies are conducted to investigate its value as adjuvant therapy modality.

  20. Invasive diagnostic techniques in idiopathic interstitial pneumonias.


    Poletti, Venerino; Ravaglia, Claudia; Gurioli, Carlo; Piciucchi, Sara; Dubini, Alessandra; Cavazza, Alberto; Chilosi, Marco; Rossi, Andrea; Tomassetti, Sara


    Fibrosing interstitial lung diseases (f-ILDs) represent a heterogeneous group of disorders in which the aetiology may be identified or, not infrequently, remain unknown. Establishing a correct diagnosis of a distinct f-ILD requires a multidisciplinary approach, integrating clinical profile, physiological and laboratory data, radiological appearance and, when appropriate, histological findings. Surgical lung biopsy is still considered the most important diagnostic tool as it is able to provide lung samples large enough for identification of complex patterns such as usual interstitial pneumonitis (UIP) and nonspecific interstitial pneumonitis. However, this procedure is accompanied by significant morbidity and mortality. Bronchoalveolar lavage is still a popular diagnostic tool allowing identification of alternative diagnoses in patients with suspected idiopathic pulmonary fibrosis (IPF) when an increase in lymphocytes is detected. Conventional transbronchial lung biopsy has a very low sensitivity in detecting the UIP pattern and its role in this clinical-radiological context is marginal. The introduction of less invasive methods such as transbronchial cryobiopsy show great promise to clinical practice as they can be used to obtain samples large enough to morphologically support a diagnosis of IPF or other idiopathic interstitial pneumonias, along with fewer complications. Recent advances in the field suggest that less invasive methods of lung sampling, without significant side effects, in combination with other diagnostic methods could replace the need for surgical lung biopsy in the future. Indeed, these new multidisciplinary procedures may become the main diagnostic work-up method for patients with suspected idiopathic interstitial pneumonia.

  1. Tributyltin bioaccumulation and toxic effects in freshwater gastropods Pomacea canaliculata after a chronic exposure: field and laboratory studies.


    Martínez, María L; Piol, María N; Sbarbati Nudelman, Norma; Verrengia Guerrero, Noemí R


    Freshwater samples and gastropod mollusks (Pomacea canaliculata) were collected at 5 sampling stations located along the lower Río de la Plata basin, Argentina, to assess the extent of tributyltin (TBT) contamination. Determined data revealed the presence of TBT and some of its breakdown products (dibutyltin: DBT, and monobutyltin: MBT) in all freshwater samples and also in soft tissues of P. canaliculata gastropods. Chronic bioassays (6 months) were performed using female gastropods that had been reared under laboratory conditions and exposed to a similar TBT concentration than the value determined in freshwater samples (1 µg L(-1)). The aims of this study were to evaluate the extent of TBT accumulation, the tissue distribution, and the effects on selected biomarkers (activity of superoxide dismutasa: SOD, activity of catalase: CAT, levels of total glutathione: t-GSH, lipid peroxidation, and activity of acetylcholinesterase: AChE). Gonads presented the highest accumulation, followed by the cephalopedal region, albumin gland, and finally hepatopancreas. Both metabolites, DBT and MBT, were also found. All exposed female animals presented development of a penis reflecting the potential of TBT as an endocrine disrupting chemical for this gastropod species. Results on the selected biomarkers confirmed additional adverse effects induced by TBT. An increase in CAT activity and changes in t-GSH levels are indicative of alterations on the cellular redox status. The inhibition of AChE could reflect signs of neurotoxicity. Altogether, these results reveal a negative impact on the health of this gastropod population.

  2. An overview of interstitial brachytherapy and hyperthermia

    SciTech Connect

    Brandt, B.B.; Harney, J.


    Interstitial thermoradiotherapy, an experimental cancer treatment that combines interstitial radiation implants (brachytherapy) and interstitial hyperthermia, is in the early stages of investigation. In accordance with the procedure used in a current national trial protocol, a 60-minute hyperthermia treatment is administered after catheters are placed into the tumor area while the patient is under general anesthesia. This is immediately followed by loading of radioactive Iridium-192 seeds into the catheters for a defined period of time. Once the prescribed radiation dose is delivered, the radioactive sources are removed and a second, 60-minute hyperthermia treatment is administered. Clinical trials with hyperthermia in combination with radiation have increased in recent years. Nurses caring for these patients need to become more knowledgeable about this investigational therapy. This paper provides an overview of the biologic rationale for this therapy, as well as a description of the delivery method and clinical application. Specific related nursing interventions are defined in a nursing protocol.23 references.

  3. Interstitial Lung Disease Induced by Pazopanib Treatment

    PubMed Central

    Ide, Shotaro; Sakamoto, Noriho; Hara, Shintaro; Hara, Atsuko; Kakugawa, Tomoyuki; Nakamura, Yoichi; Futsuki, Yoji; Izumikawa, Koichi; Ishimatsu, Yuji; Yanagihara, Katsunori; Mukae, Hiroshi


    Although pneumothorax has been reported to be a major pulmonary adverse event in patients treated with pazopanib, a multikinase inhibitor, drug-induced interstitial lung disease (DILD) has not been reported. A 74-year-old Japanese man who received pazopanib for the treatment of femoral leiomyosarcoma and lung metastasis presented with dyspnea and fatigue. He had mild interstitial pneumonia when pazopanib treatment was initiated. Chest computed tomography revealed progressive bilateral ground-glass opacity (GGO) and traction bronchiectasis. We diagnosed DILD due to pazopanib. The patient's pazopanib treatment was interrupted and a steroid was administered. The symptoms and GGO were improved with treatment. Physicians should be aware of DILD due to pazopanib in patients with pre-existing interstitial lung disease. PMID:28050004

  4. Photodynamic therapy: superficial and interstitial illumination

    NASA Astrophysics Data System (ADS)

    Svanberg, Katarina; Bendsoe, Niels; Axelsson, Johan; Andersson-Engels, Stefan; Svanberg, Sune


    Photodynamic therapy (PDT) is reviewed using the treatment of skin tumors as an example of superficial lesions and prostate cancer as an example of deep-lying lesions requiring interstitial intervention. These two applications are among the most commonly studied in oncological PDT, and illustrate well the different challenges facing the two modalities of PDT-superficial and interstitial. They thus serve as good examples to illustrate the entire field of PDT in oncology. PDT is discussed based on the Lund University group's over 20 yr of experience in the field. In particular, the interplay between optical diagnostics and dosimetry and the delivery of the therapeutic light dose are highlighted. An interactive multiple-fiber interstitial procedure to deliver the required therapeutic dose based on the assessment of light fluence rate and sensitizer concentration and oxygen level throughout the tumor is presented.

  5. Timolol-induced interstitial lung disease

    PubMed Central

    Patel, Hetain; Wilches, Lina Vanessa; Guerrero, Jorge


    Timolol maleate is a non-selective beta-adrenergic receptor blocking agent with demonstrated efficacy in the treatment of open-angle glaucoma. A 76 year old female who presented with productive cough, progressive dyspnea and hypoxia after starting timolol maleate opthalamic drops following glaucoma surgery. The patient was diagnosed with interstitial lung disease secondary to timolol treatment and after cessation of the offending agent along with corticosteroid treatment, symptoms improved drastically. Elimination of other possible causes of disease along with evolution of radiological and functional signs left us with a diagnosis of timolol-induced interstitial lung disease. To our knowledge, this is the second reported case of timolol-induced interstitial lung disease. PMID:26236595

  6. Smoking-related interstitial lung diseases.


    Vassallo, Robert; Ryu, Jay H


    Cigarette smoke, a toxic collection of thousands of chemicals generated from combustion of tobacco, is recognized as the primary causative agent of certain diffuse interstitial and bronchiolar lung diseases. Most patients afflicted with these disorders are cigarette smokers, and smoking cessation has been shown to be capable of inducing disease remission and should occupy a pivotal role in the management of all smokers with these diffuse lung diseases. The role of pharmacotherapy with corticosteroids or other immunomodulating agents is not well established but may be considered in patients with progressive forms of smoking-related interstitial lung diseases. Copyright © 2012 Elsevier Inc. All rights reserved.

  7. [Interstitial cystitis. A challenge for the clinician].


    Young, Pablo; Finn, Bárbara C; González, Martín; Comercio, Laura P; Quezel, Mariano; Bruetman, Julio E


    Interstitial cystitis is characterized by over 6 months of chronic pain, pressure and discomfort felt in the lower pelvis or bladder. It is often relieved with voiding, along with daytime frequency and nocturia in the absence of an urinary tract infection. The disorder can be divided clinically into two groups -ulcerative and non-ulcerative- based on cystoscopic findings and response to treatment. Management follows an approach of applying the least invasive therapy that affords sufficient relief of symptoms. We report a case of a patient with interstitial cystitis. The diagnosis was performed by symptoms and lesion in the cystoscopy and excellent response to amitriptyline.

  8. Bivalves and gastropods from the middle Campanian Anacacho limestone, South Central Texas

    USGS Publications Warehouse

    Elder, W.P.


    The Anacacho Limestone was deposited during the Campanian and represents two depositional intervals, one of early Campanian and one of middle Campanian age. These two intervals correspond to periods of major eustatic sea level rise. This study focuses on the molluscan paleontology of the middle Campanian interval in the eastern part of the Anacacho exposure belt in Medina County, Texas. Molluscan assemblages in this area are indicative of inner to mid-shelf environments. No significant reef components are present. These eastern Anacacho deposits are interpreted to represent more offshore, deeper water environments than those to the southwest, where reef and lagoonal deposits have been reported. Analysis of the macrofossil components from these eastern localities has expanded the number of invertebrate species known from the Anacacho Limestone by nearly three-fold. This increase in diversity, based on a small amount of new work, suggests that many more taxa are yet to be identified, particularly in the western part of the exposure belt in Uvalde and Kinney Counties. This paper documents the bivalve and gastropod fauna, discussing and illustrating 24 bivalve taxa and 11 gastropod species. Two new bivalve species are named, Panopea anacachoensis new species and Spondylus siccus new species, and two potentially new gastropod species are identified but not named herein due to inadequate material. This paper expands the distribution of many eastern Gulf Coast and Atlantic Coast taxa westward into Texas and shows strong ties between the Anacacho fauna and that of the Campanian Tar Heel and Bladen Formations of the Black Creek Group in North Carolina. The taxonomic ties between these two areas probably reflect the thorough documentation of the North Carolina fauna, which is the best documented Campanian bivalve fauna in the Gulf or Atlantic Coast regions.

  9. Increasing sea surface temperature and range shifts of intertidal gastropods along the Iberian Peninsula

    NASA Astrophysics Data System (ADS)

    Rubal, Marcos; Veiga, Puri; Cacabelos, Eva; Moreira, Juan; Sousa-Pinto, Isabel


    There are well-documented changes in abundance and geographical range of intertidal invertebrates related to climate change at north Europe. However, the effect of sea surface warming on intertidal invertebrates has been poorly studied at lower latitudes. Here we analyze potential changes in the abundance patterns and distribution range of rocky intertidal gastropods related to climate change along the Iberian Peninsula. To achieve this aim, the spatial distribution and range of sub-tropical, warm- and cold-water species of intertidal gastropods was explored by a fully hierarchical sampling design considering four different spatial scales, i.e. from region (100 s of km apart) to quadrats (ms apart). Variability on their patterns of abundance was explored by analysis of variance, changes on their distribution ranges were detected by comparing with previous records and their relationship with sea water temperature was explored by rank correlation analyses. Mean values of sea surface temperature along the Iberian coast, between 1949 and 2010, were obtained from in situ data compiled for three different grid squares: south Portugal, north Portugal, and Galicia. Lusitanian species did not show significant correlation with sea water temperature or changes on their distributional range or abundance, along the temperature gradient considered. The sub-tropical species Siphonaria pectinata has, however, increased its distribution range while boreal cold-water species showed the opposite pattern. The latter was more evident for Littorina littorea that was almost absent from the studied rocky shores of the Iberian Peninsula. Sub-tropical and boreal species showed significant but opposite correlation with sea water temperature. We hypothesized that the energetic cost of frequent exposures to sub-lethal temperatures might be responsible for these shifts. Therefore, intertidal gastropods at the Atlantic Iberian Peninsula coast are responding to the effect of global warming as it

  10. Evidence of trophic transfer of microcystins from the gastropod Lymnaea stagnalis to the fish Gasterosteus aculeatus.


    Lance, Emilie; Petit, Anais; Sanchez, Wilfried; Paty, Christelle; Gérard, Claudia; Bormans, Myriam


    According to our previous results the gastropod Lymnaea stagnalis exposed to MC-producing cyanobacteria accumulates microcystins (MCs) both as free and covalently bound forms in its tissues, therefore representing a potential risk of MC transfer through the food web. This study demonstrates in a laboratory experiment the transfer of free and bound MCs from L. stagnalis intoxicated by MC-producing Planktothrix agardhii ingestion to the fish Gasterosteus aculeatus. Fish were fed during five days with digestive glands of L. stagnalis containing various concentrations of free and bound MCs, then with toxin-free digestive glands during a 5-day depuration period. MC accumulation was measured in gastropod digestive gland and in various fish organs (liver, muscle, kidney, and gills). The impact on fish was evaluated through detoxification enzyme (glutathion-S-transferase, glutathion peroxydase and superoxyde dismutase) activities, hepatic histopathology, and modifications in gill ventilation, feeding and locomotion. G. aculeatus ingestion rate was similar with intoxicated and toxin-free diet. Fish accumulated MCs (up to 3.96±0.14μgg(-1)DW) in all organs and in decreasing order in liver, muscle, kidney and gills. Hepatic histopathology was moderate. Glutathion peroxydase was activated in gills during intoxication suggesting a slight reactive oxygen species production, but without any impact on gill ventilation. Intoxication via ingestion of MC-intoxicated snails impacted fish locomotion. Intoxicated fish remained significantly less mobile than controls during the intoxication period possibly due to a lower health condition, whereas they showed a greater mobility during the depuration period that might be related to an acute foraging for food. During depuration, MC elimination was total in gills and kidney, but partial in liver and muscle. Our results assess the MC transfer from gastropods to fish and the potential risk induced by bound MCs in the food web.

  11. New porcellioidean gastropods from early Devonian of Royal Creek area, Yukon Territory, Canada, with notes on their early phylogeny

    USGS Publications Warehouse

    Fryda, J.; Blodgett, R.B.; Lenz, A.C.; Manda, S.


    This paper presents a description of new gastropods belonging to the superfamily Porcellioidea (Vetigastropoda) from the richly diverse Lower Devonian gastropod fauna of the Road River Formation in the Royal Creek area, Yukon Territory. This fauna belongs to Western Canada Province of the Old World Realm. The Pragian species Porcellia (Porcellia) yukonensis n. sp. and Porcellia (Paraporcellia) sp. represent the oldest presently known members of subgenera Porcellia (Porcellia) and Porcellia (Paraporcellia). Their simple shell ornamentation fits well with an earlier described evolutionary trend in shell morphology of the Porcellinae. Late Pragian to early Emsian Perryconcha pulchra n. gen. and n. sp. is the first member of the Porcellioidea bearing a row of tremata on adult teleoconch whorls. The occurrence of this shell feature in the Porcellioidea is additional evidence that the evolution of the apertural slit was much more complicated than has been proposed in classical models of Paleozoic gastropod evolution. Copyright ?? 2008, The Paleontological Society.

  12. Radiocarbon ages of terrestrial gastropods extend duration of ice-free conditions at the Two Creeks forest bed, Wisconsin, USA

    USGS Publications Warehouse

    Rech, Jason A.; Nekola, Jeffrey C.; Pigati, Jeffrey S.


    Analysis of terrestrial gastropods that underlie the late Pleistocene Two Creeks forest bed (~ 13,800–13,500 cal yr BP) in eastern Wisconsin, USA provides evidence for a mixed tundra-taiga environment prior to formation of the taiga forest bed. Ten new AMS 14C analyses on terrestrial gastropod shells indicate the mixed tundra-taiga environment persisted from ~ 14,500 to 13,900 cal yr BP. The Twocreekan climatic substage, representing ice-free conditions on the shore of Lake Michigan, therefore began near the onset of peak warming conditions during the Bølling–Allerød interstadial and lasted ~ 1000 yr, nearly 600 yr longer than previously thought. These results provide important data for understanding the response of continental ice sheets to global climate forcing and demonstrate the potential of using terrestrial gastropod fossils for both environmental reconstruction and age control in late Quaternary sediments.

  13. Food poisoning due to consumption of the marine gastropod Plicopurpura columellaris in El Salvador.


    Barraza, José Enrique


    Finishing a red tide event (November 2005-April 2006), and after ingestion of 40-50 specimens of Plicopurpura columellaris (Muricidae), four Salvadoran girls, ranging from 4 to 11 years, presented intoxication symptoms within one hour. They were taken to hospital after more than two hours of symptoms. One fatality occurred when the elder girl died after six hours of ingestion. Specimen samples were taken from the place where the girls took the gastropods. Mouse bioassay indicated as if the collected specimens contained 7-million mouse units/100 g of saxitoxins.

  14. A pioneer survey and DNA barcoding of some commonly found gastropod molluscs on Robben Island

    PubMed Central

    van der Bank, Herman; Greenfield, Richard


    Abstract Nineteen species of abundant gastropods were collected at Robben Island, including introduced dune snails and European brown garden snails. They were identified using morphology and DNA barcoding. It was expected that the species recorded would be similar to those from the Cape peninsula, South Africa, but we were surprised to find some exceptions: the very abundant invasive mussel species in South Africa, the South American bisexual mussel (Semimytilus algosus), and the beaded topshells (Oxystele impervia) were not found on Robben Island. Possible explanations are presented for these differences. PMID:25685029

  15. Subtidal gastropods consume sulfur-oxidizing bacteria: evidence from coastal hydrothermal vents

    SciTech Connect

    Stein, J.L.


    The black abalone (Haliotis cracherodii), a commercially important shallow-water gastropod common off White Point, Southern California, is found frequently at subtidal hydrothermal vents within mats of filamentous sulfur-oxidizing bacteria. Foraging vent abalones actively consume the bacteria and confine their nightly feeding forays to bacterial mats surrounding the vents. The growth of abalones consuming the sulfur bacteria exceeds that of control individuals consuming microalgae and is comparable to reported growth rates of abalones consuming macroalgae. Thus, off White Point, the black abalone may derive a portion of its nutrition from the subsidy of geothermal energy.

  16. A pioneer survey and DNA barcoding of some commonly found gastropod molluscs on Robben Island.


    van der Bank, Herman; Greenfield, Richard


    Nineteen species of abundant gastropods were collected at Robben Island, including introduced dune snails and European brown garden snails. They were identified using morphology and DNA barcoding. It was expected that the species recorded would be similar to those from the Cape peninsula, South Africa, but we were surprised to find some exceptions: the very abundant invasive mussel species in South Africa, the South American bisexual mussel (Semimytilusalgosus), and the beaded topshells (Oxysteleimpervia) were not found on Robben Island. Possible explanations are presented for these differences.

  17. The Environmental Context of Gastropods on Western Laurentia (Basin and Range Province) During the Great Ordovician Biodiversification Event

    NASA Astrophysics Data System (ADS)

    Dahl, Robyn Mieko

    Gastropods are a major component of modern marine ecosystems and can be found in nearly every type of marine ecosystem. They experienced their first notable radiation during the Great Ordovician Biodiversification Event (~470 Ma), during which their diversity tripled. This study examines the gastropod assemblage preserved in the Basin and Range Province of the Western United States to establish the environmental context for the Ordovician gastropod radiation. Gastropods are present within every facies examined, but their relative abundance and distribution varies. Gastropods are rare in normal marine settings and abundant in harsh (i.e., dysoxic, hypersaline) environments. Their environmental context is shown to impact survivorship through the end-Ordovician extinction event and throughout the Paleozoic and Mesozoic. Collecting accurate density data for fossil deposits can prove challenging, especially when beds are not exposed in plane view. In these cases, paleontologists are tasked with reconstructing shellbed density from cross section exposure. This study presents a mathematical model to calculate the density of fossil material within a bed from bedding cross section counts. The model is calibrated against an Ordovician biofacies comprised of oncoids, macluritid gastropods and receptaculitids exposed in the Arrow Canyon Range of Southern Nevada, where unique preservation provides both cross section exposures and plan view of fossil concentrations. University Earth Science Departments seeking to establish impactful geoscience outreach programs often pursue large-scale, grant funded programs. While this type of outreach is highly successful, it is also extremely costly, and grant funding can be difficult to secure. Here, we present the Geoscience Education Outreach Program (GEOP), a small-scale, very affordable model tested over five years in the Department of Earth Sciences at UCR. GEOP provides a variety of outreach events and allows UCR Earth Sciences to

  18. Computer-assisted interstitial laser coagulation for BPH

    NASA Astrophysics Data System (ADS)

    Ho, Gideon; Barrett, Adrian R. W.; Ng, Wan S.; Lim, Liam G.; Cheng, Wai S.


    Interstitial laser thermotherapy is a minimally invasive surgical procedure that utilizes laser to coagulate and treat benign prostatic hyperplasia. This study explores the use of a computer-assisted interstitial laser coagulation system to aid surgeons in performing this procedure.

  19. A tale of two compartments: interstitial versus blood glucose monitoring.


    Cengiz, Eda; Tamborlane, William V


    Self-monitoring of blood glucose was described as one of the most important advancements in diabetes management since the invention of insulin in 1920. Recent advances in glucose sensor technology for measuring interstitial glucose concentrations have challenged the dominance of glucose meters in diabetes management, while raising questions about the relationships between interstitial and blood glucose levels. This article will review the differences between interstitial and blood glucose and some of the challenges in measuring interstitial glucose levels accurately.

  20. Edemagenic gain and interstitial fluid volume regulation.


    Dongaonkar, R M; Quick, C M; Stewart, R H; Drake, R E; Cox, C S; Laine, G A


    Under physiological conditions, interstitial fluid volume is tightly regulated by balancing microvascular filtration and lymphatic return to the central venous circulation. Even though microvascular filtration and lymphatic return are governed by conservation of mass, their interaction can result in exceedingly complex behavior. Without making simplifying assumptions, investigators must solve the fluid balance equations numerically, which limits the generality of the results. We thus made critical simplifying assumptions to develop a simple solution to the standard fluid balance equations that is expressed as an algebraic formula. Using a classical approach to describe systems with negative feedback, we formulated our solution as a "gain" relating the change in interstitial fluid volume to a change in effective microvascular driving pressure. The resulting "edemagenic gain" is a function of microvascular filtration coefficient (K(f)), effective lymphatic resistance (R(L)), and interstitial compliance (C). This formulation suggests two types of gain: "multivariate" dependent on C, R(L), and K(f), and "compliance-dominated" approximately equal to C. The latter forms a basis of a novel method to estimate C without measuring interstitial fluid pressure. Data from ovine experiments illustrate how edemagenic gain is altered with pulmonary edema induced by venous hypertension, histamine, and endotoxin. Reformulation of the classical equations governing fluid balance in terms of edemagenic gain thus yields new insight into the factors affecting an organ's susceptibility to edema.

  1. Lymphomatoid granulomatosis mimicking interstitial lung disease.


    Braham, Emna; Ayadi-Kaddour, Aïda; Smati, Belhassen; Ben Mrad, Sonia; Besbes, Mohammed; El Mezni, Faouzi


    Lymphoid granulomatosis is a rare form of pulmonary angiitis. This case report presents a patient with lymphoid granulomatosis in whom the clinical presentation, radiological features and the partial response to corticosteroid therapy mimicked interstitial lung disease. Lymphoid granulomatosis was only diagnosed at post-mortem examination. The range of reported clinical presentations, diagnostic approaches and outcomes are described.

  2. [Interstitial processes of the lungs in childhood].


    Popper, H


    Interstitial processes in the lungs of children can be due to several underlying diseases. Knowledge of the child's age is important as genetic aberrations play a major role in diseases in the first 2 years, whereas immunological diseases are more common starting in kindergarden age. In general lung diseases are rare in children, which makes the diagnostics difficult and results in a delayed diagnosis. In addition, pediatric pulmonologists are often very reluctant to perform lung biopsies due to a lack of a specialized pathologist. In order to make a contribution to the diagnostics of pediatric pulmonary diseases, pathologists should be specialized in pulmonary pathology, have a good knowledge of genetic methods and fetal lung development, which includes the genetic factors involved in lung growth and differentiation. A close cooperation with the pediatric pulmonologist is necessary and each patient should be discussed jointly on an interstitial lung disease board to promote the quality of diagnostics. The pathologist should be aware that the developing lungs of children are not just a smaller form of adult lungs and often react very differently. In this article, we mainly focus on diffuse infiltration patterns, such as ground glass and reticulonodular infiltrations as described in high-resolution computed tomography (HRCT). Localized interstitial processes, which can sometimes be tumor-like and malformations are not dealt with; however, vascular malformations are included as these often manifest as diffuse interstitial infiltrations and must therefore be taken into consideration for the differential diagnostics.

  3. Acute and subacute idiopathic interstitial pneumonias.


    Taniguchi, Hiroyuki; Kondoh, Yasuhiro


    Idiopathic interstitial pneumonias (IIPs) may have an acute or subacute presentation, or acute exacerbation may occur in a previously subclinical or unrecognized chronic IIP. Acute or subacute IIPs include acute interstitial pneumonia (AIP), cryptogenic organizing pneumonia (COP), nonspecific interstitial pneumonia (NSIP), acute exacerbation of idiopathic pulmonary fibrosis (AE-IPF) and AE-NSIP. Interstitial lung diseases (ILDs) including connective tissue disease (CTD) associated ILD, hypersensitivity pneumonitis, acute eosinophilic pneumonia, drug-induced lung disease and diffuse alveolar haemorrhage need to be differentiated from acute and subacute IIPs. Despite the severe lack of randomized controlled trials for the treatment of acute and subacute IIPs, the mainstream treatment remains corticosteroid therapy. Other potential therapies reported in the literature include corticosteroids and immunosuppression, antibiotics, anticoagulants, neutrophil elastase inhibitor, autoantibody-targeted treatment, antifibrotics and hemoperfusion therapy. With regard to mechanical ventilation, patients in recent studies with acute and subacute IIPs have shown better survival than those in previous studies. Therefore, a careful value-laden decision about the indications for endotracheal intubation should be made for each patient. Noninvasive ventilation may be beneficial to reduce ventilator associated pneumonia.

  4. Interstitial lung disease probably caused by imipramine.


    Deshpande, Prasanna R; Ravi, Ranjani; Gouda, Sinddalingana; Stanley, Weena; Hande, Manjunath H


    Drugs are rarely associated with causing interstitial lung disease (ILD). We report a case of a 75-year-old woman who developed ILD after exposure to imipramine. To our knowledge, this is one of the rare cases of ILD probably caused due to imipramine. There is need to report such rare adverse effects related to ILD and drugs for better management of ILD.

  5. Rheumatoid arthritis-associated interstitial lung disease

    PubMed Central

    Solomon, Joshua J; Brown, Kevin K


    Rheumatoid arthritis (RA) is a systemic inflammatory disorder affecting 1% of the US population. Patients can have extra-articular manifestations of their disease and the lungs are commonly involved. RA can affect any compartment of the respiratory system and high resolution computed tomography (HRCT) of the lung is abnormal in over half of these patients. Interstitial lung disease is a dreaded complication of RA. It is more prevalent in smokers, males, and those with high antibody titers. The pathogenesis is unknown but data suggest an environmental insult in the setting of a genetic predisposition. Smoking may play a role in the pathogenesis of disease through citrullination of protein in the lung leading to the development of autoimmunity. Patients usually present in middle age with cough and dyspnea. Pulmonary function testing most commonly shows reduced diffusion capacity for carbon monoxide and HRCT reveals a combination of reticulation and ground glass abnormalities. The most common pattern on HRCT and histopathology is usual interstitial pneumonia (UIP), with nonspecific interstitial pneumonia seen less frequently. There are no large-scale well-controlled treatment trials. In severe or progressive cases, treatment usually consists of corticosteroids with or without a cytotoxic agent for 6 months or longer. RA interstitial lung disease is progressive; over half of patients show radiographic progression within 2 years. Patients with a UIP pattern on biopsy have a survival similar to idiopathic pulmonary fibrosis. PMID:27790009

  6. Pulmonary interstitial glycogenosis in a patient with trisomy 21.


    Morrison, A K; Patel, M; Johnson, S L; LeGallo, R; Teague, W G; Vergales, B


    Pulmonary interstitial glycogenosis is an interstitial lung disease of childhood that has been increasingly reported over the past decade. Here, we present a case of pulmonary interstitial glycogenosis associated with trisomy 21, pulmonary arterial hypertension, and congenital heart disease in a 34 week premature infant.

  7. Interstitial stromal progenitors during kidney development: here, there and everywhere.


    Fanni, Daniela; Gerosa, Clara; Vinci, Laura; Ambu, Rossano; Dessì, Angelica; Eyken, Peter Van; Fanos, Vassilios; Faa, Gavino


    In recent years, the renal interstitium has been identified as the site of multiple cell types, giving rise to multiple contiguous cellular networks with multiple fundamental structural and functional roles. Few studies have been carried out on the morphological and functional properties of the stromal/interstitial renal cells during the intrauterine life. This work was aimed at reviewing the peculiar features of renal interstitial stem/progenitor cells involved in kidney development. The origin of the renal interstitial progenitor cells remains unknown. During kidney development, besides the Six2 + cells of the cap mesenchyme, a self-renewing progenitor population, characterized by the expression of Foxd1, represents the first actor of the non-nephrogenic lineage. Foxd1 + interstitial progenitors originate the cortical and the renal medullary interstitial progenitors. Here, the most important stromal/interstitial compartments present in the developing human kidney will be analyzed: capsular stromal cells, cortical interstitial cells, medullary interstitial cells, the interstitium inside the renal stem cell niche, Hilar interstitial cells and Ureteric interstitial cells. Data reported here indicate that the different interstitial compartments of the developing kidney are formed by different cell types that characterize the different renal areas. Further studies are needed to better characterize the different pools of renal interstitial progenitors and their role in human nephrogenesis.

  8. Regulation of Gastrointestinal Smooth Muscle Function by Interstitial Cells.


    Sanders, Kenton M; Kito, Yoshihiko; Hwang, Sung Jin; Ward, Sean M


    Interstitial cells of mesenchymal origin form gap junctions with smooth muscle cells in visceral smooth muscles and provide important regulatory functions. In gastrointestinal (GI) muscles, there are two distinct classes of interstitial cells, c-Kit(+) interstitial cells of Cajal and PDGFRα(+) cells, that regulate motility patterns. Loss of these cells may contribute to symptoms in GI motility disorders.

  9. Hyaluronan in Tubular and Interstitial Nephrocalcinosis

    NASA Astrophysics Data System (ADS)

    Verkoelen, Carl F.


    Hyaluronan (HA) is the major glycosaminoglycan (GAG) component of the renal medullary interstitium. HA is extremely large (up to 104 kDa) and composed of thousands repeating disaccharides of glucuronic acid (GlcUA) and N-acetylglucosamine (GlcNAc). HA is synthesized by hyaluronan synthases (HASs) and degraded by hyaluronidases (Hyals). The production of HA by renomedullary interstitial cells is mediated by local osmolality. When excess water needs to be excreted, increased interstitial HA seems to antagonize water reabsorption, while the opposite occurs during water conservation. Hence, papillary interstitial HA is low and Hyal high during anti-diuresis, whereas during diuresis HA is high and Hyal low. The polyanion HA plays a role in the reabsorption of hypotonic fluid by immobilizing cations (Na+) via the carboxylate (COO-) groups of GlcUA. The binding of Ca2+ to anionic HA is probably also responsible for the fact that the papilla does not become a stone despite the extremely high interstitial phosphate and oxalate. HA is also an excellent crystal binding molecule. The expression of HA at the luminal surface of renal tubular cells leads to tubular nephrocalcinosis (tubular NC). Calcium staining methods (Von Kossa, Yasue) demonstrated that crystallization inhibitors cannot avoid the occasional precipitation of calcium phosphate in the papillary interstitium (interstitial NC). These crystals are probably immediately immobilized by the gel-like HA matrix. After ulcerating through the pelvic wall the calcified matrix becomes a Randall's plaque. The attachment of calcium oxalate crystals from the primary urine to plaque may ultimately lead to the development of clinical stones in the renal calyces (nephrolithiasis).

  10. Effect of habitat complexity on population density and species richness in tropical intertidal predatory gastropod assemblages.


    Kohn, Alan J; Leviten, Paul J


    Structural complexity of the habitat significantly increases population density and number of species in assemblages of predatory gastropod molluscs (families Conidae, Muricidae, Mitridae and Vasidae) on intertidal, generally smooth, horizontal limestone platforms fringing tropical Pacific islands. The important topographic features are physical (depressions partly filled with coral rubble) and biotic (thick algal turf binding sand). Higher population density and species richness in areas with than without such natural refuges, and following experimental addition of artificial refuges on portions of habitat lacking them support this hypothesis. Two species of Drupa differ from the other species present in not utilizing refuges during times of physical stress; this is attributed to their depressed shell and broad, tenacious foot. Highest gastropod densities occur in steep-sided depressions and those containing much coral rubble and sand, suggesting that these are important qualities of refuges. We believe this is the first demonstration of how specific environmental factors affect population density and species diversity of benthic invertebrates in a coral reef-associated habitat.

  11. Studies on bioprospecting potential of a gastropod mollusc Cantharus tranquebaricus (Gmelin, 1791)

    PubMed Central

    Sarumathi, G; Arumugam, M; Kumaresan, S; Balasubramanian, T


    Objective To study the biological activities of the tissue extract of Cantharus tranquebaricus (C. tranquebaricus). Methods Crude extract of gastropod was tested for inhibition of bacterial growth. Antibacterial assay was carried out by disc diffusion method and the activity was measured accordingly based on the inhibition zone around the disc impregnated with gastropod extract. Molecular weight of the extract was determined by using SDS-PAGE. Plasma coagulation, Fibrin plate assay and substrate SDS-PAGE were used to determine the effect of sample on plasma coagulation, fibrin (ogen) olytic and proteolytic activity. Results The maximum inhibition zone (10 mm) was observed against Vibrio cholera (V. cholera) and minimum inhibition zone (2 mm) was noticed against Proteus mirablis (P. mirablis). The molecular weight was determined as 47-106 kDa. The tissue extract shows proteolytic activity above 48 kDa. SDS-PAGE analysis of fibrinogen after incubation with the tissue extract showed fibrinogenolytic activity. In plasma coagulation assay C. tranquebaricus tissue extract showed procoagulant property and it coagulated chicken plasma within 150 s, while control took 5 min to clot. The 9 HU hemolytic units were found against chicken blood and also exhibit high level of brine shrimp lethality. Conclusions This study suggests that C. tranquebaricus could be used as potential source for isolating bioactive compounds, since it is explored first time and found with promising results. PMID:23569843

  12. The gastropod shell has been co-opted to kill parasitic nematodes.


    Rae, R


    Exoskeletons have evolved 18 times independently over 550 MYA and are essential for the success of the Gastropoda. The gastropod shell shows a vast array of different sizes, shapes and structures, and is made of conchiolin and calcium carbonate, which provides protection from predators and extreme environmental conditions. Here, I report that the gastropod shell has another function and has been co-opted as a defense system to encase and kill parasitic nematodes. Upon infection, cells on the inner layer of the shell adhere to the nematode cuticle, swarm over its body and fuse it to the inside of the shell. Shells of wild Cepaea nemoralis, C. hortensis and Cornu aspersum from around the U.K. are heavily infected with several nematode species including Caenorhabditis elegans. By examining conchology collections I show that nematodes are permanently fixed in shells for hundreds of years and that nematode encapsulation is a pleisomorphic trait, prevalent in both the achatinoid and non-achatinoid clades of the Stylommatophora (and slugs and shelled slugs), which diverged 90-130 MYA. Taken together, these results show that the shell also evolved to kill parasitic nematodes and this is the only example of an exoskeleton that has been co-opted as an immune system.

  13. Immunomodulation in the marine gastropod Haliotis diversicolor exposed to benzo(a)pyrene.


    Gopalakrishnan, Singaram; Thilagam, Harikrishnan; Huang, Wei-Bin; Wang, Ke-Jian


    It has been reported that environmental pollutants in the aquatic ecosystem could weaken immune competence of organisms. The purpose of the present study was to investigate the effects of benzo(a)pyrene [B(a)P] on immunomodulation in marine gastropods and to see if these effects are caused by or related to the generation of reactive oxygen species. In our present study, the marine gastropod Haliotis diversicolor was exposed to sublethal concentrations (0.01, 0.02, 0.04 and 0.08 mg L(-1)) of B(a)P for 7d under laboratory conditions and the alterations of hematological parameters like haemocyte count, haemocyte viability, protein content and immune components like phenoloxidase, phagocytosis and superoxide anion generation were measured. In addition, the changes in lysozyme activity, antibacterial activity due to the effect of B(a)P on abalone were analysed. B(a)P was found to decrease significantly the total number of circulating haemocytes. Intracellular superoxide anion generation and phenoloxidase significantly increased on exposure to B(a)P, whereas phagocytic activity was decreased significantly at higher concentration. Significant alterations were found in the uptake of neutral red and the observed alterations of hematological parameters and immune components tested indicated the generation of immunotoxicological effects on abalone due to B(a)P exposure. The results demonstrate a possible relationship between B(a)P and the immunological parameters of abalone studied.

  14. The Heritability of Shell Morphometrics in the Freshwater Pulmonate Gastropod Physa

    PubMed Central

    Dillon, Robert T.; Jacquemin, Stephen J.


    The cosmopolitan freshwater pulmonate snail Physa acuta hybridizes readily with Physa carolinae in the laboratory, although their F1 progeny are sterile. The two species differ qualitatively in shell shape, the former bearing a more globose shell and the latter more fusiform. We performed a hybridization experiment, measuring a set of 14 traditional (linear) and landmark-based shell morphological variables on even-aged parents and their offspring from both hybrids and purebred control lines. Parent-offspring regression yielded a strikingly high heritability estimate for score on the first relative warp axis, h2 = 0.819 ± 0.073, a result that would seem to confirm the value of geometric morphometrics as a tool for retrieving evolutionary relationships from gastropod shell form. Score on the second relative warp axis was also significantly heritable (h2 = 0.312 ± 0.123), although more moderate, as were scores on second principal components extracted from traditional measurements (correlation h2 = 0.308 ± 0.069, covariance h2 = 0.314 ± 0.050). Although score on the first relative warp axis was significantly correlated with centroid size (p < 0.001), scores on none of the three second axes were so correlated. This result suggests that second axis score might prove especially useful for estimating genetic divergence among mixed-age populations of gastropods sampled from the field. PMID:25876155

  15. Bathymetric patterns of morphological disparity in deep-sea gastropods from the western North Atlantic basin.


    McClain, Craig R


    Understanding patterns of species richness requires knowledge of the individual roles species play in community structure. Here, I use gastropod shells as a source of information about both their ecological and their evolutionary functions in generating bathymetric gradients of diversity. Specifically, morphological disparity of shell architecture in deep-sea gastropods is evaluated over a depth gradient in the western North Atlantic by constructing an empirical morphospace based on an eigenshape analysis. Morphological disparity is quantified by calculating the centroid, total range, and dispersion of the morphospace at each station along the depth gradient. The results indicate that local faunas are drawn from a regional pool with the same variance but that average dissimilarity in forms reflects the number of species in the sample. The range of the morphospace at local scales is also less than at regional scales, resulting from the variability of the morphospace centroid over depth. Although the position of the morphospace changes with depth, morphological disparity remains unaffected. Despite the lack of bathymetric patterns in variance, patterns in nearest neighbor distance persist. The findings suggest the importance of interacting ecological and evolutionary processes at varying spatiotemporal scales for both morphological disparity and species richness.

  16. Pushing short DNA fragments to the limit: Phylogenetic relationships of 'hydrobioid' gastropods (Caenogastropoda: Rissooidea).


    Wilke, Thomas; Haase, Martin; Hershler, Robert; Liu, Hsiu-Ping; Misof, Bernhard; Ponder, Winston


    Although phylogenetic studies are increasingly utilizing multi-locus datasets, a review of GenBank data for the Gastropoda indicates a strong bias towards a few short gene fragments (most commonly COI, LSU rRNA, and SSU rRNA). This is particularly the case for the Rissooidea, one of the largest and most taxonomically difficult gastropod superfamilies. Here we analyze fragments of these three genes from 90 species to determine whether they can well resolve higher relationships within this superfamily, whether structurally aligned sequence datasets increase phylogenetic signal, and whether the inclusion of highly variable regions introduces noise. We also used the resulting phylogenetic data in combination with morphological/anatomical evidence to re-evaluate the taxonomic status of 'hydrobioid' family-level groups. Our results indicate that all three of the alignment strategies that were used resulted in phylogenies having similar signal levels. However, there was a slight advantage to using structural alignment for inferring family-level relationships. Moreover, the set of 'standard' gastropod genes supported recognition of many previously recognized families and provides new insight into the systematics of several problematic groups. However, some family-group taxa were unresolved and the relationships among families were also poorly supported, suggesting a need for more extensive sampling and inclusion of additional genes. Copyright © 2012 Elsevier Inc. All rights reserved.

  17. Parasitic infection alters the physiological response of a marine gastropod to ocean acidification.


    Macleod, C D; Poulin, R


    Increased hydrogen ion concentration and decreased carbonate ion concentration in seawater are the most physiologically relevant consequences of ocean acidification (OA). Changes to either chemical species may increase the metabolic cost of physiological processes in marine organisms, and reduce the energy available for growth, reproduction and survival. Parasitic infection also increases the energetic demands experienced by marine organisms, and may reduce host tolerance to stressors associated with OA. This study assessed the combined metabolic effects of parasitic infection and OA on an intertidal gastropod, Zeacumantus subcarinatus. Oxygen consumption rates and tissue glucose content were recorded in snails infected with one of three trematode parasites, and an uninfected control group, maintained in acidified (7·6 and 7·4 pH) or unmodified (8·1 pH) seawater. Exposure to acidified seawater significantly altered the oxygen consumption rates and tissue glucose content of infected and uninfected snails, and there were clear differences in the magnitude of these changes between snails infected with different species of trematode. These results indicate that the combined effects of OA and parasitic infection significantly alter the energy requirements of Z. subcarinatus, and that the species of the infecting parasite may play an important role in determining the tolerance of marine gastropods to OA.

  18. Body Size Extinction and Origination Selectivity: A Case Study of Marine Gastropods

    NASA Astrophysics Data System (ADS)

    Kuo, E.; Seixas, G.; Faerber, M.; Payne, J.


    Body size has received exceptional interest in evolutionary biology because of its correlation with many ecological and physiological traits. Because large size is typically associated with long generation time and small population size, it has been widely assumed that extinction risk is positively correlated with body size. Data from Pleistocene and Holocene terrestrial mammals and birds support this inference. However, there have been few studies on size bias of marine invertebrate animals, so the true extent of this pattern remains unknown. For this study, we compiled genus-level body size data for marine gastropods spanning the entire Phanerozoic. We use this dataset to examine the statistical evidence for size bias in both origination and extinction of marine gastropods. We perform logistic regression analyses on the data from each Phanerozoic stage to determine the association of body size with origination and extinction. Contrary to previous studies on terrestrial vertebrates, we observe no strong or persistent association between body size and the probability that a genus either originated or went extinct during that stage. Hence, our findings indicate that size bias in extinction risk may reflect particular aspects of mammalian biology or anthropogenic environmental change rather than a general pattern of animal evolution.

  19. Effects of gastropod predation on the reproductive output of an overexploited deep octocoral

    NASA Astrophysics Data System (ADS)

    Priori, C.; Erra, F.; Angiolillo, M.; Santangelo, G.


    The study presented herein is aimed at quantifying the effects of the partial predation exerted by the gastropod Pseudosimnia carnea on the reproductive features of the highly valuable, slow-growing, and long-lived red coral, Corallium rubrum. Seventy-five colonies were collected just before annual spawning from a red coral population living between 85 and 90 m deep in the NW Mediterranean; of these, 35 % were affected by P. carnea. Female colonies were more frequently preyed upon than males (3:1 ratio). Overall, 1,100 polyps were dissected and examined for their reproductive content. The mean number of polyps per colony and the mean fecundity of female polyps and colonies were significantly reduced by gastropod predation, which affected colonies independently of their size; in particular, colony fecundity was reduced by 81 %. The consequent reduction in population reproductive output is likely to have long-term effects on preyed-upon populations and thereby limit their resilience to intense commercial harvesting.

  20. Mobile Element Evolution Playing Jigsaw - SINEs in Gastropod and Bivalve Mollusks.


    Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette


    SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc-snail and SCoica-mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain-Snail-is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5' end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves-extending the distribution range of this superfamily. © The Author(s) 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  1. Mobile Element Evolution Playing Jigsaw—SINEs in Gastropod and Bivalve Mollusks

    PubMed Central

    Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette


    SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc—snail and SCoica—mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain—Snail—is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5′ end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves—extending the distribution range of this superfamily. PMID:26739168

  2. What can aquatic gastropods tell us about phenotypic plasticity? A review and meta-analysis

    PubMed Central

    Bourdeau, P E; Butlin, R K; Brönmark, C; Edgell, T C; Hoverman, J T; Hollander, J


    There have been few attempts to synthesise the growing body of literature on phenotypic plasticity to reveal patterns and generalities about the extent and magnitude of plastic responses. Here, we conduct a review and meta-analysis of published literature on phenotypic plasticity in aquatic (marine and freshwater) gastropods, a common system for studying plasticity. We identified 96 studies, using pre-determined search terms, published between 1985 and November 2013. The literature was dominated by studies of predator-induced shell form, snail growth rates and life history parameters of a few model taxa, accounting for 67% of all studies reviewed. Meta-analyses indicated average plastic responses in shell thickness, shell shape, and growth and fecundity of freshwater species was at least three times larger than in marine species. Within marine gastropods, species with planktonic development had similar average plastic responses to species with benthic development. We discuss these findings in the context of the role of costs and limits of phenotypic plasticity and environmental heterogeneity as important constraints on the evolution of plasticity. We also consider potential publication biases and discuss areas for future research, indicating well-studied areas and important knowledge gaps. PMID:26219231

  3. The vertical distribution and abundance of gastropods and bivalves from rocky beaches of Cuastecomate Bay, Jalisco, México.


    Esqueda, M C; Ríos-Jara, E; Michel-Morfín, J E; Landa-Jaime, V


    The vertical distribution and abundance of conspicuous gastropod and bivalve species were studied at five rocky beaches in Cuastecomate Bay, Jalisco. Sampling was done from September, 1993 through March, 1994 with 0.75 m2 quadrants placed along replicate transect lines (10 m long) in the supralittoral and mesolittoral (upper, middle and lower intertidal) zones. A total of 6,643 mollusks were collected. Gastropods dominated the samples (6,272 individuals, 44 species); the bivalves were less abundant and diverse (371 individuals, five species). Seventeen species comprised 89.8% of all individuals collected. The gastropods Nodilittorina aspera and Nerita scabricosta were the most abundant with 637.8 and 71.43 individuals/m2, respectively. The most abundant bivalves were Brachidontes adamsianus and Chloromytilus palliopunctatus with 60.7 and 61.3 individuals/m2 respectively. The abundance of gastropods decreased from the supralittoral to the lower tidal zones while the number of species increased in the same direction. The number of species of bivalves also increased from the supralittoral to the lower intertidal zone; the abundance of individuals was higher at the middle intertidal zone. Affinities between groups of species among sampling stations were identified by computing Pearson's correlation coefficient using abundance values (ind./m2) and Jaccard's dissimilarity index using species presence or absence in the lower intertidal zone. Affinity among stations was not dependent upon their vicinity but on the high dominance of few species, the occurrence of many secondary species and beach characteristics.

  4. Deriving Sediment Interstitial Water Remediation Goals ...

    EPA Pesticide Factsheets

    This document contains a methodology for developing interstitial water remediation goals (IWRGs) for nonionic organic pollutants (toxicants) in sediments for the protection of benthic organisms. The document provides the basis for using the final chronic values (FCVs) from EPA’s aquatic water quality criteria (AWQC) for the protection of aquatic life to set the IWRGs for toxicants in sediments. Concentrations of the toxicants in the sediment interstitial water are measured using passive sampling. This document also discusses how to evaluate the consistency between passive sampling measurements and sediment toxicity test results. When these data are consistent, one can be reasonably assured that the causes of toxicity to benthic organisms in the sediment have been correctly identified and that the developed IWRGs for the toxicants will be protective of the benthic organisms at the site. The consistency evaluation is an important step in developing defensible IWRGs. To assist in developing defensible IWRGs.

  5. Pancreas tumor interstitial pressure catheter measurement

    NASA Astrophysics Data System (ADS)

    Nieskoski, Michael D.; Gunn, Jason; Marra, Kayla; Trembly, B. Stuart; Pogue, Brian W.


    This paper highlights the methodology in measuring interstitial pressure in pancreatic adenocarcinoma tumors. A Millar Mikrotip pressure catheter (SPR-671) was used in this study and a system was built to amplify and filter the output signal for data collection. The Millar pressure catheter was calibrated prior to each experiment in a water column at 37°C, range of 0 to 60 inH2O (112 mmHg), resulting in a calibration factor of 33 mV / 1 inH2O. The interstitial pressures measured in two orthotopically grown pancreatic adenocarcinoma tumor were 57 mmHg and 48 mmHg, respectively. Verteporfin uptake into the pancreatic adenocarcinoma tumor was measured using a probe-based experimental dosimeter.

  6. Irradiation system for interstitial photodynamic therapy

    NASA Astrophysics Data System (ADS)

    Pacheco, L.; Stolik, S.; De la Rosa, J.


    Interstitial Photodynamic Therapy (IPDT) is a promising form of treatment of deep-seated and bulky malignant tumors, based on the lethal cell response to the photochemical reactions when drug is light activated in presence of oxygen. In order to accomplish an effective internal illumination, laser sources are preferably used because of two important reasons: the monochromatic light can be confined to the narrow absorption band of the drug and the laser beam is easily focused into optical fibers. In this work the development of a diode-laser-light-source is presented. The system is tuned by temperature to get a better match in the 5-ALA absorption band. This system also comprises a trifurcated fiber system to accomplish interstitial illumination.

  7. Uncommon causes of occupational interstitial lung diseases.


    Gong, H


    Uncommon causes of occupational interstitial lung disease, or pneumoconiosis, are being increasingly recognized and diagnosed. The fibrogenic potential of numerous types of respirable inorganic particles remains poorly understood but is significantly determined by lung deposition and clearance, the agent's size and solubility, host susceptibility, and other factors. Microanalytic techniques have improved the identification of uncommon or unusual biopersistent particles or elements in fibrotic lung tissue. Recent findings in workers exposed to manmade vitreous fibers, silicon carbide, talc, titanium, cerium, and polyvinyl chloride provide new clinical insights into not only their specific fibrogenic capabilities but also in the broader appreciation that many cases of unexplained interstitial lung disease may be caused by occupational exposures to one or more uncommon airborne substances.

  8. [Alveolo-interstitial pneumonia due to Temozolamide].


    Guilleminault, L; Carré, P; de Luca, K; Beau Salinas, F; Autret-Leca, E; Narciso, B; Diot, P


    Temozolomide is an alkylating agent approved for treatment of glioblastoma in association with radiotherapy. We report the case of a 56 year old woman presenting with alveolo-interstitial pneumonia after treatment with Temozolomide. Initially she received induction treatment with Temozolomide and concomitant radiotherapy for bifocal high grade glioblastoma. A month later she received, as scheduled, the first course of Temozolomide maintenance chemotherapy. Grade II dyspnoea developed a few days later. High resolution computed tomography showed alveolo-interstitial opacities with basal predominance, associated with alveolar nodules. Broncho-alveolar lavage showed a lymphocytosis. No bacteria were isolated from microbiological samples. A final diagnosis of drug-induced pneumonia was based on the time sequence and absence of other causes. There is little literature concerning the pulmonary toxicity of Temozolomide. However, our case report of drug-induced pneumonia and similar observations in the databases of regional pharmacovigilance centres suggest that this side effect should be included in the summary of product characteristics.

  9. Interstitial hyperthermia in combination with brachytherapy.


    Coughlin, C T; Douple, E B; Strohbehn, J W; Eaton, W L; Trembly, B S; Wong, T Z


    Flexible coaxial cables were modified to serve as microwave antennas operating at a frequency of 915 MHz. These antennas were inserted into nylon afterloading tubes that had been implanted in tumors using conventional interstitial implantation techniques for iridium-192 seed brachytherapy. The tumor volume was heated to 42-45 degrees C within 15 minutes and heating was continued for a total of 1 hour per treatment. Immediately following a conventional brachytherapy dose and removal of the iridium seeds the tumors were heated again in a second treatment. This interstitial technique for delivering local hyperthermia should be compatible with most brachytherapy methods. The technique has proved so far to be practical and without complications. Temperature distributions obtained in tissue phantoms and a patient are described.

  10. RTOG quality assurance guidelines for interstitial hyperthermia.


    Emami, B; Stauffer, P; Dewhirst, M W; Prionas, S; Ryan, T; Corry, P; Herman, T; Kapp, D S; Myerson, R J; Samulski, T


    This document specifies the current recommendations for quality assurance for hyperthermia administration with interstitial techniques as specified by the Radiation Therapy Oncology Group (RTOG). The document begins by providing a brief description of the physical principles behind the use of the three most commonly used methods of interstitial hyperthermia: radiofrequency (RF-LCF), microwave antennas, and ferromagnetic seeds. Emphasis is placed on features that effect quality assurance. Specific recommendations are provided for: a) Pretreatment planning and equipment performance checks, b) Implant considerations and documentation, c) Thermometry, and d) Safety procedures. Specific details regarding quality assurance issues that are common to all local and regional hyperthermia methods are outlined in previous documents sponsored by the RTOG. It is anticipated that technological advances may lead to future modifications of this document.

  11. Interstitial devices for treating deep seated tumors

    NASA Astrophysics Data System (ADS)

    Lafon, Cyril; Cathignol, Dominique; Prat, Frédéric; Melodelima, David; Salomir, Rares; Theillère, Yves; Chapelon, Jean-Yves


    Techniques using intracavitary or interstitial applicators have been proposed because extracorporeal HIFU techniques are not always suitable for deep-seated tumors. Bones or gaseous pockets may indeed be located in the intervening tissue. The objective is to bring the ultrasound source as close as possible to the target through natural routes in order to minimize the effects of attenuation and phase aberration along the ultrasound pathway. Under these circumstances, it becomes possible to use higher frequency, thus increasing the ultrasonic absorption coefficient and resulting in more efficient heating of the treatment region. In contrast to extra-corporeal applicators, the design of interstitial probes imposes additional constraints relative to size and ergonomy. The goal of this paper is to present the range of miniature interstitial applicators we developed at INSERM for various applications. The sources are rotating plane water-cooled transducers that operate at a frequency between 3 and 10 MHz depending on the desired therapeutic depth. The choice of a plane transducer rather than divergent sources permits to extend the therapeutic depth and to enhance the angular selectivity of the treatment Rotating single element flat transducer can also be replaced by cylindrical arrays for rotating electronically a reconstructed plane wave. When extended zone of coagulation are required, original therapeutic modalities combining cavitation and thermal effects are used. These methods consist in favoring in depth heating by increasing the acoustic attenuation away from the transducer with the presence of bubbles. When associated to modern imaging modalities, these minimally invasive therapeutic devices offer very promising options for cancer treatment. For examples, two versions of an image-guided esophageal applicator are designed: one uses a retractable ultrasound mini probe for the positioning of the applicator, while the other is MRI compatible and offers on line

  12. [Chronic recurrent multifocal osteomyelitis with interstitial myositis].


    Nagashima, Saori; Nozawa, Tomo; Kizawa, Toshitaka; Kikuchi, Masako; Miyamae, Takako; Imagawa, Tomoyuki; Inaba, Hiroshi; Sato, Tatsuharu; Hashimoto, Kunio; Aida, Noriko; Yokota, Shumpei


    Chronic recurrent multifocal osteomyelitis (CRMO) is an inflammatory, non-infectious disorder of skeletal system mainly seen in children. We report a case of CRMO presenting with fever and leg pain. The patient was an 11-year-old boy complaining of a fever, swelling and pain on his right foot, and pain on both legs. Although serum levels of CK and aldolase were not increased, MRI imaging suggested polymyositis. Muscle biopsy showed interstitial infiltration of inflammatory cells without any evidences of dermatomyositis or polymyositis. One month later, he complained of a swelling, pain and redness of his left clavicle as recurrently experienced during the recent 6 months, and MRI investigation indicated the diagnosis of osteomyelitis. Bone biopsy was performed and showed chronic inflammatory changes with negative bacterial culture. Multiple bone lesions and muscle uptake of FDG in his legs were revealed by whole body FDG-PET/CT, and he was diagnosed as having CRMO with interstitial myositis. The combinatorial administration of non-steroidal anti-inflammatory drugs and bisphosphonate successfully improved his clinical symptoms and laboratory abnormalities. To our knowledge, there is no report of a patient of CRMO associated with interstitial myositis.

  13. Interstitial loop transformations in FeCr

    SciTech Connect

    Béland, Laurent Karim; Osetsky, Yuri N.; Stoller, Roger E.; Xu, Haixuan


    Here, we improve the Self-Evolving Atomistic Kinetic Monte Carlo (SEAKMC) algorithm by integrating the Activation Relaxation Technique nouveau (ARTn), a powerful open-ended saddle-point search method, into the algorithm. We use it to investigate the reaction of 37-interstitial 1/2[1 1 1] and 1/2[View the MathML source] loops in FeCr at 10 at.% Cr. They transform into 1/2[1 1 1], 1/2[View the MathML source], [1 0 0] and [0 1 0] 74-interstitial clusters with an overall barrier of 0.85 eV. We find that Cr decoration locally inhibits the rotation of crowdions, which dictates the final loop orientation. Moreover, the final loop orientation depends on the details of the Cr decoration. Generally, a region of a given orientation is favored if Cr near its interface with a region of another orientation is able to inhibit reorientation at this interface more than the Cr present at the other interfaces. Also, we find that substitutional Cr atoms can diffuse from energetically unfavorable to energetically favorable sites within the interlocked 37-interstitial loops conformation with barriers of less than 0.35 eV.

  14. Interstitial loop transformations in FeCr


    Béland, Laurent Karim; Osetsky, Yuri N.; Stoller, Roger E.; ...


    Here, we improve the Self-Evolving Atomistic Kinetic Monte Carlo (SEAKMC) algorithm by integrating the Activation Relaxation Technique nouveau (ARTn), a powerful open-ended saddle-point search method, into the algorithm. We use it to investigate the reaction of 37-interstitial 1/2[1 1 1] and 1/2[View the MathML source] loops in FeCr at 10 at.% Cr. They transform into 1/2[1 1 1], 1/2[View the MathML source], [1 0 0] and [0 1 0] 74-interstitial clusters with an overall barrier of 0.85 eV. We find that Cr decoration locally inhibits the rotation of crowdions, which dictates the final loop orientation. Moreover, the final loop orientationmore » depends on the details of the Cr decoration. Generally, a region of a given orientation is favored if Cr near its interface with a region of another orientation is able to inhibit reorientation at this interface more than the Cr present at the other interfaces. Also, we find that substitutional Cr atoms can diffuse from energetically unfavorable to energetically favorable sites within the interlocked 37-interstitial loops conformation with barriers of less than 0.35 eV.« less

  15. Breast conservation treatment with perioperative interstitial irradiation

    SciTech Connect

    Krishnan, L.; Mansfield, C.M.; Jewell, W.R.; Reddy, E.K.; Thomas, J.H.; Krishnan, E.C.


    Limited resection of the breast combined with radiation has proved to be as effective as more radical surgery in treating early breast cancer. At the University of Kansas Medical Center, the radiotherapy consists of an interstitial implant at the time of lumpectomy to deliver an interstitial boost dose to the tumor bed with iridium-192 immediately following the surgical procedure. An axillary node dissection is also performed at the time of lumpectomy. A dose of 2000 cGy is delivered to the tumor bed between 40 and 60 h. Two to three weeks later, 4500-5000 cGy is delivered to the entire breast with external beam radiation over 5-5.5 weeks. One hundred breasts in 98 patients were so treated between June 1982 and February 1986, with 2 carcinomas in situ, 40 stage I, 51 stage II, and 7 stage III cancers, consisting of 2 TIS, 54 T1, 39 T2, and 5 T3 lesions. Locoregional control with a median follow-up of 31 months was 98%. One recurrence was in a different quadrant, and the other revealed predominantly the in situ component. Immediate implant did not compromise wound healing or cosmesis. The cosmetic result was graded as good to excellent in 88% of the breasts. Our preliminary results appear to suggest a better local control with immediate interstitial irradiation.

  16. Temperature control in interstitial laser cancer immunotherapy

    NASA Astrophysics Data System (ADS)

    Bandyopadhyay, Pradip K.; Holmes, Kyland; Burnett, Corinthius; Zharov, Vladimir P.


    Positive results of Laser-Assisted Cancer Immunotherapy (LACI) have been reported previously in the irradiation of superficial tumors. This paper reports the effect of LACI using laser interstitial therapy approach. We hypothesize that the maximum immuno response depends on laser induced tumor temperature. The measurement of tumor temperature is crucial to ensure necrosis by thermal damage and immuno response. Wister Furth female rats in this study were inoculated with 13762 MAT B III rat mammary adinocarcinoma. LACI started seven to ten days following inoculation. Contrary to surface irradation, we applied laser interstitial irradiation of tumor volume to maximize the energy deposition. A diode laser with a wavelength of 805 nm was used for tumor irradiation. The laser energy was delivered inside the tumor through a quartz fiber. Tumor temperature was measured with a micro thermocouple (interstitial), while the tumor surface temperature was controlled with an IR detector. The temperature feedback demonstrates that it is possible to maintain the average tumor temperature at the same level with reasonable accuracy in the desired range from 65°C-85°C. In some experiments we used microwave thermometry to control average temperature in deep tissue for considerable period of time, to cause maximum thermal damage to the tumor. The experimental set-up and the different temperature measurement techniques are reported in detail, including the advantages and disadvantages for each method.

  17. Accumulation of Cu and Zn in discarded antifouling paint particles by the marine gastropod, Littorina littorea

    NASA Astrophysics Data System (ADS)

    Gammon, Melanie; Turner, Andrew; Brown, Murray T.


    The short-term (5 day) accumulation of Cu and Zn in different tissues of the marine gastropod, Littorina littorea, has been studied in the presence of ˜10 mg l -1 of antifouling paint particles and pre- or simultaneously contaminated algal food ( Ulva lactuca). Accumulation of Cu was observed in the head-foot, digestive gland-gonad complex and gills to extents dependent on how and when food was contaminated and administered. However, retention of Zn was only observed in the gills and only when L. littorea and U. lactuca were simultaneously exposed to paint particles. Relative to the alga, faecal material was highly enriched in Zn, suggesting that the animal is able to rapidly eliminate this metal, most likely through the formation and egestion of insoluble phosphate granules. Thus, L. littorea is a useful biomonitor of marine contamination by antifouling applications in respect of Cu but not Zn.

  18. Protection mechanisms of the iron-plated armor of a deep-sea hydrothermal vent gastropod

    PubMed Central

    Yao, Haimin; Dao, Ming; Imholt, Timothy; Huang, Jamie; Wheeler, Kevin; Bonilla, Alejandro; Suresh, Subra; Ortiz, Christine


    Biological exoskeletons, in particular those with unusually robust and multifunctional properties, hold enormous potential for the development of improved load-bearing and protective engineering materials. Here, we report new materials and mechanical design principles of the iron-plated multilayered structure of the natural armor of Crysomallon squamiferum, a recently discovered gastropod mollusc from the Kairei Indian hydrothermal vent field, which is unlike any other known natural or synthetic engineered armor. We have determined through nanoscale experiments and computational simulations of a predatory attack that the specific combination of different materials, microstructures, interfacial geometries, gradation, and layering are advantageous for penetration resistance, energy dissipation, mitigation of fracture and crack arrest, reduction of back deflections, and resistance to bending and tensile loads. The structure-property-performance relationships described are expected to be of technological interest for a variety of civilian and defense applications. PMID:20133823

  19. Spatial patterns of morphological diversity across the Indo-Pacific: analyses using strombid gastropods.

    PubMed Central

    Roy, K.; Balch, D. P.; Hellberg, M. E.


    Biological diversity can be measured using various metrics, but existing knowledge of spatial patterns of diversity is largely based on species counts. There is increasing evidence that trends in species richness might not match trends in other biodiversity metrics, such as morphological diversity. Here, we use data from a large group of Indo-Pacific gastropods (family Strombidae) to show that the species richness of a region is a poor predictor of the morphological diversity present there. Areas with only a few species can harbour an impressive array of morphologies and, conversely, morphological diversity in the most species-rich regions is no higher than in regions with half their taxonomic diversity. Biological diversity in the Pacific is highly threatened by human activity and our results indicate that, in addition to species richness, morphological diversity metrics need to be incorporated into conservation decisions. PMID:11749702

  20. Ocean acidification disrupts induced defences in the intertidal gastropod Littorina littorea.


    Bibby, Ruth; Cleall-Harding, Polly; Rundle, Simon; Widdicombe, Steve; Spicer, John


    Carbon dioxide-induced ocean acidification is predicted to have major implications for marine life, but the research focus to date has been on direct effects. We demonstrate that acidified seawater can have indirect biological effects by disrupting the capability of organisms to express induced defences, hence, increasing their vulnerability to predation. The intertidal gastropod Littorina littorea produced thicker shells in the presence of predation (crab) cues but this response was disrupted at low seawater pH. This response was accompanied by a marked depression in metabolic rate (hypometabolism) under the joint stress of high predation risk and reduced pH. However, snails in this treatment apparently compensated for a lack of morphological defence, by increasing their avoidance behaviour, which, in turn, could affect their interactions with other organisms. Together, these findings suggest that biological effects from ocean acidification may be complex and extend beyond simple direct effects.

  1. Predator-prey interaction between muricid gastropods and mussels under ocean acidification.


    Xu, X-Y; Yip, K R; Shin, P K S; Cheung, S G


    Predation of the muricid gastropod Thais clavigera on two-sized groups of the mussel Brachidontes variabilis was studied under three pCO2 levels, 380, 950, and 1250μatm. At 950μatm pCO2 level, the prey handling time decreased significantly and large-sized B. variabilis were preferred by T. clavigera. However, the prey consumption rate was independent of pCO2 levels, although the prey searching time increased significantly at elevated pCO2. These findings indicated that the predator-prey interaction between T. clavigera and B. variabilis was altered under ocean acidification, which will have a long-term impact on the population dynamics of the interacting species.

  2. Gastropods from the Campanian-Maastrichtian Aruma Formation, Central Saudi Arabia

    NASA Astrophysics Data System (ADS)

    Gameil, Mohamed; El-Sorogy, Abdelbaset S.


    The gastropod fauna of the Upper Cretaceous Aruma Formation in central Saudi Arabia comprises fifteen species belonging to fifteen genera, fourteen families, and five clades. The species are not abundant at any individual stratigraphic level but are equally and irregularly scattered in the formation. The studied species come mainly from the Hajajah Member of Upper Cretaceous Aruma Formation in central Saudi Arabia. Calliomphalus orientalis (Douvillé, 1916); Coelobolma corbarica Cossmann, 1918; Turritella (Torquesia) figarii Quaas, 1902; Neoptyxis olisiponensis (Sharpe, 1850) and Otostoma (Otostoma) divaricatum (d'Orbigny, 1847) are recorded from the Upper Cretaceous of central Arabia for the first time. The identified species have a close affinity to the Tethyan fauna known from other parts in Asia, Africa and Europe. Herbivores and predators are the dominant trophic groups which may indicate shallow marine lagoonal and relatively open marine environment.

  3. Evidence that gastropod torsion is driven by asymmetric cell proliferation activated by TGF-beta signalling.


    Kurita, Yoshihisa; Wada, Hiroshi


    Gastropods are characterized by their asymmetric bodyplan, which develops through a unique ontogenetic process called 'torsion'. Despite several intensive studies, the driving force of torsion remains to be determined. Although torsion was traditionally believed to be driven by contraction of the retractor muscle connecting the foot and the shell, some recent reports cast doubt on that idea. Here, we report that torsion is accompanied by left-right asymmetric cell proliferation in the mantle epithelium in the limpet Nipponacmea fuscoviridis. Furthermore, we found that pharmacological inhibition of the transforming growth factor-β (TGF-β) signalling pathway, including that of Nodal, blocked torsion. We confirmed that the blocking was brought about through failure of the activation of cell proliferation in the right-hand side of the mantle epithelium, while the retractor muscle apparently developed normally. These results suggest that limpet torsion is driven by left-right asymmetric cell proliferation in the mantle epithelium, induced by the TGF-β pathway.

  4. Rapid and convergent evolution of parental care in hydrobiid gastropods from New Zealand.


    Haase, M


    Although parental care occurs in most phyla encompassing a wide array of forms, little is known about its evolution in invertebrates. Two types of egg capsules have been known among ovoviviparous New Zealand hydrobiid gastropods, elastic capsules and simple membranes. Based on a phylogenetic analysis using two mtDNA sequence fragments, I asked whether the second state was derived from the first or whether brooding had multiple origins. The evolution of ovoviviparity was also investigated in the context of habitat transition between brackish and freshwater. Maximum parsimony and Markov chain models of character state transformations in a maximum likelihood framework suggested that hydrobiids have invaded freshwater three times independently. Two of these invasions were followed by the evolution of ovoviviparity, probably in adaptation to changing water levels during periods of irregular precipitation. The syntopy of two congeneric species, one oviparous and the other one brooding, indicated that the transition between reproductive modes must have occurred rapidly.

  5. Fish predation as a factor in the distribution of Lake Malawi gastropods.


    McKaye, K R; Stauffer, J R; Louda, S M


    Gastropod densities in Lake Malawi, Africa drop dramatically below 4.5 m water depth. Weed beds disappear and the number of molluscivorous cichlids increases below this depth. When molluscivores were excluded from open sand habitat by cages, due to migration and reduced predation, the density of snails increased by 40-60% within a week. Alternatively, when adult Cyrtocara placodon were placed into the cages, snail density equaled the controls. The molluscivores disproportionately consumed snails of the genus Bulinus relative to those of the more heavily armoured genus, Melanoides. Cichlid molluscivores are hypothesized to be responsible for preventing the thin shelled bilharzia vector snail, Bulinus globosus, from successfully invading the open shore areas of Lake Malawi. Lake Malawi may be relatively free of this human disease because of snail predation by cichlids.

  6. Odontomariinae, a new middle paleozoic subfamily of slit-bearing euophaloidean gastropods (Euophalomorpha, Gastropoda)

    USGS Publications Warehouse

    Fryda, J.; Heidelberger, D.; Blodgett, R.B.


    A new subfamily, the Odontomariinae subfam. nov., is established herein for a distinctive group of uncoiled, slit-bearing Middle Devonian euomphalid gastropods. Its taxonomic position is based on the recent discovery of open coiled protoconchs and it is placed within the Euomphalomorpha. The genera Odontomaria Odontomaria C. F. Roemer and Tubiconcha n. gen. belonging to this new subfamily are enlarged based on studies on new material of the following species: Odontomaria semiplicata (Sandberger & Sandberger), Odontomaria gracilis n. sp., Odontomaria jankei n. sp., Odontomaria cheeneetnukensis n. sp., Odontomaria cindiprellerae n. sp. and Tubiconcha leunissi (Heidelberger, 2001). Members of the Odontomariinae were mainly sedentary organisms in high-energy, moderately shallow water. ?? 2006 E. Schweizerbart'sche Verlagsbuchhandlung.

  7. Gastropod nacre: structure, properties and growth--biological, chemical and physical basics.


    Heinemann, Fabian; Launspach, Malte; Gries, Katharina; Fritz, Monika


    The biogenic polymer/mineral composite nacre is a non-brittle biological ceramic, which self-organizes in aqueous environment and under ambient conditions. It is therefore an important model for new sustainable materials. Its highly controlled structural organization of mineral and organic components at all scales down to the nano- and molecular scales is guided by organic molecules. These molecules then get incorporated into the material to be responsible for properties like fracture mechanics, beauty and corrosion resistance. We report here on structure, properties and growth of columnar (gastropod) nacre with emphasis on the genus Haliotis in contrast to sheet nacre of many bivalves. © 2010 Elsevier B.V. All rights reserved.

  8. Gene expression and feeding ecology: evolution of piscivory in the venomous gastropod genus Conus.

    PubMed Central

    Duda, Thomas F.; Palumbi, Stephen R.


    Differential expression of gene-family members is typically associated with the specific development of certain tissues and organs, but its importance in the ecological adaptation of organisms has rarely been investigated. Several specialized feeding modes have evolved within the predatory marine gastropod genus Conus, including molluscivory and piscivory. Based on phylogenetic investigations of Conus species, it has been concluded that piscivory arose at least twice in this genus. Moreover, molecular analyses of conotoxin mRNA transcripts reveal that piscivores from independent evolutionary lineages express the same subset of four-loop conotoxins, contrary to phylogenetic expectations. These results demonstrate that differential expression of gene-family members can play a key role in adaptive evolution, particularly during shifts to new ecological niches. PMID:15306367

  9. New gastropod vectors and tetrodotoxin potential expansion in temperate waters of the Atlantic Ocean.


    Silva, Marisa; Azevedo, Joana; Rodriguez, Paula; Alfonso, Amparo; Botana, Luis M; Vasconcelos, Vítor


    Tetrodotoxin is a potent low weight marine toxin found in warm waters, especially of the Indian and Pacific Oceans. Intoxications are usually linked to the consumption of the puffer fish, although TTX was already detected in several different edible taxa. Benthic organisms such as mollusks and echinoderms, with different feeding habits, were collected monthly along the Portuguese coast from the summer of 2009 until the end of 2010. The extraction and analysis techniques were optimized and TTX and some analogues were detected for the first time in two intertidal gastropod species-Gibbula umbilicalis and Monodonta lineata by LC-MS/MS and UPLC-MS/MS. Although the levels are low, these findings suggest that monitoring of TTX and analogues in North Atlantic species should be implemented so as to detect potentially new toxin vectors and seasonal and/or geographical patterns.

  10. New Gastropod Vectors and Tetrodotoxin Potential Expansion in Temperate Waters of the Atlantic Ocean

    PubMed Central

    Silva, Marisa; Azevedo, Joana; Rodriguez, Paula; Alfonso, Amparo; Botana, Luis M.; Vasconcelos, Vítor


    Tetrodotoxin is a potent low weight marine toxin found in warm waters, especially of the Indian and Pacific Oceans. Intoxications are usually linked to the consumption of the puffer fish, although TTX was already detected in several different edible taxa. Benthic organisms such as mollusks and echinoderms, with different feeding habits, were collected monthly along the Portuguese coast from the summer of 2009 until the end of 2010. The extraction and analysis techniques were optimized and TTX and some analogues were detected for the first time in two intertidal gastropod species—Gibbula umbilicalis and Monodonta lineata by LC-MS/MS and UPLC-MS/MS. Although the levels are low, these findings suggest that monitoring of TTX and analogues in North Atlantic species should be implemented so as to detect potentially new toxin vectors and seasonal and/or geographical patterns. PMID:22690139

  11. Five new cryptic freshwater gastropod species from New Caledonia (Caenogastropoda, Truncatelloidea, Tateidae)

    PubMed Central

    Haase, Martin; Zielske, Susan


    Abstract During the course of a project aiming at the reconstruction of the colonization of the South Pacific islands by tateid gastropods based on molecular data we discovered five new species on New Caledonia belonging to the genera Hemistomia and Leiorhagium, respectively. We describe these species based on morphological, anatomical and genetic data. All five species are morphologically cryptic as they closely resemble or are even indistinguishable from known species stressing the importance of a comprehensive taxonomic approach integrating several methods. As a consequence of their small and fragmented geographic ranges and the rapidly progressing anthropogenic land cover changes on New Caledonia, all five species qualify as critically endangered according to the criteria of the IUCN. PMID:26478699

  12. Interstitial space and collagen alterations of the developing rat diaphragm

    NASA Technical Reports Server (NTRS)

    Gosselin, L. E.; Martinez, D. A.; Vailas, A. C.; Sieck, G. C.


    The effect of growth on the relative interstitial space [%total cross-sectional area (CSA)] and collagen content of the rat diaphragm muscle was examined at postnatal ages of 0, 7, 14, and 21 days as well as in adult males. The proportion of interstitial space relative to total muscle CSA was determined by computerized image analysis of lectin-stained cross sections of diaphragm muscle. To assess collagen content and extent of collagen maturation (i.e., cross-linking), high-pressure liquid chromatography analysis was used to measure hydroxyproline concentration and the nonreducible collagen cross-link hydroxylysylpyridinoline (HP), respectively. At birth, interstitial space accounted for approximately 47% of total diaphragm muscle CSA. During postnatal growth, the relative contribution of interstitial space decreased such that by adulthood the interstitial space accounted for approximately 18% of total muscle CSA. The change in relative interstitial space occurred without a concomitant change in hydroxyproline concentration. However, the concentration of HP markedly increased with age such that the adult diaphragm contained approximately 17 times more HP than at birth. These results indicate that during development the relative CSA occupied by interstitial space decreases as muscle fiber size increases. However, the reduction in relative interstitial space is not associated with a change in collagen concentration. Thus collagen density in the interstitial space may increase with age. It is possible that the observed changes in relative interstitial space and collagen influence the passive length-force properties of the diaphragm.

  13. Interstitial space and collagen alterations of the developing rat diaphragm

    NASA Technical Reports Server (NTRS)

    Gosselin, L. E.; Martinez, D. A.; Vailas, A. C.; Sieck, G. C.


    The effect of growth on the relative interstitial space [%total cross-sectional area (CSA)] and collagen content of the rat diaphragm muscle was examined at postnatal ages of 0, 7, 14, and 21 days as well as in adult males. The proportion of interstitial space relative to total muscle CSA was determined by computerized image analysis of lectin-stained cross sections of diaphragm muscle. To assess collagen content and extent of collagen maturation (i.e., cross-linking), high-pressure liquid chromatography analysis was used to measure hydroxyproline concentration and the nonreducible collagen cross-link hydroxylysylpyridinoline (HP), respectively. At birth, interstitial space accounted for approximately 47% of total diaphragm muscle CSA. During postnatal growth, the relative contribution of interstitial space decreased such that by adulthood the interstitial space accounted for approximately 18% of total muscle CSA. The change in relative interstitial space occurred without a concomitant change in hydroxyproline concentration. However, the concentration of HP markedly increased with age such that the adult diaphragm contained approximately 17 times more HP than at birth. These results indicate that during development the relative CSA occupied by interstitial space decreases as muscle fiber size increases. However, the reduction in relative interstitial space is not associated with a change in collagen concentration. Thus collagen density in the interstitial space may increase with age. It is possible that the observed changes in relative interstitial space and collagen influence the passive length-force properties of the diaphragm.

  14. Experimental depletion of different renal interstitial cell populations

    SciTech Connect

    Bohman, S.O.; Sundelin, B.; Forsum, U.; Tribukait, B.


    To define different populations of renal interstitial cells and investigate some aspects of their function, we studied the kidneys of normal rats and rats with hereditary diabetes insipidus (DI, Brattleboro) after experimental manipulations expected to alter the number of interstitial cells. DI rats showed an almost complete loss of interstitial cells in their renal papillae after treatment with a high dose of vasopressin. In spite of the lack of interstitial cells, the animals concentrated their urine to the same extent as vasopressin-treated normal rats, indicating that the renomedullary interstitial cells do not have an important function in concentrating the urine. The interstitial cells returned nearly to normal within 1 week off vasopressin treatment, suggesting a rapid turnover rate of these cells. To further distinguish different populations of interstitial cells, we studied the distribution of class II MHC antigen expression in the kidneys of normal and bone-marrow depleted Wistar rats. Normal rats had abundant class II antigen-positive interstitial cells in the renal cortex and outer medulla, but not in the inner medulla (papilla). Six days after 1000 rad whole body irradiation, the stainable cells were almost completely lost, but electron microscopic morphometry showed a virtually unchanged volume density of interstitial cells in the cortex and outer medulla, as well as the inner medulla. Thus, irradiation abolished the expression of the class II antigen but caused no significant depletion of interstitial cells.

  15. Microstructures in shells of the freshwater gastropod Viviparus viviparus: a potential sensor for temperature change?


    Füllenbach, Christoph S; Schöne, Bernd R; Branscheid, Robert


    Mollusk shells contain a plethora of information on past climate variability. However, only a limited toolkit is currently available to reconstruct such data from the shells. The environmental data of some proxies (e.g. Sr/Ca ratios) is obscured by physiological effects, whereas other proxies, such as δ(18)O, simultaneously provide information on two or more different environmental variables. The present study investigates whether microstructures of the freshwater gastropod Viviparus viviparus provide an alternative means to reconstruct past water temperature. Cold and highly variable temperature regimes resulted in the precipitation of highly unordered first-order lamellae of simple crossed-lamellar (XLM) structures if new shell formed from scratch. However, during stable and warm conditions, well-ordered first-order lamellae were laid down irrespective of pre-existing shell material. Homogeneous first-order lamellae also formed during times of cold and highly variable temperatures if the new shell was deposited onto existing shell material with well-ordered first-order lamellae. The growth front seems to contain instructions for building specific microstructure variants, irrespective of environmental conditions. However, if this template is missing, the animal forms a deviating microstructure. Under extremely stressful situations (e.g. removal from habitat, calcein staining, extreme temperature shifts), the gastropod precipitates an evolutionarily older microstructure (irregular simple prisms) rather than XLM structures. These shell portions were macroscopically described as disturbance lines. In addition, repetitive, presumably periodic growth patterns were observed, which consisted of gradually changing third-order lamellae between consecutive faint, organic-rich growth lines. These growth patterns were probably controlled by intrinsic biological clocks and exhibited a two-daily periodicity. The results of this study may provide the basis for using changes in

  16. Correlated Evolution between Mode of Larval Development and Habitat in Muricid Gastropods

    PubMed Central

    Pappalardo, Paula; Rodríguez-Serrano, Enrique; Fernández, Miriam


    Abstract Larval modes of development affect evolutionary processes and influence the distribution of marine invertebrates in the ocean. The decrease in pelagic development toward higher latitudes is one of the patterns of distribution most frequently discussed in marine organisms (Thorson's rule), which has been related to increased larval mortality associated with long pelagic durations in colder waters. However, the type of substrate occupied by adults has been suggested to influence the generality of the latitudinal patterns in larval development. To help understand how the environment affects the evolution of larval types we evaluated the association between larval development and habitat using gastropods of the Muricidae family as a model group. To achieve this goal, we collected information on latitudinal distribution, sea water temperature, larval development and type of substrate occupied by adults. We constructed a molecular phylogeny for 45 species of muricids to estimate the ancestral character states and to assess the relationship between traits using comparative methods in a Bayesian framework. Our results showed high probability for a common ancestor of the muricids with nonpelagic (and nonfeeding) development, that lived in hard bottoms and cold temperatures. From this ancestor, a pelagic feeding larva evolved three times, and some species shifted to warmer temperatures or sand bottoms. The evolution of larval development was not independent of habitat; the most probable evolutionary route reconstructed in the analysis of correlated evolution showed that type of larval development may change in soft bottoms but in hard bottoms this change is highly unlikely. Lower sea water temperatures were associated with nonpelagic modes of development, supporting Thorson's rule. We show how environmental pressures can favor a particular mode of larval development or transitions between larval modes and discuss the reacquisition of feeding larva in muricids

  17. A prokineticin-like protein responds to immune challenges in the gastropod pest Pomacea canaliculata.


    Accorsi, Alice; Benatti, Stefania; Ross, Eric; Nasi, Milena; Malagoli, Davide


    The golden apple snail Pomacea canaliculata is an invasive pest originating from South America. It has already been found in Asia, the southern United States and more recently in the EU. Aiming to target the immune system of the snail as a way to control its spreading, we have developed organ-specific transcriptomes and looked for molecules controlling replication and differentiation of snail hemocytes. The prokineticin domain-containing protein Astakine 1 is the only cytokine known thus far capable of regulating invertebrate hematopoiesis, and we analyzed the transcriptomes looking for molecules containing a prokineticin domain. We have identified a prokineticin-like protein (PlP), that we called Pc-plp and we analyzed by real-time PCR (qPCR) its expression. In control snails, highest levels of Pc-plp were detected in the digestive gland, the ampulla (i.e., a hemocyte reservoir) and the pericardial fluid (i.e., the hematopoietic district). We tested Pc-plp expression after triggering hematopoiesis via multiple hemolymph withdrawals, or during bacterial challenge through LPS injection. In both cases a reduction of Pc-plp mRNA was observed. The multiple hemolymph withdrawals caused a significant decrease of Pc-plp mRNA in pericardial fluid and circulating hemocytes, while the LPS injection promoted the Pc-plp mRNA drop in anterior kidney, mantle and gills, organs that may act as immune barrier in molluscs. Our data indicate an important role for prokineticin domain-containing proteins as immunomodulators also in gastropods and their dynamic expression may serve as a biosensor to gauge the effectiveness of immunological interventions aimed at curtailing the spreading of the gastropod pest P. canaliculata.

  18. Consumption rates and prey preference of the invasive gastropod Rapana venosa in the Northern Adriatic Sea

    NASA Astrophysics Data System (ADS)

    Savini, Dario; Occhipinti-Ambrogi, Anna


    The alien Asian gastropod Rapana venosa (Valenciennes 1846) was first recorded in 1973 along the Italian coast of the Northern Adriatic Sea. Recently, this predator of bivalves has been spreading all around the world oceans, probably helped by ship traffic and aquaculture trade. A caging experiment in natural environment was performed during the summer of 2002 in Cesenatico (Emilia-Romagna, Italy) in order to estimate consumption rates and prey preference of R. venosa. The prey items chosen were the Mediterranean mussel Mytilus galloprovincialis (Lamarck 1819), the introduced carpet clam Tapes philippinarum (Adams and Reeve 1850), both supporting the local fisheries, and the Indo-Pacific invasive clam Anadara (Scapharca) inaequivalvis (Bruguière 1789). Results showed an average consumption of about 1 bivalve prey per day (or 1.2 g wet weight per day). Predation was species and size selective towards small specimens of A. inaequivalvis; consumption of the two commercial species was lower. These results might reduce the concern about the economical impact on the local bivalve fishery due to the presence of the predatory gastropod. On the other hand, selective predation might probably alter local community structure, influencing competition amongst filter feeder/suspension feeder bivalve species and causing long-term ecological impact. The large availability of food resource and the habitat characteristics of the Emilia-Romagna littoral makes this area an important breeding ground for R. venosa in the Mediterranean Sea, thus worthy of consideration in order to understand the bioinvasion ecology of this species and to control its likely further dispersal.

  19. Environmentally relevant concentrations of a common insecticide increase predation risk in a freshwater gastropod.


    Salice, Christopher J; Kimberly, David A


    Ecological receptors are faced with a multitude of stressors that include abiotic and biotic factors creating a challenge for assessing risk of chemical exposure. Of particular interest and importance are the effects of contaminants on inter-species interactions such as competition and predator-prey relationships. The objective of this study was to determine whether environmentally relevant concentrations of the commonly used insecticide, malathion, would alter predator avoidance behavior in a freshwater gastropod that could translate to increased predation risk. We exposed adult Physa pomilia snails to 0, 0.25, or 1.0 mg/L malathion for 2, 24, or 48 h and evaluated predator avoidance using a behavioral assay in which snails were exposed to cues from predatory crayfish. We found a significant reduction in predator avoidance in snails exposed to both concentrations of malathion after 48 h of exposure. To evaluate whether observed effects of malathion on predator avoidance actually increased susceptibility of snails to predators, we conducted a predator challenge experiment. Snails exposed to 0.25 mg/L malathion for 48 h were significantly more susceptible to predation. That increased predation risk was evident 48 h after initial malathion exposures is a unique result because most studies have evaluated behavioral responses soon after (<12 h) initiation of pesticide exposure. The extent to which the observed interactions affect natural populations, and the mechanisms through which they are mediated are largely unexplored. However, our study is the first to show that a commonly used insecticide decreases predator avoidance and may actually increase predation susceptibility in gastropods at concentrations several orders of magnitude below acute toxicity levels.

  20. Terrestrial invasion of pomatiopsid gastropods in the heavy-snow region of the Japanese Archipelago

    PubMed Central


    Background Gastropod mollusks are one of the most successful animals that have diversified in the fully terrestrial habitat. They have evolved terrestrial taxa in more than nine lineages, most of which originated during the Paleozoic or Mesozoic. The rissooidean gastropod family Pomatiopsidae is one of the few groups that have evolved fully terrestrial taxa during the late Cenozoic. The pomatiopsine diversity is particularly high in the Japanese Archipelago and the terrestrial taxa occur only in this region. In this study, we conducted thorough samplings of Japanese pomatiopsid species and performed molecular phylogenetic analyses to explore the patterns of diversification and terrestrial invasion. Results Molecular phylogenetic analyses revealed that Japanese Pomatiopsinae derived from multiple colonization of the Eurasian Continent and that subsequent habitat shifts from aquatic to terrestrial life occurred at least twice within two Japanese endemic lineages. Each lineage comprises amphibious and terrestrial species, both of which are confined to the mountains in heavy-snow regions facing the Japan Sea. The estimated divergence time suggested that diversification of these terrestrial lineages started in the Late Miocene, when active orogenesis of the Japanese landmass and establishment of snowy conditions began. Conclusions The terrestrial invasion of Japanese Pomatiopsinae occurred at least twice beside the mountain streamlets of heavy-snow regions, which is considered the first case of this event in the area. Because snow coverage maintains stable temperatures and high humidity on the ground surface, heavy-snow conditions may have paved the way for these organisms from freshwater to land via mountain streamlets by preventing winter desiccation in mountain valleys. The fact that the terrestrialization of Pomatiopsidae occurred only in year-round wet environments, but not in seasonally dried regions, provides new insight into ancient molluscan terrestrialization

  1. The ultrastructure of spermatozoa and spermiogenesis in pyramidellid gastropods, and its systematic importance

    NASA Astrophysics Data System (ADS)

    Healy, John M.


    Ultrastructural observations on spermiogenesis and spermatozoa of selected pyramidellid gastropods (species of Turbonilla, Pyrgulina, Cingulina and Hinemoa) are presented. During spermatid developement, the condensing nucleus becomes initially anterio-posteriorly compressed or sometimes cup-shaped. Concurrently, the acrosomal complex attaches to an electrondense layer at the presumptive anterior pole of the nucleus, while at the opposite (posterior) pole of the nucleus a shallow invagination is formed to accommodate the centriolar derivative. Midpiece formation begins soon after these events have taken place, and involves the following processes: (1) the wrapping of individual mitochondria around the axoneme/coarse fibre complex; (2) later internal metamorphosis resulting in replacement of cristae by paracrystalline layers which envelope the matrix material; and (3) formation of a glycogen-filled helix within the mitochondrial derivative (via a secondary wrapping of mitochondria). Advanced stages of nuclear condensation (elongation, transformation of fibres into lamellae, subsequent compaction) and midpiece formation proceed within a microtubular sheath (‘manchette’). Pyramidellid spermatozoa consist of an acrosomal complex (round to ovoid apical vesicle; column-shaped acrosomal pedestal), helically-keeled nucleus (short, 7 10 μm long, shallow basal invagination for axoneme/coarse fibre attachment), elongate helical midpiece (composed of axoneme, coarse fibres, paracrystalline and matrix materials, glycogen-filled helix), glycogen piece (length variable, preceeded by a dense ring structure at junction with midpiece). The features of developing and mature spermatozoa observed in the Pyramidellidae are as observed in opisthobranch and pulmonate gastropods indicating that the Pyramidelloidea should be placed within the Euthyneura/Heterobranchia, most appropriately as a member group of the Opisthobranchia.

  2. Kenyan coral reef-associated gastropod assemblages: distribution and diversity patterns

    NASA Astrophysics Data System (ADS)

    McClanahan, T. R.


    A survey of Kenya's shallow water (<2 m) coral reef-associated prosobranch fauna was undertaken to determine patterns of distribution, density, diversity and species richness, and the possible role of other reef fauna and human utilization on these patterns. The sample assemblage of 135 species from 25 families is similar to other Indian Ocean regions with no apparent endemism or subregional faunal affinities. Species richness, determined by species-individual relationships, has been reduced by approximately 45% since the Pleistocene. Northern Kenya, typified by small coral islands experiencing river and estuarine discharges had low densities and species richness and high species variability. This is attributable to the interrelated factors of river discharge, small reefs and reduced predator refuge. Southern Kenya's more expansive fringing reef has a denser and richer fauna but appears less species rich than Tanzania. Variation within reefs suggests similarities in diversity between reef lagoons, flats and edges, but lagoons had lower densities than reef flat or edge sites. This is attributable to greater predation rates within lagoons. Species composition between reef locations was variable but differed for comparisons between reef lagoons and reef flats. The population densities of thirty commercially collected species were compared between shelled and unshelled reefs. Only two commercial strombids, Lambis truncata and L. chiragra, had lower densities within shelled compared to unshelled reefs. Within six southern Kenvan reef lagoons, total gastropod densities were negatively correlated with the Balistidae (triggerfish) and total fish densities and positively with sea urchin densities. The removal of balistids through fishing appears to lead to co-occurring population increases in gastropod and sea urchin populations which, in most instances, appears to negate the effect of shell collecting.

  3. Non-Random Sibling Cannibalism in the Marine Gastropod Crepidula coquimbensis

    PubMed Central

    Brante, Antonio; Fernández, Miriam; Viard, Frédérique


    Sibling cannibalism is commonly observed in marine species. For instance, intrabrood cannibalism has been documented in marine gastropods with direct development, suggesting a relationship between embryo behavior and the evolution of life history strategies. However, there has been little effort to document the factors driving sibling cannibalism in marine species. The kin selection theory suggests that the level of relatedness plays an important role in cannibalism patterns. We examined Crepidula coquimbensis, a marine gastropod that broods and encloses its brooded offspring in capsules. Encapsulated embryos show sibling cannibalism and high levels of intracapsular multiple paternity. Given these features, cannibalistic behavior may be driven by kin-relatedness. To test this hypothesis, we constructed artificial aggregations of embryos to mimic three levels of relatedness: high, medium and low. For each category of aggregation, the cannibalism rate and benefits (i.e. size at hatching of surviving offspring) were estimated. In addition, at the end of embryo development, we performed parentage analyses to determine if cannibalism was associated with the relatedness between cannibal and victim embryos. Our results show that the intensity of sibling cannibalism increased in aggregations characterized by the lowest level of relatedness. There were important benefits of cannibalism in terms of hatching cannibal size. In addition, cannibalism between embryos was not random: the variation in reproductive success between males increased over the course of the experiment and the effective number of fathers decreased. Altogether, these results suggest that polyandry may play an important role in the evolution of sibling cannibalism in C. coquimbensis and that kin selection may operate during early embryonic stages in this species. PMID:23805291

  4. Terrestrial invasion of pomatiopsid gastropods in the heavy-snow region of the Japanese Archipelago.


    Kameda, Yuichi; Kato, Makoto


    Gastropod mollusks are one of the most successful animals that have diversified in the fully terrestrial habitat. They have evolved terrestrial taxa in more than nine lineages, most of which originated during the Paleozoic or Mesozoic. The rissooidean gastropod family Pomatiopsidae is one of the few groups that have evolved fully terrestrial taxa during the late Cenozoic. The pomatiopsine diversity is particularly high in the Japanese Archipelago and the terrestrial taxa occur only in this region. In this study, we conducted thorough samplings of Japanese pomatiopsid species and performed molecular phylogenetic analyses to explore the patterns of diversification and terrestrial invasion. Molecular phylogenetic analyses revealed that Japanese Pomatiopsinae derived from multiple colonization of the Eurasian Continent and that subsequent habitat shifts from aquatic to terrestrial life occurred at least twice within two Japanese endemic lineages. Each lineage comprises amphibious and terrestrial species, both of which are confined to the mountains in heavy-snow regions facing the Japan Sea. The estimated divergence time suggested that diversification of these terrestrial lineages started in the Late Miocene, when active orogenesis of the Japanese landmass and establishment of snowy conditions began. The terrestrial invasion of Japanese Pomatiopsinae occurred at least twice beside the mountain streamlets of heavy-snow regions, which is considered the first case of this event in the area. Because snow coverage maintains stable temperatures and high humidity on the ground surface, heavy-snow conditions may have paved the way for these organisms from freshwater to land via mountain streamlets by preventing winter desiccation in mountain valleys. The fact that the terrestrialization of Pomatiopsidae occurred only in year-round wet environments, but not in seasonally dried regions, provides new insight into ancient molluscan terrestrialization.

  5. Correlated evolution between mode of larval development and habitat in muricid gastropods.


    Pappalardo, Paula; Rodríguez-Serrano, Enrique; Fernández, Miriam


    Larval modes of development affect evolutionary processes and influence the distribution of marine invertebrates in the ocean. The decrease in pelagic development toward higher latitudes is one of the patterns of distribution most frequently discussed in marine organisms (Thorson's rule), which has been related to increased larval mortality associated with long pelagic durations in colder waters. However, the type of substrate occupied by adults has been suggested to influence the generality of the latitudinal patterns in larval development. To help understand how the environment affects the evolution of larval types we evaluated the association between larval development and habitat using gastropods of the Muricidae family as a model group. To achieve this goal, we collected information on latitudinal distribution, sea water temperature, larval development and type of substrate occupied by adults. We constructed a molecular phylogeny for 45 species of muricids to estimate the ancestral character states and to assess the relationship between traits using comparative methods in a Bayesian framework. Our results showed high probability for a common ancestor of the muricids with nonpelagic (and nonfeeding) development, that lived in hard bottoms and cold temperatures. From this ancestor, a pelagic feeding larva evolved three times, and some species shifted to warmer temperatures or sand bottoms. The evolution of larval development was not independent of habitat; the most probable evolutionary route reconstructed in the analysis of correlated evolution showed that type of larval development may change in soft bottoms but in hard bottoms this change is highly unlikely. Lower sea water temperatures were associated with nonpelagic modes of development, supporting Thorson's rule. We show how environmental pressures can favor a particular mode of larval development or transitions between larval modes and discuss the reacquisition of feeding larva in muricids gastropods.

  6. [Nonspecific interstitial pneumonitis: a clinicopathologic entity, histologic pattern or unclassified group of heterogeneous interstitial pneumonitis?].


    Morais, António; Moura, M Conceição Souto; Cruz, M Rosa; Gomes, Isabel


    Nonspecific interstitial pneumonitis (NSIP) initially described by Katzenstein and Fiorelli in 1994, seems to be a distinct clinicopathologic entity among idiopathic interstitial pneumonitis (IIP). Besides different histologic features from other IIP, NSIP is characterized by a better long-term outcome, associated with a better steroids responsiveness than idiopathic pulmonar fibrosis (IPF), where usually were included. Thus, differentiating NSIP from other IIP, namely IPF is very significant, since it has important therapeutic and prognostic implications. NSIP encloses different pathologies, namely those with inflammatory predominance (cellular subtype) or fibrous predominance (fibrosing subtype). NSIP is reviewed and discussed by the authors, after two clinical cases description.

  7. [Streptococcal infection, acute kidney failure and interstitial nephritis].


    Faurie, R E; Prado, A C


    The relationship between streptococcal infection and renal disease has been object of multiple studies. Streptococcal infection may induce acute glomerulonephritis or interstitial nephritis. We report a patient with a streptococcal infection who developed acute renal failure. The renal biopsy showed an acute interstitial nephritis, with an interstitium infiltrate with a significant number of eosinophils. We review the causes of acute renal failure associated with streptococcal infection, specially acute interstitial nephritis.

  8. Idiopathic non-specific interstitial pneumonia.


    Belloli, Elizabeth A; Beckford, Rosemarie; Hadley, Ryan; Flaherty, Kevin R


    Non-specific interstitial pneumonia (NSIP) is an interstitial lung disease that may be idiopathic or secondary to connective tissue disease, toxins or numerous other causes. Idiopathic NSIP is a rare diagnosis and requires exclusion of these other possible causes. Patients typically present in mid-adulthood with dyspnoea, cough and often constitutional symptoms including fever and fatigue. The disease has a female predominance, and more than 50% of patients have never smoked. Physical exam features mild hypoxaemia and inspiratory rales. Pulmonary function tests demonstrate restriction and a low diffusing capacity for carbon monoxide. High-resolution computed tomography abnormalities include predominantly lower lobe subpleural reticular changes, traction bronchiectasis and ground-glass opacities; honeycombing is rarely seen. An evaluation of the underlying pathology is necessary for a firm diagnosis. Histologically, alveolar and interstitial mononuclear cell inflammation and fibrosis are seen in a temporally uniform pattern with preserved underlying alveolar architecture. NSIP must be differentiated from other parenchymal lung diseases including idiopathic pulmonary fibrosis and hypersensitivity pneumonitis. A thorough exposure history and assessment for underlying connective tissue diseases are highly important, as positive findings in these categories would likely denote a case of secondary NSIP. A multi-disciplinary discussion that includes pulmonologist(s), radiologist(s) and pathologist(s) assists in reaching a consensus diagnosis and improves diagnostic accuracy. Treatment of idiopathic NSIP, although not well proven, is generally instituted in the form of immunosuppression. Prognosis is favourable compared with idiopathic pulmonary fibrosis, although the diagnosis still carries an attributable mortality. Herein we will summarize the clinical characteristics and management of idiopathic NSIP.

  9. Current concepts and dilemmas in idiopathic interstitial pneumonias

    PubMed Central

    Ryu, Jay H.; Moua, Teng; Azadeh, Natalya; Baqir, Misbah; Yi, Eunhee S.


    Idiopathic interstitial pneumonias comprise approximately one-third of interstitial lung diseases (also called diffuse parenchymal infiltrative lung diseases). The classification of idiopathic interstitial pneumonias has undergone several revisions since the initial description of 40 years ago, and the most recent version was published in 2013. Although some aspects have been clarified, this group of heterogeneous disorders continues to be a source of confusion and misunderstanding in clinical applications. In this article, we explore several topical themes in the evaluation and management of patients with idiopathic interstitial pneumonias. PMID:27853529

  10. Diffuse persistent interstitial pulmonary emphysema treated by lobectomy.


    Matta, Reva; Matta, Judy; Hage, Pierre; Nassif, Yolla; Mansour, Nabil; Diab, Nabil


    Persistent interstitial pulmonary emphysema is a rare condition that occurs in preterm infants on mechanical ventilation, characterized by abnormal accumulation of air in the pulmonary interstitium, due to disruption of the basement membrane. Diffuse persistent interstitial pulmonary emphysema is observed when small cysts are noted in all lobes of the lung. The management of infants suffering from diffuse persistent interstitial pulmonary emphysema varies according to severity and stability of the patient, being either conservative treatment or aggressive surgical treatment by pneumonectomy. We report a case of an unstable patient with diffuse persistent interstitial pulmonary emphysema successfully treated by lobectomy as a form of conservative surgical approach.

  11. Migration of Di- and Tri-Interstitials in Silicon

    SciTech Connect

    Posselt, Matthias; Gao, Fei; Zwicker, D


    A comprehensive study on the migration of di- and tri-interstitials in silicon is performed using classical molecular dynamics simulations with the Stillinger-Weber potential. The initial di- and tri-interstitial configurations with the lowest formation energies are determined, and then, the defect migration is investigated for temperatures between 800 and 1600 K. The defect diffusivity and the self-diffusion coefficient per defect are calculated. Compared to the mono-interstitial, the di-interstitial migrates faster, whereas the tri-interstitial diffuses slower. The migration mechanism of the di-interstitial shows a pronounced dependence on the temperature. Like in the case of the mono-interstitial, the mobility of the di-interstitial is higher than the mobility of the lattice atoms during the defect diffusion. On the other hand, the tri-interstitial mobility is lower than the corresponding atomic mobility. The results are compared with data from the literature and the implications of the present results for the analysis of experimental data on defect evolution and migration are discussed.

  12. Defects involving interstitial boron in low-temperature irradiated silicon

    NASA Astrophysics Data System (ADS)

    Khirunenko, L. I.; Sosnin, M. G.; Duvanskii, A. V.; Abrosimov, N. V.; Riemann, H.


    Interstitial boron-related defects in silicon subjected to irradiation with 5 MeV electrons at a temperature of 80 K are investigated by Fourier-transform infrared absorption spectroscopy. This study demonstrates the radiation-enhanced annealing of interstitial boron during irradiation. We have revealed the interaction, which occurs in the course of irradiation, of diffusing interstitial boron atoms with one another and with interstitial oxygen. The local vibrational modes associated with these defects are identified, and the thermal stability of the defects is determined.

  13. Transplantation stimulates interstitial cell migration in hydra

    SciTech Connect

    Fujisawa, T.; David, C.N.; Bosch, T.C. )


    Migration of interstitial cells and nerve cell precursors was analyzed in Hydra magnipapillata and Hydra vulgaris (formerly Hydra attenuata). Axial grafts were made between ({sup 3}H)thymidine-labeled donor and unlabeled host tissue. Migration of labeled cells into the unlabeled half was followed for 4 days. The results indicate that the rate of migration was initially high and then slowed on Days 2-4. Regrafting fresh donor tissue on Days 2-4 maintained high levels of migration. Thus, migration appears to be stimulated by the grafting procedure itself.

  14. Collagen gene expression in radiation interstitial pneumonitis

    SciTech Connect

    Bai Yun-hong; Wang, De-wen; Cui Cai-bin


    By using type I and type III collagen cDNA probe and cDNA-mRNA in situ hybridization, we observed the changes of rat lung {alpha} 1(I) and {alpha} 1(III) collagen gene expression in radiation interstitial pneumonitis. The results showed that the expressed cell of type I and type III collagen were scattered within the fibroblasts in the thickened interalveolar walls. The type I and type III collagen mRNA content in irradiated animals were higher than those in the controls at 0.5, 1, 2, 3, 6, and 12 months. 10 refs., 4 figs., 1 tab.

  15. Interstitial hydraulic conductivity and interstitial fluid pressure for avascular or poorly vascularized tumors.


    Liu, L J; Schlesinger, M


    A correct description of the hydraulic conductivity is essential for determining the actual tumor interstitial fluid pressure (TIFP) distribution. Traditionally, it has been assumed that the hydraulic conductivities both in a tumor and normal tissue are constant, and that a tumor has a much larger interstitial hydraulic conductivity than normal tissue. The abrupt transition of the hydraulic conductivity at the tumor surface leads to non-physical results (the hydraulic conductivity and the slope of the TIFP are not continuous at tumor surface). For the sake of simplicity and the need to represent reality, we focus our analysis on avascular or poorly vascularized tumors, which have a necrosis that is mostly in the center and vascularization that is mostly on the periphery. We suggest that there is an intermediary region between the tumor surface and normal tissue. Through this region, the interstitium (including the structure and composition of solid components and interstitial fluid) transitions from tumor to normal tissue. This process also causes the hydraulic conductivity to do the same. We introduce a continuous variation of the hydraulic conductivity, and show that the interstitial hydraulic conductivity in the intermediary region should be monotonically increasing up to the value of hydraulic conductivity in the normal tissue in order for the model to correspond to the actual TIFP distribution. The value of the hydraulic conductivity at the tumor surface should be the lowest in value. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Development of a new heating needle for interstitial hyperthermia compatible with interstitial radiotherapy.


    Ikeda, H; Tanaka, M; Matsuo, R; Fukuda, H; Yamada, R; Yamamoto, I


    We have developed a new heating needle for interstitial hyperthermia compatible with brachytherapy. We studied the heating characteristics of interstitial needles and the usefulness of these needles for interstitial hyperthermia. As heating needles, we used MicroSelectron HDR interstitial needles. These needles were only heated at the metal tip, and were insulated in the middle and grounded from the top. The hyperthermia system was based on the principles of RF capacitive heating, and we used a Thermotron RF-8. We examined whether the temperature and the heating area could be elevated to a level required for hyperthermia. Good heating was obtained around the metal tip of the needle. The heating area of the longitudinal axis of the needle varied with the length of the metal part, while the transverse heating area of the needle was almost unchanged. If heating was performed while maintaining the elevation of temperature in each needle at the same level using variable coils (tuning box), heating was homogeneous over the regions in accordance with the arrangement of the needles. With this heating system, the temperature rises easily, and a uniform temperature distribution can be obtained.

  17. Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands--a controlled mesocosm experiment.


    Penha-Lopes, Gil; Bartolini, Fabrizio; Limbu, Samwel; Cannicci, Stefano; Mgaya, Yunus; Kristensen, Erik; Paula, José


    The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential.

  18. [Distribution of acetylcholinesterase activity in the digestive system of the gastropod molluscs Littorina littorea and Achatina fulica].


    Zaĭtseva, O V; Kuznetsova, T V


    With the use of the histochemical procedure for the demonstration of acetylcholinesterase (AchE) activity, the distribution cholinergic regulatory elements was studied in the esophagus, the pharynx, the stomach, the liver (the digestive gland) and the intestine in sea and terrestrial gastropod molluscs that differed in their general organization level, lifestyle, habitat and feeding type. In both molluscs, all the parts of the digestive tract contained the significant amount of intraepithelial AchE-positive cells of the open type, single subepithelial neurons and the nervous fibers localized among the muscle cells of the wall of the organs. The basal processes of the AchE-positive intraepithelial cells were shown to form the intraepithelial nerve plexus and to pass under the epithelium. The peculiarities and common principles in the distribution of the nervous elements detected, their possible function and the regulatory role in the digestion in gastropod molluscs and other animals are discussed.

  19. A new freshwater snail genus (Hydrobiidae, Gastropoda) from Montenegro, with a discussion on gastropod diversity and endemism in Skadar Lake

    PubMed Central

    Pešić, Vladimir; Glöer, Peter


    Abstract Karucia sublacustrina a new species of freshwater snails (Hydrobiidae, Gastropoda) is described based on material collected from Skadar Lake (Montenegro, Albania). The new species belongs to monotypic genus Karucia gen. n. The shell morphology and body shape of the new genus resembles Radomaniola Szarowska, 2006 and Grossuana Radoman, 1973, from which it differs in the larger shells with relatively slim and a slightly, but clearly shouldered body whorl. The number of gastropods from Skadar Lake basin tallies now 50 species. The adjusted rate of gastropod endemicity for Skadar Lake basin is estimated to be 38%. By compiling faunal and taxonomic data we also aim to provide information of relevance as to conservation efforts. PMID:23794834

  20. Interstitial Condensation Risk at Thermal Rehabilitated Buildings

    NASA Astrophysics Data System (ADS)

    Baran, I.; Bliuc, I.; Iacob, A.; Dumitrescu, L.; Pescaru, R. A.; Helepciuc, C.


    The increasing thermal insulation degree of existing residential buildings, aiming to reduce the energy requirements for ensuring the indoor comfort, has as expected effect the elimination of condensation risk. However, in some cases this phenomenon occurs, both on the inner surface of the closing element and also in its structure. The surface condensation causes can be identified and can be easily removed. Instead, the causes and even the presence of interstitial condensation are more difficult to be observed. But the moistening of the insulation materials and the reduction of thermal insulation capacity or even its total degradation, contravene into a large extent or totally to the main purpose of the additional thermal protection. To avoid such situations, it is necessary to respect some principles concerning the structure, resulted from the knowledge of the water vapour diffusion behaviour of various materials. It is known that condensation vulnerability is higher for the additional thermal protection solutions by disposing the insulating material on the inside surface of the closing element. But practice has shown that the condensation phenomenon is not totally excluded neither in the case of outside thermal insulation - which is the current solution applied to the rehabilitation works - if the principles mentioned above are not known and respected. In this paper two models are compared on which the risk of interstitial condensation can be checked. The analysis made on two structures of exterior walls with thermal insulation demonstrates the need for additional verifications before proposing a solution for thermal rehabilitation of the envelope elements.

  1. Interstitial Pulmonary Edema Following Bromocarbamide Intoxication

    PubMed Central

    Sugihara, H.; Hagedorn, M.; Bōttcher, D.; Neuhof, H.; Mittermayer, Ch.


    Bromocarbamides are sleep-inducing drugs which can lead, in man, to intoxication and death due to respiratory failure. To prove whether hemodynamic factors or the changed endothelial permeability induce pulmonary edema, animal experiments were performed. The fine structural changes in pulmonary edema in rabbits were observed at 60, 90 and 120 minutes after oral administration. The major findings were a) large blebs between capillary endothelium and alveolar epithelium and b) interstitial edema of the vessel wall. The bleb contents were much less electron dense than the blood contents in the capillary. Colloidal carbon did not enter the bleb or the edematous interstitial tissue. Exogenous peroxidase uptake in pinocytotie vesicles increased in pathologic cases. The hemodynamic measurements in animal receiving artificial respiration which maintained the blood pO2 at a steady state showed similar blebs in the pulmonary vessels, indicating that anoxia is not the major cause of the vascular lesion. Moreover, pulmonary arterial pressure and pulmonary vascular resistance could be held in the normal range in artificially respirated animals under bromocarbamide intoxication. Thus, hemodynamic factors are not likely to play a pathogenetic role in bringing about pulmonary edema. The chief, early factor is the increased endothelial permeability due to increased cytoplasmic transport. From this a practical suggestion for treating patients with bromocarbamide intoxication is derived: the usual fluid replacement in shock patients should be handled with great care to avoid fluid overload of the lung. ImagesFig 1Fig 2Fig 3Fig 4Fig 5Fig 6 PMID:4835993

  2. Interstitial Fe in MgO

    SciTech Connect

    Mølholt, T. E. Gislason, H. P.; Ólafsson, S.; Mantovan, R.; Gunnlaugsson, H. P.; Svane, A.; Weyer, G.; Masenda, H.; Naidoo, D.; Bharuth-Ram, K.; Fanciulli, M.; Johnston, K.; Sielemann, R.


    Isolated {sup 57}Fe atoms were studied in MgO single-crystals by emission Mössbauer spectroscopy following implantation of {sup 57}Mn decaying to {sup 57}Fe. Four Mössbauer spectral components were found corresponding to different Fe lattice positions and/or charge states. Two components represent Fe atoms substituting Mg as Fe{sup 2+} and Fe{sup 3+}, respectively; a third component is due to Fe in a strongly implantation-induced disturbed region. The fourth component, which is the focus of this paper, can be assigned to Fe at an interstitial site. Comparison of its measured isomer shift with ab initio calculations suggests that the interstitial Fe is located on, or close to, the face of the rock-salt MgO structure. To harmonize such an assignment with the measured near-zero quadrupole interaction a local motion process (cage motion) of the Fe has to be stipulated. The relation of such a local motion as a starting point for long range diffusion is discussed.

  3. Respiratory bronchiolitis-interstitial lung disease.


    Sieminska, Alicja; Kuziemski, Krzysztof


    Respiratory bronchiolitis-associated interstitial lung disease (RB-ILD) is a rare, mild inflammatory pulmonary disorder that occurs almost exclusively in current or former heavy smokers, usually between the third and sixth decades, most likely with no gender predilection. The onset is usually insidious with exertional dyspnea and persistent cough, which may be non-productive, developing over a course of weeks or months. RB-ILD may also be diagnosed in asymptomatic patients with functional impairment and chest radiograph or high-resolution computed tomography (HRCT) abnormalities. Histologically, RB-ILD is characterized by the accumulation of yellow-brown pigmented macrophages within the lumens of respiratory bronchioles and alveolar ducts, associated with a patchy submucosal and peribronchiolar chronic inflammation. Common findings also include mild bronchiolar and peribronchiolar alveolar fibrosis that expands contiguous alveolar septa and leads to architectural distortion as well as centrilobular emphysema. Chest radiographs in patients with RB-ILD typically show fine reticulonodular interstitial opacities, while on HRCT central and peripheral bronchial wall thickening, centrilobular nodules, and ground-glass opacities associated with upper lobe centrilobular emphysema are most frequently reported. Pulmonary function testing may be normal but usually demonstrates mixed, predominantly obstructive abnormalities, often combined with hyperinflation and usually associated with a mild to moderate reduction in carbon monoxide diffusion capacity (DLco). The course of RB-ILD is heterogeneous. Some patients respond favorably to corticosteroids and/or smoking cessation, but often there is no functional improvement and the disease progresses despite smoking cessation and treatment.

  4. Interstitial embrittlement in vanadium laser welds

    SciTech Connect

    Strum, M.J.; Wagner, L.M.


    Efficiencies of interstitial absorption during pulsed ND:YAG laser welding of vanadium were compared for nitrogen, oxygen, hydrogen, and water vapor. Influence of interstitial levels on the embrittlement of vanadium laser welds was also measured. For 1000 ppM contaminant levels in the weld atmosphere, weld hydrogen content increased 9 ppM, nitrogen content increased 190 ppM, and oxygen content increased from 500 ppM relative to baseplate levels. Welds in ultrahigh-purity argon atmospheres contained 3 ppM hydrogen, 40 ppM nitrogen, and 250 ppM oxygen. Longitudinal all-weld tensile specimens and notched-plate specimens were used to measure weld metal tensile properties at [minus]55C. All of the laser weld notch-strength ratios exceeded unity and weld metal tensile strengths all exceeded the baseplate values. For 1000 ppM atmosphere contaminant levels, the only significant decrease in ductility, as measured by reduction-in-area at fracture was for the weld atmosphere containing oxygen. Weld atmospheres containing 1% nitrogen also reduced the weld ductility, and resulted in the onset of cleavage fracture.

  5. Interstitial embrittlement in vanadium laser welds

    SciTech Connect

    Strum, M.J.; Wagner, L.M.


    Efficiencies of interstitial absorption during pulsed ND:YAG laser welding of vanadium were compared for nitrogen, oxygen, hydrogen, and water vapor. Influence of interstitial levels on the embrittlement of vanadium laser welds was also measured. For 1000 ppM contaminant levels in the weld atmosphere, weld hydrogen content increased 9 ppM, nitrogen content increased 190 ppM, and oxygen content increased from 500 ppM relative to baseplate levels. Welds in ultrahigh-purity argon atmospheres contained 3 ppM hydrogen, 40 ppM nitrogen, and 250 ppM oxygen. Longitudinal all-weld tensile specimens and notched-plate specimens were used to measure weld metal tensile properties at {minus}55C. All of the laser weld notch-strength ratios exceeded unity and weld metal tensile strengths all exceeded the baseplate values. For 1000 ppM atmosphere contaminant levels, the only significant decrease in ductility, as measured by reduction-in-area at fracture was for the weld atmosphere containing oxygen. Weld atmospheres containing 1% nitrogen also reduced the weld ductility, and resulted in the onset of cleavage fracture.

  6. Interstitial therapy of perineal and gynecological malignancies.


    Martinez, A; Herstein, P; Portnuff, J


    Thirty-five patients, 38 to 88 years of age, were treated with 125-Iodine or 192-Iridium interstitial implants at Stanford University Medical Center between July 1974, and December, 1978. There were 25 primary epithelial malignancies, eight extensions from intrapelvic organs and two metastatic tumors (hypernephroma and Hodgkin's disease). The involved sites were: urethra (6 patients); vulva (9 patients); vagina (8 patients); anus (7 patients); cervix (5 patients). Implantation was usually performed to treat evident or microscopic disease in conjunction with external beam pelvic treatment with or without local excision. Computerized implant preplanning was used. 125-Iodine seeds were inserted either directly or within absorbable suture Polyglactin 910; 192-Iridium in nylon carriers was placed by suture or transperineal template. Two patients were lost to follow-up leaving 33 patients, 27 of whom are alive and free of local disease from 37 to 76 months. The overall local control rate was 88%, or 29/33 patients. All four local recurrences appeared before 24 months. Minor complications included: 10 patients with transient mucositis, four with superficial ulcers, and one patient with infection at the implanted site. Two major complications occurred: a necrotic rectal ulcer requiring a colostomy and a contracted, painful bladder necessitating a urinary diversion. We conclude that in selected cases interstitial irradiation provides good local control of perineal and gynecological malignancies with low morbidity in this elderly and quite often fragile group of patients.

  7. Tissue temperature monitoring during interstitial photodynamic therapy

    NASA Astrophysics Data System (ADS)

    Svensson, Jenny; Johansson, Ann; Svanberg, Katarina; Andersson-Engels, Stefan


    During δ-aminolevulinic acid (ALA) based Interstitial Photodynamic Therapy (IPDT) a high light fluence rate is present close to the source fibers. This might induce an unintentional tissue temperature increase of importance for the treatment outcome. In a previous study, we have observed, that the absorption in the tissue increases during the treatment. A system to measure the local tissue temperature at the source fibers during IPDT on tissue phantoms is presented. The temperature was measured by acquiring the fluorescence from small Cr3+-doped crystals attached to the tip of the illumination fiber used in an IPDT-system. The fluorescence of the Alexandrite crystal used is temperature dependent. A ratio of the intensity of the fluorescence was formed between two different wavelength bands in the red region. The system was calibrated by immersing the fibers in an Intralipid solution placed in a temperature controlled oven. Measurements were then performed by placing the fibers interstitially in a pork chop as a tissue phantom. Measurements were also performed superficially on skin on a volunteer. A treatment was conducted for 10 minutes, and the fluorescence was measured each minute during the illumination. The fluorescence yielded the temperature at the fiber tip through the calibration curve. The measurements indicate a temperature increase of a few degrees during the simulated treatment.

  8. [Acute interstitial nephritis induced by loratadine].


    Alvarez Navascués, R; Bastardo, Z; Fernández Díaz, M; Guerediaga, J; Quiñones, L; Pinto, J


    Loratadine is a second generation histamine H1 receptor antagonist, that has high potency antiallergic properties and is associated with low adverse effects compared with other antihistamines. Acute interstitial nephritis is a cause of acute renal failure that is most often induced by drugs or, less frequently, infection or sarcoidosis. Although the number of drugs associated with acute intersticial nephritis is too large, the antihistaminic loratadine have never been reported before. We report a case of an interstitial nephritis with acute renal failure that suggesting hypersensitivity reaction in a 77 old man who had received loratadine (10 mg/day) during ten days before his assessment to our hospital by disseminated pruritic syndrome. The initial suspect was rapidly progressive glomerulonephitis and renal biopsy was practice and treatment with corticosteroids were initiated (prednisone bolus of 500 mg three days and 1 mg/kg/day/later). The loratadine therapy was cessation. He exhibiting a slow and progressive improvement on renal function and one month later, urea and creatinine levels was normal and hematuria and proteinuria had disappeared. The corticosteroids therapy were progressive decreased until withdrawal. We think that this is an interesting case, basing in its clinical presentation and that it had never been reported before.

  9. Respiratory bronchiolitis-interstitial lung disease

    PubMed Central


    Respiratory bronchiolitis-associated interstitial lung disease (RB-ILD) is a rare, mild inflammatory pulmonary disorder that occurs almost exclusively in current or former heavy smokers, usually between the third and sixth decades, most likely with no gender predilection. The onset is usually insidious with exertional dyspnea and persistent cough, which may be non-productive, developing over a course of weeks or months. RB-ILD may also be diagnosed in asymptomatic patients with functional impairment and chest radiograph or high-resolution computed tomography (HRCT) abnormalities. Histologically, RB-ILD is characterized by the accumulation of yellow-brown pigmented macrophages within the lumens of respiratory bronchioles and alveolar ducts, associated with a patchy submucosal and peribronchiolar chronic inflammation. Common findings also include mild bronchiolar and peribronchiolar alveolar fibrosis that expands contiguous alveolar septa and leads to architectural distortion as well as centrilobular emphysema. Chest radiographs in patients with RB-ILD typically show fine reticulonodular interstitial opacities, while on HRCT central and peripheral bronchial wall thickening, centrilobular nodules, and ground-glass opacities associated with upper lobe centrilobular emphysema are most frequently reported. Pulmonary function testing may be normal but usually demonstrates mixed, predominantly obstructive abnormalities, often combined with hyperinflation and usually associated with a mild to moderate reduction in carbon monoxide diffusion capacity (DLco). The course of RB-ILD is heterogeneous. Some patients respond favorably to corticosteroids and/or smoking cessation, but often there is no functional improvement and the disease progresses despite smoking cessation and treatment. PMID:25011486

  10. Deriving sediment Interstitial Water Remediation Goals ...

    EPA Pesticide Factsheets

    Background/Objectives. Passive sampling is becoming a frequently used measurement technique at Superfund sites with contaminated sediments. Passive sampling measures the concentrations of freely dissolved chemicals (Cfrees) in the sediment interstitial water. The freely dissolved chemical is a good surrogate for and a very practical means for estimating the concentrations of bioavailable chemical in the sediments. Building from this approach, a methodology is proposed to derive sediment Interstitial Water Remediation Goals (IWRGs) for the protection of benthic organisms from direct toxicity using Cfrees measured with passive sampling.Approach/Activities. In the early 2000s, EPA developed and released Equilibrium Partitioning Sediment Benchmarks (ESBs) for a series of chemicals. ESBs are intended to be chemical concentrations below which unacceptable toxicity to benthic organisms does not occur. The ESBs (expressed with the units of ug/g OC) were derived using the equations:ESB= K_OC×FCV where K_OC=0.00028+0.983K_OWThe KOC is the organic carbon normalized sediment-water chemical partition coefficient, FCV is the Final Chronic Value from EPA’s ambient water quality criteria for the protection of aquatic life, and KOW is the n-octanol/water partition coefficient for the chemical. At a specific site, the remedial goal (CS:ESB µg/kg-dw) in sediment are then derived using the site-specific fraction of organic carbon in the sediment (fOC:SS) at the site:C_

  11. Deriving sediment Interstitial Water Remediation Goals ...

    EPA Pesticide Factsheets

    Background/Objectives. Passive sampling is becoming a frequently used measurement technique at Superfund sites with contaminated sediments. Passive sampling measures the concentrations of freely dissolved chemicals (Cfrees) in the sediment interstitial water. The freely dissolved chemical is a good surrogate for and a very practical means for estimating the concentrations of bioavailable chemical in the sediments. Building from this approach, a methodology is proposed to derive sediment Interstitial Water Remediation Goals (IWRGs) for the protection of benthic organisms from direct toxicity using Cfrees measured with passive sampling.Approach/Activities. In the early 2000s, EPA developed and released Equilibrium Partitioning Sediment Benchmarks (ESBs) for a series of chemicals. ESBs are intended to be chemical concentrations below which unacceptable toxicity to benthic organisms does not occur. The ESBs (expressed with the units of ug/g OC) were derived using the equations:ESB= K_OC×FCV where K_OC=0.00028+0.983K_OWThe KOC is the organic carbon normalized sediment-water chemical partition coefficient, FCV is the Final Chronic Value from EPA’s ambient water quality criteria for the protection of aquatic life, and KOW is the n-octanol/water partition coefficient for the chemical. At a specific site, the remedial goal (CS:ESB µg/kg-dw) in sediment are then derived using the site-specific fraction of organic carbon in the sediment (fOC:SS) at the site:C_

  12. Intravesical liposome therapy for interstitial cystitis.


    Tyagi, Pradeep; Kashyap, Mahendra; Majima, Tsuyoshi; Kawamorita, Naoki; Yoshizawa, Tsuyoshi; Yoshimura, Naoki


    Over the past two decades, there has been lot of interest in the use of liposomes as lipid-based biocompatible carriers for drugs administered by the intravesical route. The lipidic bilayer structure of liposomes facilitates their adherence to the apical membrane surface of luminal cells in the bladder, and their vesicular shape allows them to co-opt the endocytosis machinery for bladder uptake after instillation. Liposomes have been shown to enhance the penetration of both water-soluble and insoluble drugs, toxins, and oligonucleotides across the bladder epithelium. Empty liposomes composed entirely of the endogenous phospholipid, sphingomyelin, could counter mucosal inflammation and promote wound healing in patients suffering from interstitial cystitis. Recent clinical studies have tested multilamellar liposomes composed entirely of sphingomyelin as a novel intravesical therapy for interstitial cystitis. In addition, liposomes have been used as a delivery platform for the instillation of botulinum toxin in overactive bladder patients. The present review discusses the properties of liposomes that are important for their intrinsic therapeutic effect, summarizes the recently completed clinical studies with intravesical liposomes and covers the latest developments in this field. © 2017 The Japanese Urological Association.

  13. Interstitial lung diseases in the hospitalized patient.


    Disayabutr, Supparerk; Calfee, Carolyn S; Collard, Harold R; Wolters, Paul J


    Interstitial lung diseases (ILDs) are disorders of the lung parenchyma. The pathogenesis, clinical manifestations, and prognosis of ILDs vary depending on the underlying disease. The onset of most ILDs is insidious, but they may also present subacutely or require hospitalization for management. ILDs that may present subacutely include acute interstitial pneumonia, connective tissue disease-associated ILDs, cryptogenic organizing pneumonia, acute eosinophilic pneumonia, drug-induced ILDs, and acute exacerbation of idiopathic pulmonary fibrosis. Prognosis and response to therapy depend on the type of underlying ILD being managed. This opinion piece discusses approaches to differentiating ILDs in the hospitalized patient, emphasizing the role of bronchoscopy and surgical lung biopsy. We then consider pharmacologic treatments and the use of mechanical ventilation in hospitalized patients with ILD. Finally, lung transplantation and palliative care as treatment modalities are considered. The diagnosis of ILD in hospitalized patients requires input from multiple disciplines. The prognosis of ILDs presenting acutely vary depending on the underlying ILD. Patients with advanced ILD or acute exacerbation of idiopathic pulmonary fibrosis have poor outcomes. The mainstay treatment in these patients is supportive care, and mechanical ventilation should only be used in these patients as a bridge to lung transplantation.

  14. Fire performance of interstitial space construction system

    NASA Astrophysics Data System (ADS)

    Lawson, J. R.


    Two unique walk-on deck construction systems were exposed to the standard NFPA 251 time-temperature fire exposure in order to evaluate their fire performance. A large scale steel structure was used in the test program to simulate construction systems found in the field. The structure consisted of two large functional floors separate by an interstitial space in which a walk-on deck system was constructed from light-weight concrete, and the second was built with poured gypsum. Three complete two hour fire tests were conducted along with one shorter test. Critical areas evaluated were the top functional floor, unprotected steel work in the interstitial space, response of the walk-on deck systems, and protection for a heavy steel column located in the center of each test bay. Test data were compared with the fire endurance test requirements of NFPA 251. Computer predictions were also made using the FIRES-08 model to determine its ability to accurately predict the construction systems performance.

  15. Morphological and behavioral differences in the gastropod Trophon geversianus associated to distinct environmental conditions, as revealed by a multidisciplinary approach

    NASA Astrophysics Data System (ADS)

    Márquez, Federico; Nieto Vilela, Rocío Aimé; Lozada, Mariana; Bigatti, Gregorio


    The gastropod Trophon geversianus exhibits shell polymorphisms along its distribution in subtidal and intertidal habitats. Our hypothesis is that morphological and behavioral patterns of T. geversianus represent habitat-specific constrains; subsequently we expect an association between shell morphology, attachment behavior, and habitat. In order to test this hypothesis we compared individuals from intertidal and subtidal habitats, at three sites in Golfo Nuevo (Argentina). We analyzed shell morphology using classic morphometric variables, 3D geometric morphometrics and computing tomography scan. The results were complemented with field observations of attachment to substrate and turning time behavior, as well as of the number of shell scars produced by crab predation. Our results showed differences in shell size and shape between intertidal and subtidal-collected individuals. Centroid size, total weight and shell weight, as well as shell density and thickness were significantly lower in intertidal individuals than in subtidal ones. Gastropods from intertidal habitats presented a low-spired shell and an expanded aperture which might allow better attachment to the bottom substrate, while subtidal individuals presented a slender and narrower shell shape. The number of crab scars was significantly higher in shells from subtidal individuals. Observations of the behavior of gastropods placed at the intertidal splash zone showed 100% of attachment to the bottom in the intertidal individuals, while subtidal specimens only attached in average in 32% of the cases. These latter took 12 times longer to re-attach to the bottom when faced up. Phylogenetic analysis of COI gene fragments showed no consistent differences among individuals sampled in both habitats. All these results suggest that T. geversianus has developed two ecomorphs with distinct morphological and behavioral responses to physically stressful conditions registered in north Patagonian intertidals, as opposed to

  16. Population structure of an invasive parthenogenetic gastropod in coastal lakes and estuaries of northern KwaZulu-Natal, South Africa.


    Miranda, Nelson A F; Perissinotto, Renzo; Appleton, Christopher C


    Estuaries and coastal lakes receive little attention despite being heavily invaded by non-indigenous invasive species (NIS). In these situations, studies of population dynamics in invaded habitats can provide valuable insights into how NIS interact with new environments. Tarebia granifera is a prosobranch gastropod from south-east Asia which has invaded other sub-tropical parts of the world. This study addresses whether a small number of key environmental factors influences gastropod communities, and specifically how the population density and size structure of T. granifera were influenced by environmental change in estuaries and coastal lakes in southern Africa. T. granifera's density, number of brooded juveniles and size structure were measured at the St. Lucia Estuary, Mgobozeleni Estuary, Lake Sibaya and Lake Nhlange. Size structure was classified according to shell height (SH). All dissected individuals were found to be female and free from trematode infection. Salinity, water depth, temperature, and pH were the main factors correlated with population density of gastropod communities. T. granifera often reached densities well over 1000 ind. m(-2), displacing indigenous gastropods and becoming a dominant component of the benthic community. T. granifera successfully invaded estuaries despite frequent exposure to high salinity and desiccation, which could together eliminate >97% of the population. The persistence of T. granifera was ensured due to its high fecundity and the environmental tolerance of large adults (20-30 mm SH) which carried an average of 158±12.8 SD brooded juveniles. Repeat introductions were not essential for the success of this parthenogenetic NIS. There is a need for a broader study on the reproductive biology of T. granifera (including the previously overlooked "brood pouch ecology"), which affects population dynamics and may be relevant to other parthenogenetic NIS, such as Melanoides tuberculata and Potamopyrgus antipodarum.

  17. Population Structure of an Invasive Parthenogenetic Gastropod in Coastal Lakes and Estuaries of Northern KwaZulu-Natal, South Africa

    PubMed Central

    Miranda, Nelson A. F.; Perissinotto, Renzo; Appleton, Christopher C.


    Background Estuaries and coastal lakes receive little attention despite being heavily invaded by non-indigenous invasive species (NIS). In these situations, studies of population dynamics in invaded habitats can provide valuable insights into how NIS interact with new environments. Tarebia granifera is a prosobranch gastropod from south-east Asia which has invaded other sub-tropical parts of the world. This study addresses whether a small number of key environmental factors influences gastropod communities, and specifically how the population density and size structure of T. granifera were influenced by environmental change in estuaries and coastal lakes in southern Africa. Methodology/Principal Findings T. granifera's density, number of brooded juveniles and size structure were measured at the St. Lucia Estuary, Mgobozeleni Estuary, Lake Sibaya and Lake Nhlange. Size structure was classified according to shell height (SH). All dissected individuals were found to be female and free from trematode infection. Salinity, water depth, temperature, and pH were the main factors correlated with population density of gastropod communities. T. granifera often reached densities well over 1000 ind. m−2, displacing indigenous gastropods and becoming a dominant component of the benthic community. T. granifera successfully invaded estuaries despite frequent exposure to high salinity and desiccation, which could together eliminate >97% of the population. The persistence of T. granifera was ensured due to its high fecundity and the environmental tolerance of large adults (20–30 mm SH) which carried an average of 158±12.8 SD brooded juveniles. Repeat introductions were not essential for the success of this parthenogenetic NIS. Conclusion/Significance There is a need for a broader study on the reproductive biology of T. granifera (including the previously overlooked “brood pouch ecology”), which affects population dynamics and may be relevant to other parthenogenetic NIS

  18. The Mitochondrial Genomes of the Nudibranch Mollusks, Melibe leonina and Tritonia diomedea, and Their Impact on Gastropod Phylogeny

    PubMed Central

    Sevigny, Joseph L.; Kirouac, Lauren E.; Thomas, William Kelley; Ramsdell, Jordan S.; Lawlor, Kayla E.; Sharifi, Osman; Grewal, Simarvir; Baysdorfer, Christopher; Curr, Kenneth; Naimie, Amanda A.; Okamoto, Kazufusa; Murray, James A.; Newcomb, James M.


    The phylogenetic relationships among certain groups of gastropods have remained unresolved in recent studies, especially in the diverse subclass Opisthobranchia, where nudibranchs have been poorly represented. Here we present the complete mitochondrial genomes of Melibe leonina and Tritonia diomedea (more recently named T. tetraquetra), two nudibranchs from the unrepresented Cladobranchia group, and report on the resulting phylogenetic analyses. Both genomes coded for the typical thirteen protein-coding genes, twenty-two transfer RNAs, and two ribosomal RNAs seen in other species. The twelve-nucleotide deletion previously reported for the cytochrome oxidase 1 gene in several other Melibe species was further clarified as three separate deletion events. These deletions were not present in any opisthobranchs examined in our study, including the newly sequenced M. leonina or T. diomedea, suggesting that these previously reported deletions may represent more recently divergent taxa. Analysis of the secondary structures for all twenty-two tRNAs of both M. leonina and T. diomedea indicated truncated d arms for the two serine tRNAs, as seen in some other heterobranchs. In addition, the serine 1 tRNA in T. diomedea contained an anticodon not yet reported in any other gastropod. For phylogenetic analysis, we used the thirteen protein-coding genes from the mitochondrial genomes of M. leonina, T. diomedea, and seventy-one other gastropods. Phylogenetic analyses were performed for both the class Gastropoda and the subclass Opisthobranchia. Both Bayesian and maximum likelihood analyses resulted in similar tree topologies. In the Opisthobranchia, the five orders represented in our study were monophyletic (Anaspidea, Cephalaspidea, Notaspidea, Nudibranchia, Sacoglossa). In Gastropoda, two of the three traditional subclasses, Opisthobranchia and Pulmonata, were not monophyletic. In contrast, four of the more recently named gastropod clades (Vetigastropoda, Neritimorpha

  19. Diverse Gastropod Hosts of Angiostrongylus cantonensis, the Rat Lungworm, Globally and with a Focus on the Hawaiian Islands

    PubMed Central

    Kim, Jaynee R.; Hayes, Kenneth A.; Yeung, Norine W.; Cowie, Robert H.


    Eosinophilic meningitis caused by the parasitic nematode Angiostrongylus cantonensis is an emerging infectious disease with recent outbreaks primarily in tropical and subtropical locations around the world, including Hawaii. Humans contract the disease primarily through ingestion of infected gastropods, the intermediate hosts of Angiostrongylus cantonensis. Effective prevention of the disease and control of the spread of the parasite require a thorough understanding of the parasite's hosts, including their distributions, as well as the human and environmental factors that contribute to transmission. The aim of this study was to screen a large cross section of gastropod species throughout the main Hawaiian Islands to determine which act as hosts of Angiostrongylus cantonensis and to assess the parasite loads in these species. Molecular screening of 7 native and 30 non-native gastropod species revealed the presence of the parasite in 16 species (2 native, 14 non-native). Four of the species tested are newly recorded hosts, two species introduced to Hawaii (Oxychilus alliarius, Cyclotropis sp.) and two native species (Philonesia sp., Tornatellides sp.). Those species testing positive were from a wide diversity of heterobranch taxa as well as two distantly related caenogastropod taxa. Review of the global literature showed that many gastropod species from 34 additional families can also act as hosts. There was a wide range of parasite loads among and within species, with an estimated maximum of 2.8 million larvae in one individual of Laevicaulis alte. This knowledge of the intermediate host range of Angiostrongylus cantonensis and the range of parasite loads will permit more focused efforts to detect, monitor and control the most important hosts, thereby improving disease prevention in Hawaii as well as globally. PMID:24788772

  20. Gastropod growth and survival as bioindicators of stress associated with high nutrients in the intertidal of a shallow temperate estuary

    NASA Astrophysics Data System (ADS)

    Marsden, Islay D.; Baharuddin, Nursalwa


    The effects of multiple stressors on estuarine organisms are not well understood. Using cage experiments we measured the survival and growth of the pulmonate gastropod Amphibola crenata at five locations which differed contaminant levels. Water nutrients came from a nearby sewage treatment works and the sediment contained low levels of trace metals. Over 6 weeks of exposure, sediment surface chlorophyll levels varied amongst locations. The Chl a values were positively correlated with sediment N and P and trace metals As, Cd, Cu, Pb and Zn. Pulmonate survival depended on location, highest mortality was from a site close to the treatment plant and mortality rate of large individuals decreased significantly with distance away from it. For four locations, medium A. crenata had higher survival than small (juveniles) or adults. Growth rates of small individuals exceeded those for medium and large A. crenata. The mean length increment/week for medium gastropods ranged between 0.49 and 1.11 mm and was negatively correlated with the amount of Chl a in the surface sediment, suggesting the negative effects of eutrophication on gastropod growth. Growth rate of the pulmonate was not correlated with nutrient concentration or trace metal concentrations in the sediment. The dry weight condition index (CI) did not correlate with the growth rate, and for medium individuals, was unaffected by any of the environmental variables. The CI of small individuals was negatively affected by increasing water nutrient levels and the CI of large individuals negatively affected by increasing sediment nutrients and trace metal concentrations. The results from this study suggest that gastropod growth and survival could be used as tools to monitor the effects of changing nutrient levels and recovery from eutrophication within temperate estuaries.

  1. eSnail: a transcriptome-based molecular resource of the central nervous system for terrestrial gastropods.


    Zhao, Min; Wang, Tianfang; Stewart, Michael J; Bose, Utpal; Suwansa-Ard, Saowaros; Storey, Kenneth B; Cummins, Scott F


    To expand on emerging terrestrial gastropod molecular resources, we have undertaken transcriptome-based sequencing of the central nervous system (CNS) from six ecologically invasive terrestrial gastropods. Focusing on snail species Cochlicella acuta and Helix aspersa, and reticulated slugs Deroceras invadens, Deroceras reticulatum, Lehmannia nyctelia, and Milax gagates, we obtained a total of 367,869,636 high quality reads and compared them with existing CNS transcript resources for the invasive Mediterranean snail, Theba pisana. In total we obtained, 419,289 unique transcripts (unigenes) from 1,410,569 assembled contigs, with BLAST search analysis of multiple protein databases leading to the annotation of 124,268 unigenes, of which 92,544 mapped to NCBI non-redundant protein databases. We found that these transcriptomes have representatives in most biological functions, based on comparison of gene ontology, KEGG pathway, and protein family contents, demonstrating a high range of transcripts responsible for regulating metabolic activities and molecular functions occurring within the CNS. To provide an accessible genetic resource, we also demonstrate the presence of 66,687 microsatellites and 304,693 single nucleotide variants, which can be used for the design of potentially thousands of unique primers for functional screening. An online 'eSnail' database with a user-friendly web interface was implemented to query all the information obtained herein ( We demonstrate the usefulness of the database through the mining of molluscan neuropeptides. As the most comprehensive CNS transcriptome resource for terrestrial gastropods, eSnail may serve as a useful gateway for researchers to explore gastropod CNS function for multiple purposes, including for the development of biocontrol approaches. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  2. A cellular and metabolic assessment of the thermal stress responses in the endemic gastropod Benedictia limnaeoides ongurensis from Lake Baikal.


    Axenov-Gribanov, Denis V; Bedulina, Daria S; Shatilina, Zhanna M; Lubyaga, Yulia A; Vereshchagina, Kseniya P; Timofeyev, Maxim A


    Our objective was to determine if the Lake Baikal endemic gastropod Benedictia limnaeoides ongurensis, which inhabits in stable cold waters expresses a thermal stress response. We hypothesized that the evolution of this species in the stable cold waters of Lake Baikal resulted in a reduction of its thermal stress-response mechanisms at the biochemical and cellular levels. Contrary to our hypothesis, our results show that exposure to a thermal challenge activates the cellular and biochemical mechanisms of thermal resistance, such as heat shock proteins and antioxidative enzymes, and alters energetic metabolism in B. limnaeoides ongurensis. Thermal stress caused the elevation of heat shock protein 70 and the products of anaerobic glycolysis together with the depletion of glucose and phosphagens in the studied species. Thus, a temperature increase activates the complex biochemical system of stress response and alters the energetic metabolism in this endemic Baikal gastropod. It is concluded that the deepwater Lake Baikal endemic gastropod B. limnaeoides ongurensis retains the ability to activate well-developed biochemical stress-response mechanisms when exposed to a thermal challenge. © 2013.

  3. Effects of ocean acidification on the shells of four Mediterranean gastropod species near a CO2 seep.


    Duquette, Ashley; McClintock, James B; Amsler, Charles D; Pérez-Huerta, Alberto; Milazzo, Marco; Hall-Spencer, Jason M


    Marine CO2 seeps allow the study of the long-term effects of elevated pCO2 (ocean acidification) on marine invertebrate biomineralization. We investigated the effects of ocean acidification on shell composition and structure in four ecologically important species of Mediterranean gastropods (two limpets, a top-shell snail, and a whelk). Individuals were sampled from three sites near a volcanic CO2 seep off Vulcano Island, Italy. The three sites represented ambient (8.15pH), moderate (8.03pH) and low (7.73pH) seawater mean pH. Shell mineralogy, microstructure, and mechanical strength were examined in all four species. We found that the calcite/aragonite ratio could vary and increased significantly with reduced pH in shells of one of the two limpet species. Moreover, each of the four gastropods displayed reductions in either inner shell toughness or elasticity at the Low pH site. These results suggest that near-future ocean acidification could alter shell biomineralization and structure in these common gastropods. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. [Community structure of bivalves and gastropods in roots of red mangrove Rhizophora mangle (Rhizophoraceae) in isla Larga, Mochima Bay, Venezuela].


    Acosta Balbas, Vanessa; Betancourt Tineo, Rafael; Prieto Arcas, Antulio


    The Rhizophora mangle roots form a complex ecosystem where a wide range of organisms are permanently established, reproduce, and find refuge. In this study, we assessed the diversity of bivalves and gastropods that inhabit red mangrove roots, in isla Larga, Mochima, Venezuela Sucre state. Bimonthly collections were made from January 2007 to May 2008, in four study areas denominated: South, North, East and West. In each area, five mangrove roots were sampled, and the specimens were obtained. We analyzed a total of 180 roots and a total of 35 bivalve species and 25 gastropod species were found. The most abundant bivalves were: Isognomon alatus, Isognomon bicolor, Ostrea equestris, Crassostrea rhizophorae and Brachidontes exustus; among gastropods, the most common where: Littorina angulifera, (Cymatium pileare and Diodora cayenensis. The months with the highest abundances and number of individuals for both groups were January and July 2007, and March 2008. The mangrove ecosystem in isla Larga, presented a number of individuals and species higher than those reported for other regions in Venezuela and the Caribbean.

  5. Genotoxicity of cadmium chloride in the marine gastropod Nerita chamaeleon using comet assay and alkaline unwinding assay.


    Sarkar, Anupam; Bhagat, Jacky; Ingole, Baban S; Rao, Durga P; Markad, Vijaykumar L


    This paper presents an evaluation of the genotoxic effects of cadmium chloride (CdCl2 ) on marine gastropod, Nerita chamaeleon following the technique of comet assay and the DNA alkaline unwinding assay (DAUA). In this study, the extent of DNA damage in gill cells of N. chamaeleon was measured after in vivo exposure to four different concentrations (10, 25, 50, and 75 µg/L) of CdCl2 . In vitro exposure of hydrogen peroxide (H2 O2 ; 1, 10, 25, and 50 µM) of the gill cells showed a significant increase in the percentage tail DNA, Olive tail moment, and tail length (TL). Significant changes in percentage tail DNA by CdCl2 exposure were observed in all exposed groups of snails with respect to those in control. Exposure to 75 µg/L of CdCl2 produced significant decrease in DNA integrity as measured by DAUA at all duration with respect to control. In vivo exposure to different concentrations of CdCl2 (10, 25, 50, and 75 µg/L) to N. chamaeleon showed considerable increase in DNA damage as observed by both alkaline comet assay and the DAUA. The extent of DNA damage in marine gastropods determined by the application of alkaline comet assay and DAUA clearly indicated the genotoxic responses of marine gastropod, N. chamaeleon to a wide range of cadmium concentration in the marine environment.

  6. Left-right asymmetric expression of dpp in the mantle of gastropods correlates with asymmetric shell coiling

    PubMed Central


    Background Various shapes of gastropod shells have evolved ever since the Cambrian. Although theoretical analyses of morphogenesis exist, the molecular basis of shell development remains unclear. We compared expression patterns of the decapentaplegic (dpp) gene in the shell gland and mantle tissues at various developmental stages between coiled-shell and non-coiled-shell gastropods. Results We analyzed the expression patterns of dpp for the two limpets Patella vulgata and Nipponacmea fuscoviridis, and for the dextral wild-type and sinistral mutant lineage of the pond snail Lymnaea stagnalis. The limpets had symmetric expression patterns of dpp throughout ontogeny, whereas in the pond snail, the results indicated asymmetric and mirror image patterns between the dextral and sinistral lineages. Conclusion We hypothesize that Dpp induces mantle expansion, and the presence of a left/right asymmetric gradient of the Dpp protein causes the formation of a coiled shell. Our results provide a molecular explanation for shell, coiling including new insights into expression patterns in post-embryonic development, which should aid in understanding how various shell shapes are formed and have evolved in the gastropods. PMID:23711320

  7. Species diversity of planktonic gastropods (Pteropoda and Heteropoda) from six ocean regions based on DNA barcode analysis

    NASA Astrophysics Data System (ADS)

    Jennings, Robert M.; Bucklin, Ann; Ossenbrügger, Holger; Hopcroft, Russell R.


    Pteropods and heteropods are two distinct groups of holoplanktonic gastropods whose species and genetic diversity remain poorly understood, despite their ubiquity in the world's oceans. Some species apparently attain near cosmopolitan distributions, implying long-distance dispersal or cryptic species assemblages. We present the first multi-regional and species-rich molecular dataset of holoplanktonic gastropods, comprising DNA barcodes from the mitochondrial cytochrome c oxidase I subunit gene (COI) from 115 individuals of 41 species sampled from six ocean regions across the globe. Molecular analysis and assessment of barcoding utility supported the validity of several morphological subspecies and forms (e.g. of Creseis virgula and Limacina helicina), while others were not supported (e.g. Cavolinia uncinata). Significant genetic variation was observed among conspecific specimens collected in different geographic regions for some species, particularly in euthecosomatous pteropods. Several species of euthecosomes showed no evidence of genetic separation among distant ocean regions. Overall, we suggest some taxonomic revision of the holoplanktonic gastropods will be required, pending a more complete molecular inventory of these groups.

  8. Assembly and annotation of a non-model gastropod (Nerita melanotragus) transcriptome: a comparison of de novo assemblers.


    Amin, Shorash; Prentis, Peter J; Gilding, Edward K; Pavasovic, Ana


    The sequencing, de novo assembly and annotation of transcriptome datasets generated with next generation sequencing (NGS) has enabled biologists to answer genomic questions in non-model species with unprecedented ease. Reliable and accurate de novo assembly and annotation of transcriptomes, however, is a critically important step for transcriptome assemblies generated from short read sequences. Typical benchmarks for assembly and annotation reliability have been performed with model species. To address the reliability and accuracy of de novo transcriptome assembly in non-model species, we generated an RNAseq dataset for an intertidal gastropod mollusc species, Nerita melanotragus, and compared the assembly produced by four different de novo transcriptome assemblers; Velvet, Oases, Geneious and Trinity, for a number of quality metrics and redundancy. Transcriptome sequencing on the Ion Torrent PGM™ produced 1,883,624 raw reads with a mean length of 133 base pairs (bp). Both the Trinity and Oases de novo assemblers produced the best assemblies based on all quality metrics including fewer contigs, increased N50 and average contig length and contigs of greater length. Overall the BLAST and annotation success of our assemblies was not high with only 15-19% of contigs assigned a putative function. We believe that any improvement in annotation success of gastropod species will require more gastropod genome sequences, but in particular an increase in mollusc protein sequences in public databases. Overall, this paper demonstrates that reliable and accurate de novo transcriptome assemblies can be generated from short read sequencers with the right assembly algorithms.

  9. Role of the Substrate in Feeding and Growth of the Marine Suspension-Feeding Gastropods Crepidula fornicata and Crepipatella peruviana.


    Pechenik, Jan A; Diederich, Casey M; Chaparro, Oscar R; Cubillos, Victor M; Mardones-Toledo, Daniela A


    Unlike lamellibranch bivalves, suspension-feeding calyptraeid gastropods lack siphons and paired shell valves to regulate water inflow. This study was designed to determine if calyptraeid gastropods use the solid surface to which they attach to facilitate food particle capture. Juveniles of both Crepidula fornicata and Crepipatella peruviana were maintained with phytoplankton for 3 to 6 wk in the laboratory, either attached to solid substrate or without solid substrate. Individuals of C. fornicata and C. peruviana that were reared on solid substrate grew about five to ten times more, or two times more, respectively, than those deprived of solid substrate. Final tissue weights were also significantly greater for individuals of both species that had been reared on solid substrate. For the two species, phytoplankton clearance rates were about two to three times higher for individuals attached to solid substrate than for those without solid substrate; rates of food cord production from the gills were also significantly higher. About 50% of C. peruviana that were deprived of solid substrate died during the first 3 wk of observation, and about 60% were dead by 6 wk. In contrast, most individuals of C. peruviana that were attached to solid substrate survived for the entire 6-wk study period, and all of the C. fornicata survived whether or not they were attached to solid substrate. The solid substrate to which calyptraeid gastropods attach clearly plays an important role in their feeding biology, although the precise role remains to be explored.

  10. Freshwater gastropods diversity hotspots: three new species from the Uruguay River (South America)

    PubMed Central

    de Lucía, Micaela


    Background: The Atlantic Forest is globally one of the priority ecoregions for biodiversity conservation. In Argentina, it is represented by the Paranense Forest, which covers a vast area of Misiones Province between the Paraná and Uruguay rivers. The Uruguay River is a global hotspot of freshwater gastropod diversity, here mainly represented by Tateidae (genus Potamolithus) and to a lesser extent Chilinidae. The family Chilinidae (Gastropoda, Hygrophila) includes 21 species currently recorded in Argentina, and three species in the Uruguay River. The species of Chilinidae occur in quite different types of habitats, but generally in clean oxygenated water recording variable temperature ranges. Highly oxygenated freshwater environments (waterfalls and rapids) are the most vulnerable continental environments. We provide here novel information on three new species of Chilinidae from environments containing waterfalls and rapids in the Uruguay River malacological province of Argentina. Materials and Methods: The specimens were collected in 2010. We analyzed shell, radula, and nervous and reproductive systems, and determined the molecular genetics. The genetic distance was calculated for two mitochondrial markers (cytochrome c oxidase subunit I–COI- and cytochrome b -Cyt b-) for these three new species and the species recorded from the Misionerean, Uruguay River and Lower Paraná-Río de la Plata malacological provinces. In addition, the COI data were analyzed phylogenetically by the neighbor-joining and Bayesian inference techniques. Results: The species described here are different in terms of shell, radula and nervous and reproductive systems, mostly based on the sculpture of the penis sheath. Phylogenetic analyses grouped the three new species with those present in the Lower Paraná-Río de la Plata and Uruguay River malacological provinces. Discussion: Phylogenetic analyses confirm the separation between the Uruguay River and the Misionerean malacological

  11. Ecological performance and possible origin of a ubiquitous but under-studied gastropod

    NASA Astrophysics Data System (ADS)

    Thomsen, Mad S.; Wernberg, Thomas; Tuya, Fernando; Silliman, Brian R.


    Invasions by non-indigenous species (NIS) have been suggested to alter local, regional and global biota on unprecedented scales. To manage NIS, it is pivotal to identify whether a species is introduced or native, but even today the geographical origin of thousands of species worldwide remain uncertain. Most of these 'cryptogenic species' are inconspicuous and rare, but in a few instances, they can also be abundant and conspicuous species, with large impacts on community structure. The identification of cryptogenic species, and summarizing information on their most likely origin, is an important task in invasion biology, and can highlight the need for research and management. Here, we document that the gastropod Batillaria australis in the Swan River estuary (Perth, Western Australia) is a conspicuous species of uncertain origin. A literature review combined with new survey data revealed that all evidence point to a recent human-mediated transfer; for example, it is absent from the fossil record, was first collected in 1954, has a low parasite diversity, has increased its population size dramatically in recent times, is separated by >3000 km from conspecifics, has no long-distance dispersal mechanisms, and existing ocean currents run against a natural range extension. Surprisingly, despite political and scientific focus on NIS hardly any ecological data have been published on this species from Western Australia. We show that B. australis is highly abundant in both seagrass beds (424 ± 29 ind m -2) and on unvegetated sand flats (92 ± 22 ind m -2) being orders of magnitudes more abundant than any native gastropod in the Swan River. Experiments showed that high resistance to predation and environmental stress potentially explains its success. From our survey data, we calculated that >3.6 billion invasive snails today occupy the Swan River. This large snail populations support other organisms; for example, almost 1 billion macroalgae are found attached to living B

  12. 17β-Oestradiol may prolong reproduction in seasonally breeding freshwater gastropod molluscs.


    Benstead, Rachel S; Baynes, Alice; Casey, Daire; Routledge, Edwin J; Jobling, Susan


    Whilst the effects of oestrogenic contaminants in the aquatic environment are well documented in fish, effects in invertebrate species has been subject to debate, possibly due to differences in experimental conditions (temperature, timing and duration of exposure) between studies. It has been suggested that molluscs are only susceptible to oestrogens in periods either following the main spawning or leading up to the maturation of gametes. To investigate this possibility, two temperate, seasonally reproducing gastropods (Planorbarius corneus and Viviparus viviparus) were exposed to two concentrations of 17β-oestradiol (E2; 10ng/l and 100ng/l nominal) in an outdoor mesocosm (subject to natural seasons). In addition, P. corneus was also exposed to E2 (1, 10 and 100ng/l) in the laboratory at temperatures and photoperiods to simulate summer and autumn. In the mesocosm, both snail species produced similar numbers of eggs/embryos as reference groups in the summer, but the groups exposed to 10ngE2/l (nominal) had significantly higher productivities after the onset of autumn, when entering their quiescent phase, whilst the snails exposed to a higher concentration (100ng/l, nominal) had an increased rate of mortality, and did not experience increased reproduction. In the laboratory, the rate of egg laying in P. corneus was unaffected in simulated summer (20°C, 16h photoperiod), but snails exposed to 10 and 100ng/l (nominal) in simulated autumn (15°C, 12h photoperiod) showed a concentration-dependent inhibition of the natural decline in egg laying observed in the control snails. Overall, rather than an increase in reproductive rate, the response of this species was a perpetuation of summer reproductive rates into autumn. We conclude that exposure to E2 can affect reproduction in the freshwater gastropods studied, but in P. corneus at least, this is dependent on the seasonal conditions (temperature and photoperiod) at which exposures are made. 2010. Published by Elsevier B

  13. Characterization of a β-D-mannosidase from a marine gastropod, Aplysia kurodai.


    Zahura, Umme Afsari; Rahman, Mohammad Matiur; Inoue, Akira; Ojima, Takao


    A β-D-mannosidase (EC with a molecular mass of approximately 100 kDa was purified from the digestive fluid of a marine gastropod Aplysia kurodai by ammonium sulfate fractionation followed by column chromatographies on TOYOPEARL Butyl-650 M, TOYOPEARL DEAE-650 M, and Superdex 200 10/300 GL. This enzyme, named AkMnsd in the present study, showed optimal activities at pH 4.5 and 40 °C and was stable at the acidic pH range from 2.0 to 6.7 and the temperature below 38 °C. The Km and Vmax values for AkMnsd determined at pH 6.0 and 30 °C with p-nitrophenyl β-d-mannopyranoside were 0.10 mM and 3.75 μmol/min/mg, respectively. AkMnsd degraded various polymer mannans as well as mannooligosaccharides liberating mannose as a major degradation product. Linear mannan from green alga Codium fragile was completely depolymerized by AkMnsd in the presence of AkMan, an endolytic β-mannanase, which we previously isolated from the same animal (Zahura et al., Comp. Biochem. Physiol. B 157, 137-148 (2010)). A cDNA encoding AkMnsd was amplified from the Aplysia hepatopancreas cDNA by the PCR using degenerated primers designed on the basis of N-terminal and internal amino-acid sequences of AkMnsd. The cloned AkMnsd cDNA consisted of 2985 bp and encoded an amino-acid sequence of 931 residues with the calculated molecular mass of 101,970 Da. The deduced sequence of AkMnsd showed 20-43% amino-acid identity to those of glycoside-hydrolase-family 2 (GHF2) β-mannosidases. The catalytically important amino-acid residues determined in GHF2 enzymes were completely conserved in AkMnsd. Thus, AkMnsd is regarded as a new member of GHF2 mannosidase from marine gastropod.

  14. Freshwater gastropods diversity hotspots: three new species from the Uruguay River (South America).


    Gutiérrez Gregoric, Diego E; de Lucía, Micaela


    The Atlantic Forest is globally one of the priority ecoregions for biodiversity conservation. In Argentina, it is represented by the Paranense Forest, which covers a vast area of Misiones Province between the Paraná and Uruguay rivers. The Uruguay River is a global hotspot of freshwater gastropod diversity, here mainly represented by Tateidae (genus Potamolithus) and to a lesser extent Chilinidae. The family Chilinidae (Gastropoda, Hygrophila) includes 21 species currently recorded in Argentina, and three species in the Uruguay River. The species of Chilinidae occur in quite different types of habitats, but generally in clean oxygenated water recording variable temperature ranges. Highly oxygenated freshwater environments (waterfalls and rapids) are the most vulnerable continental environments. We provide here novel information on three new species of Chilinidae from environments containing waterfalls and rapids in the Uruguay River malacological province of Argentina. The specimens were collected in 2010. We analyzed shell, radula, and nervous and reproductive systems, and determined the molecular genetics. The genetic distance was calculated for two mitochondrial markers (cytochrome c oxidase subunit I-COI- and cytochrome b -Cyt b-) for these three new species and the species recorded from the Misionerean, Uruguay River and Lower Paraná-Río de la Plata malacological provinces. In addition, the COI data were analyzed phylogenetically by the neighbor-joining and Bayesian inference techniques. The species described here are different in terms of shell, radula and nervous and reproductive systems, mostly based on the sculpture of the penis sheath. Phylogenetic analyses grouped the three new species with those present in the Lower Paraná-Río de la Plata and Uruguay River malacological provinces. Phylogenetic analyses confirm the separation between the Uruguay River and the Misionerean malacological provinces in northeast Argentina. These new endemic species from

  15. Population biology of the gastropod Olivella minuta (Gastropoda, Olividae) on two sheltered beaches in southeastern Brazil

    NASA Astrophysics Data System (ADS)

    Petracco, Marcelo; Camargo, Rita Monteiro; Tardelli, Daniel Teixeira; Turra, Alexander


    The structure, dynamics and production of two populations of the olivid gastropod Olivella minuta were analyzed through monthly sampling from November 2009 through October 2011 on two sandy beaches, Pernambuco (very sheltered) and Barequeçaba (sheltered) in São Paulo state (23°48'S), southeastern Brazil. On both beaches, samples were taken along five transects established perpendicular to the waterline. Parameters of the von Bertalanffy growth function were estimated for both populations from monthly length-frequency distributions. The production and turnover ratios were determined using the mass-specific growth rate method. The population on the less-sheltered Barequeçaba Beach was less abundant (120.02 ± 22.60 ind m-1) than on Pernambuco Beach (3295.30 ± 504.86 ind m-1 (±SE)), which we attribute to the greater environmental stability of the latter. Conversely, the mean length, size of the largest individual, and body mass were higher at Barequeçaba than at Pernambuco. The significant differences in the growth of individuals and the mortality rate (Z) between the beaches suggest that density-dependent processes were operating at Pernambuco Beach. The production and P/B ratio at Pernambuco (12.12 g AFDM m-1 year-1 and 1.91 year-1) were higher than at Barequeçaba (0.82 g AFDM m-1 year-1 and 1.06 year-1). The difference in production can be attributed to the higher abundance on Pernambuco, while the higher P/B ratio resulted from the scarcity of smaller individuals in the intertidal zone of Barequeçaba. The P/B ratio estimated for the Pernambuco population is the highest found so far for sandy-beach gastropods. This study reinforces the theory that biological interactions are important regulators of sheltered sandy-beach populations. Future studies with multi-beach sampling are needed to better understand the life-history variations of O. minuta along gradients of degree of exposure of sandy beaches.

  16. Cold Work Embrittlement of Interstitial-Free Steels

    SciTech Connect


    Interstitial-free (IF) steels are defined by their low amounts of solute interstitial elements, such as carbon and nitrogen. During secondary forming, strain can be localized at the grain boundaries of these steels, resulting in secondary cold work embrittlement (CWE).

  17. [Roentgenographic pattern of interstitial pneumonia and allergic alveolitis (author's transl)].


    Stender, H S


    Roentgenographic examination of the lungs permits diagnosis of inflammatory and allergic pulmonary disease with predominantly interstitial and less alveolar involvement in which pulmonary fibrosis may develop. Reaction of the sensitised lung to allergic exposure causes typical roentgenological patterns. Development of pulmonary fibrosis in interstitial lung disease can be prevented be early cortison therapy.

  18. Interstitial Solutes and Deformation in Nb and Nb Single Crystals

    SciTech Connect

    R. E. Ricker; D. J. Pitchure; and G. R. Myneni


    Experiments were conducted on high purity single and polycrystalline niobium to determine the influence of low concentrations of interstitial impurities on mechanical properties and to evaluate the feasibility of using measurements of mechanical properties to detect, identify, and quantify the diffusible interstitial content.

  19. Transient enhanced diffusion of boron in silicon: The interstitial flux

    SciTech Connect

    Simpson, T.W.; Goldberg, R.D.; Mitchell, I.V.; Baribeau, J.M.


    Delta-doped boron marker layers in silicon have been used to test further the relationship between B transient enhanced diffusion (TED) and the flux of silicon interstitials released during the annealing stage following self implantation. The authors present new data which address a number of questions raised by the present models. They show that in the experiments bulk trapping of interstitials is significant only for low implant fluences ({approximately}10{sup 12} cm{sup {minus}2}). The origin of the observed diffusion-like profiles for the interstitial flux is instead found to lie in local trapping within the {delta}-doped layers themselves. Boron trapped in immobile clusters may be associated with Si interstitials in approximately a 1:1 ratio; nevertheless this trapping contribution alone may not entirely account for the observed gradient. They suggest that some part of the observed TED response with depth is attributable to local trapping of silicon interstitials within the boron doped layers.

  20. Smoking-related idiopathic interstitial pneumonia: A review.


    Margaritopoulos, George A; Harari, Sergio; Caminati, Antonella; Antoniou, Katerina M


    For many years, cigarette smoking has been considered as the leading cause of chronic obstructive pulmonary disease and lung cancer. Recently, however, it has also been associated with the development of diffuse interstitial lung diseases. In the latest classification of the major idiopathic interstitial pneumonias (IIP), the term smoking-related IIP has been introduced, including two entities, namely desquamative interstitial pneumonia (DIP) and respiratory bronchiolitis-interstitial lung disease (RB-ILD). Other entities in which smoking has a definite or suggested role include pulmonary Langerhan's cell histiocytosis, smoking-related interstitial fibrosis, combined pulmonary fibrosis and emphysema syndrome and idiopathic pulmonary fibrosis. In this review, we will focus on the mechanisms of smoking-related lung damage and on the clinical aspects of these disorders with the exception of idiopathic pulmonary fibrosis, which will be reviewed elsewhere in this review series.

  1. Amino acid racemization dating of Upper Pleistocene - Holocene terrestrial gastropods from a Mediterranean region (Murcia, SE Spain)

    NASA Astrophysics Data System (ADS)

    Garcia-Mayordomo, Julian; Ortiz, Jose E.; Torres, Trinidad; Insua-Arevalo, Juan M.; Martinez-Diaz, Jose J.; Altolaguirre, Yul; Canales-Fernandez, Maria L.; Martin-Banda, Raquel


    The amino acid racemization method has become a widely used geochronological tool for dating Quaternary deposits. The method is based on the fact that living organisms contain only L-amino acids which gradually racemize into D-amino acids after death. Thus, the D/L ratio increases with time after death until it is equal to 1, that is, when equilibrium is reached. Gastropod shells are particularly useful for amino acid racemization dating. Because the amino acid racemization method is not a numerical dating method in isolation, it needs to be calibrated, mainly with radiometric dating methods. The racemization process is genus- and temperature-dependent. In this work we present a preliminary analysis that compares the radiometric age estimated from different dating methods of a number of gastropods recovered in localities from Murcia (Southeastern Spain), with the age obtained through the amino acid racemization method. Taking advantage of recent paleoseismological research in the Murcia region (SE Spain), 28 gastropods specimens were collected from different trenches dug in young Quaternary alluvial deposits. The specimens were subsequently classified and then analyzed according to the standards protocols of the Biomolecular Stratigraphy Laboratory (UPM, Madrid School of Mines). The species found were Otala lactea, Iberus gualterianus, Sphincterochila candidissima and Theba pisana. The D/L ratios of aspartic acid, leucine, phenylalanine and glutamic acid were determined, and the corresponding average age of each specimen was calculated introducing the D/L values in the age calculation algorithm of Torres et al. (1997) for gastropods of central and southern Spain. The racemization age for each locality was then compared to the radiometric age of the deposit where the specimens were collected. To this respect, the samples were classified in different groups considering the reliability on the age control method. The most reliable sample consists only on dates obtained

  2. Balance point characterization of interstitial fluid volume regulation.


    Dongaonkar, R M; Laine, G A; Stewart, R H; Quick, C M


    The individual processes involved in interstitial fluid volume and protein regulation (microvascular filtration, lymphatic return, and interstitial storage) are relatively simple, yet their interaction is exceedingly complex. There is a notable lack of a first-order, algebraic formula that relates interstitial fluid pressure and protein to critical parameters commonly used to characterize the movement of interstitial fluid and protein. Therefore, the purpose of the present study is to develop a simple, transparent, and general algebraic approach that predicts interstitial fluid pressure (P(i)) and protein concentrations (C(i)) that takes into consideration all three processes. Eight standard equations characterizing fluid and protein flux were solved simultaneously to yield algebraic equations for P(i) and C(i) as functions of parameters characterizing microvascular, interstitial, and lymphatic function. Equilibrium values of P(i) and C(i) arise as balance points from the graphical intersection of transmicrovascular and lymph flows (analogous to Guyton's classical cardiac output-venous return curves). This approach goes beyond describing interstitial fluid balance in terms of conservation of mass by introducing the concept of inflow and outflow resistances. Algebraic solutions demonstrate that P(i) and C(i) result from a ratio of the microvascular filtration coefficient (1/inflow resistance) and effective lymphatic resistance (outflow resistance), and P(i) is unaffected by interstitial compliance. These simple algebraic solutions predict P(i) and C(i) that are consistent with reported measurements. The present work therefore presents a simple, transparent, and general balance point characterization of interstitial fluid balance resulting from the interaction of microvascular, interstitial, and lymphatic function.

  3. Green Fluorescence of Cytaeis Hydroids Living in Association with Nassarius Gastropods in the Red Sea

    PubMed Central

    Prudkovsky, Andrey A.; Ivanenko, Viatcheslav N.; Nikitin, Mikhail A.; Lukyanov, Konstantin A.; Belousova, Anna; Reimer, James D.; Berumen, Michael L.


    Green Fluorescent Proteins (GFPs) have been reported from a wide diversity of medusae, but only a few observations of green fluorescence have been reported for hydroid colonies. In this study, we report on fluorescence displayed by hydroid polyps of the genus Cytaeis Eschscholtz, 1829 (Hydrozoa: Anthoathecata: Filifera) found at night time in the southern Red Sea (Saudi Arabia) living on shells of the gastropod Nassarius margaritifer (Dunker, 1847) (Neogastropoda: Buccinoidea: Nassariidae). We examined the fluorescence of these polyps and compare with previously reported data. Intensive green fluorescence with a spectral peak at 518 nm was detected in the hypostome of the Cytaeis polyps, unlike in previous reports that reported fluorescence either in the basal parts of polyps or in other locations on hydroid colonies. These results suggest that fluorescence may be widespread not only in medusae, but also in polyps, and also suggests that the patterns of fluorescence localization can vary in closely related species. The fluorescence of polyps may be potentially useful for field identification of cryptic species and study of geographical distributions of such hydroids and their hosts. PMID:26840497

  4. Biokinetics of different-shaped copper oxide nanoparticles in the freshwater gastropod, Potamopyrgus antipodarum

    USGS Publications Warehouse

    Ramskov, Tina; Croteau, Marie-Noele; Forbes, Valery E.; Selck, Henriette


    Sediment is recognized as a major environmental sink for contaminants, including engineered nanoparticles (NPs). Consequently, sediment-living organisms are likely to be exposed to NPs. There is evidence that both accumulation and toxicity of metal NPs to sediment-dwellers increase with decreasing particle size, although NP size does not always predict effects. In contrast, not much is known about the influence of particle shape on bioaccumulation and toxicity. Here, we examined the influence of copper oxide (CuO) NP shape (rods, spheres, and platelets) on their bioaccumulation kinetics and toxicity to the sediment-dwelling gastropod, Potamopyrgus antipodarum. The influence of Cu added as CuCl2 (i.e., aqueous Cu treatment) was also examined. Exposure to sediment mixed with aqueous Cu or with different-shaped CuO NPs at an average measured exposure concentration of 207 μg Cu per g dry weight sediment for 14 days did not significantly affect snail mortality. However, growth decreased for snails exposed to sediment amended with CuO NP spheres and platelets. P. antipodarum accumulated Cu from all Cu forms/shapes in significant amounts compared to control snails. In addition, once accumulated, Cu was efficiently retained (i.e., elimination rate constants were generally not significantly different from zero). Consequently, snails are likely to concentrate Cu over time, from both aqueous and NP sources, resulting in a high potential for toxicity.

  5. Species-specific and transgenerational responses to increasing salinity in sympatric freshwater gastropods

    USGS Publications Warehouse

    Suski, Jamie G.; Salice, Christopher J.; Patino, Reynaldo


    Freshwater salinization is a global concern partly attributable to anthropogenic salt contamination. The authors examined the effects of increased salinity (as NaCl, 250-4,000 µS/cm, specific conductance) on two sympatric freshwater gastropods (Helisoma trivolvis and Physa pomillia). Life stage sensitivities were determined by exposing naive eggs or naive juveniles (through adulthood and reproduction). Additionally, progeny eggs from the juvenile-adult exposures were maintained at their respective parental salinities to examine transgenerational effects. Naive H. trivolvis eggs experienced delayed development at specific conductance > 250 µS/cm; reduced survivorship and reproduction were also seen in juvenile H. trivolvis at 4,000 µS/cm. Survival and growth of P. pomilia were not affected by increased salinity following egg or juvenile exposures. Interestingly, the progeny of H. trivolvis exposed to higher salinity may have gained tolerance to increased salinity whereas P. pomilia progeny may have experienced negative transgenerational effects. The present study demonstrates that freshwater snail species vary in their tolerance to salinization and also highlights the importance of multigenerational studies, as stressor impacts may not be readily apparent from shorter term exposures.

  6. Baseline trace metals in gastropod mollusks from the Beagle Channel, Tierra del Fuego (Patagonia, Argentina).


    Conti, Marcelo Enrique; Stripeikis, Jorge; Finoia, Maria Grazia; Tudino, Mabel Beatriz


    With the aim to evaluate the mollusk Nacella (P)magellanica as biomonitor of elemental pollution in seawater of the Beagle Channel, more than one hundred individuals of the gastropod were sampled, separated in viscera and muscle, and then examined with respect to the accumulation of Cd, Cr, Cu, Ni, Pb and Zn. Collection was performed in seven strategic locations along 170 km of the coastal area of the Beagle Channel (Tierra del Fuego, Argentina) in two campaigns during 2005 and 2007. Samples of surrounding seawater in the different sites were obtained and tested for the same metals as well. The accumulation capacity of Nacella (P)magellanica and thus its aptitude as biomonitor, was evaluated through the calculus of the preconcentration factors of the metals assayed. A discussion involving the comparison with other mollusks previously tested will be given. Several statistical approaches able to analyze data with environmental purposes were applied. Non parametric univariate tests such as Kruskal-Wallis and Mann-Whitney were carried out to assess the changes of the metal concentrations with time (2005 and 2007) in each location. Multivariate methods (linear discriminant analysis on PCA factors) were also applied to obtain a more reliable site classification. Johnson's probabilistic method was carried out for comparison between different geographical areas. The possibility of employing these results as heavy metals' background levels of seawater from the Beagle Channel will be debated.

  7. Larval settlement and metamorphosis in a marine gastropod in response to multiple conspecific cues.


    Cahill, Abigail E; Koury, Spencer A


    Larvae of the marine gastropod Crepidula fornicata must complete a transition from the plankton, where they are highly dispersed, to an aggregated group of benthic adults. Previous research has shown that selective settlement of larvae on conspecific adults is mediated by a water-borne chemical cue. However, variable experimental conditions have been used to study this cue, and standardization is needed in order to investigate factors that may have weak effects on settlement. In this study, we developed a time-course bioassay based on a full-factorial design with temporal blocking and statistical analysis of larval settlement rates in the lab. We tested this bioassay by examining settlement in the presence of an abiotic cue (KCl), and biotic cues (water conditioned with adult conspecifics and conspecific pedal mucus). Results confirmed settlement in the presence of both KCl and adult-conditioned water, and discovered the induction of settlement by pedal mucus. This optimized, standardized bioassay will be used in future experiments to characterize the complex process of larval settlement in C. fornicata, particularly to measure components of potentially small effect.

  8. Old fossils–young species: evolutionary history of an endemic gastropod assemblage in Lake Malawi

    PubMed Central

    Schultheiß, Roland; Van Bocxlaer, Bert; Wilke, Thomas; Albrecht, Christian


    Studies on environmental changes provide important insights into modes of speciation, into the (adaptive) reoccupation of ecological niches and into species turnover. Against this background, we here examine the history of the gastropod genus Lanistes in the African Rift Lake Malawi, guided by four general evolutionary scenarios, and compare it with patterns reported from other endemic Malawian rift taxa. Based on an integrated approach using a mitochondrial DNA phylogeny and a trait-specific molecular clock in combination with insights from the fossil record and palaeoenvironmental data, we demonstrate that the accumulation of extant molecular diversity in the endemic group did not start before approximately 600 000 years ago from a single lineage. Fossils of the genus from the Malawi Rift, however, are over one million years older. We argue that severe drops in the lake level of Lake Malawi in the Pleistocene offer a potential explanation for this pattern. Our results also challenge previously established phylogenetic relationships within the genus by revealing parallel evolution and providing evidence that the endemic Lanistes species are not restricted to the lake proper but are present throughout the Malawi Rift. PMID:19439440

  9. AFLPs and Mitochondrial Haplotypes Reveal Local Adaptation to Extreme Thermal Environments in a Freshwater Gastropod

    PubMed Central

    Quintela, María; Johansson, Magnus P.; Kristjánsson, Bjarni K.; Barreiro, Rodolfo; Laurila, Anssi


    The way environmental variation shapes neutral and adaptive genetic variation in natural populations is a key issue in evolutionary biology. Genome scans allow the identification of the genetic basis of local adaptation without previous knowledge of genetic variation or traits under selection. Candidate loci for divergent adaptation are expected to show higher FST than neutral loci influenced solely by random genetic drift, migration and mutation. The comparison of spatial patterns of neutral markers and loci under selection may help disentangle the effects of gene flow, genetic drift and selection among populations living in contrasting environments. Using the gastropod Radix balthica as a system, we analyzed 376 AFLP markers and 25 mtDNA COI haplotypes for candidate loci and associations with local adaptation among contrasting thermal environments in Lake Mývatn, a volcanic lake in northern Iceland. We found that 2% of the analysed AFLP markers were under directional selection and 12% of the mitochondrial haplotypes correlated with differing thermal habitats. The genetic networks were concordant for AFLP markers and mitochondrial haplotypes, depicting distinct topologies at neutral and candidate loci. Neutral topologies were characterized by intense gene flow revealed by dense nets with edges connecting contrasting thermal habitats, whereas the connections at candidate loci were mostly restricted to populations within each thermal habitat and the number of edges decreased with temperature. Our results suggest microgeographic adaptation within Lake Mývatn and highlight the utility of genome scans in detecting adaptive divergence. PMID:25007329

  10. Intraspecific Scaling Relationships Between Crawling Speed and Body Size in a Gastropod.


    Hemmert, Heather M; Baltzley, Michael J


    Across various modes of locomotion, body size and speed are often correlated both between and within species. Among the gastropods, however, current data are minimal for interspecific and intraspecific scaling relationships. In this study, we tested the relationships between various measurements of body size and crawling speed in the terrestrial snail Cornu aspersum. We also investigated the relationships between crawling speed, muscular wave frequency, and muscular wavelength, because--while these relationships within individuals are well studied--the relationships among individuals are unknown. We recorded snails crawling on both a horizontal and a vertical surface. We found that when they crawled on a horizontal surface, foot length was positively correlated with pedal wavelength and crawling speed, but was not correlated with wave frequency. In comparison, when they crawled on a vertical surface, foot length was positively correlated with wavelength, negatively correlated with wave frequency, and not correlated with crawling speed. Body mass had no correlation with crawling speed when snails were crawling on a horizontal surface, but was negatively correlated with speed when snails crawled on a vertical surface.

  11. Effect of Male Accessory Gland Products on Egg Laying in Gastropod Molluscs

    PubMed Central

    van Iersel, Sander; Swart, Elferra M.; Nakadera, Yumi; van Straalen, Nico M.; Koene, Joris M.


    In internally fertilizing animals, seminal fluid is usually added to the spermatozoa, together forming the semen or ejaculate. Besides nourishing and activating sperm, the components in the seminal fluid can also influence female physiology to augment fertilization success of the sperm donor. While many studies have reported such effects in species with separate sexes, few studies have addressed this in simultaneously hermaphroditic animals. This video protocol presents a method to study effects of seminal fluid in gastropods, using a simultaneously hermaphroditic freshwater snail, the great pond snail Lymnaea stagnalis, as model organism. While the procedure is shown using complete prostate gland extracts, individual components (i.e., proteins, peptides, and other compounds) of the seminal fluid can be tested in the same way. Effects of the receipt of ejaculate components on egg laying can be quantified in terms of frequency of egg laying and more subtle estimates of female reproductive performance such as egg numbers within each egg masses. Results show that seminal fluid proteins affect female reproductive output in this simultaneous hermaphrodite, highlighting their importance for sexual selection. PMID:24998794

  12. Biological strategy for the fabrication of highly ordered aragonite helices: the microstructure of the cavolinioidean gastropods

    NASA Astrophysics Data System (ADS)

    Checa, Antonio G.; Macías-Sánchez, Elena; Ramírez-Rico, Joaquín


    The Cavolinioidea are planktonic gastropods which construct their shells with the so-called aragonitic helical fibrous microstructure, consisting of a highly ordered arrangement of helically coiled interlocking continuous crystalline aragonite fibres. Our study reveals that, despite the high and continuous degree of interlocking between fibres, every fibre has a differentiated organic-rich thin external band, which is never invaded by neighbouring fibres. In this way, fibres avoid extinction. These intra-fibre organic-rich bands appear on the growth surface of the shell as minuscule elevations, which have to be secreted differentially by the outer mantle cells. We propose that, as the shell thickens during mineralization, fibre secretion proceeds by a mechanism of contact recognition and displacement of the tips along circular trajectories by the cells of the outer mantle surface. Given the sizes of the tips, this mechanism has to operate at the subcellular level. Accordingly, the fabrication of the helical microstructure is under strict biological control. This mechanism of fibre-by-fibre fabrication by the mantle cells is unlike that any other shell microstructure.

  13. Population genetics of a trochid gastropod broadens picture of Caribbean Sea connectivity.


    Díaz-Ferguson, Edgardo; Haney, Robert A; Haney, Robert; Wares, John P; Wares, John; Silliman, Brian R; Silliman, Brian


    Regional genetic connectivity models are critical for successful conservation and management of marine species. Even though rocky shore invertebrates have been used as model systems to understand genetic structure in some marine environments, our understanding of connectivity in Caribbean communities is based overwhelmingly on studies of tropical fishes and corals. In this study, we investigate population connectivity and diversity of Cittarium pica, an abundant rocky shore trochid gastropod that is commercially harvested across its natural range, from the Bahamas to Venezuela. We tested for genetic structure using DNA sequence variation at the mitochondrial COI and 16S loci, AMOVA and distance-based methods. We found substantial differentiation among Caribbean sites. Yet, genetic differentiation was associated only with larger geographic scales within the Caribbean, and the pattern of differentiation only partially matched previous assessments of Caribbean connectivity, including those based on larval dispersal from hydrodynamic models. For instance, the Bahamas, considered an independent region by previous hydrodynamic studies, showed strong association with Eastern Caribbean sites in our study. Further, Bonaire (located in the east and close to the meridional division of the Caribbean basin) seems to be isolated from other Eastern sites. The significant genetic structure and observed in C. pica has some commonalities in pattern with more commonly sampled taxa, but presents features, such as the differentiation of Bonaire, that appear unique. Further, the level of differentiation, together with regional patterns of diversity, has important implications for the application of conservation and management strategies in this commercially harvested species.

  14. Photosynthesis drives oxygen levels in macrophyte-associated gastropod egg masses.


    Woods, H Arthur; Podolsky, Robert D


    Many aquatic animals deposit fertilized eggs in adherent clutches or gelatinous masses. Egg aggregation carries certain risks, including the potential for inadequate oxygen supply to embryos. Physical and biological conditions alter such risks. We examined the effects of light levels and associated photosynthetic organisms on the distribution of oxygen inside gelatinous egg masses of four temperate gastropod species. Egg masses of two species, the opisthobranchs Melanochlamys diomedea and Haminoea callidegenita, contained significant populations of diatoms but generally were not associated with macrophytes. Egg masses of the other two species, the opisthobranch Haminoea vesicula and the prosobranch Lacuna sp., occurred commonly on subtidal macrophytes and appeared not to contain significant populations of diatoms. In the laboratory, we used microelectrodes to measure oxygen levels inside masses exposed to alternating dark and light conditions; light level had an enormous influence on oxygen profiles in egg masses of all four species. Masses of H. vesicula and Lacuna sp., when experimentally separated from their macrophytes, showed only slight increases in oxygen upon light exposure, indicating that the main source of oxygen in situ was the macrophyte rather than associated microalgae. Our findings indicate that photosynthesis by macrophytes can drive large changes in internal oxygen profiles.

  15. Heavy-tailed distributions in the intermittent motion behaviour of the intertidal gastropod Littorina littorea

    NASA Astrophysics Data System (ADS)

    Seuront, Laurent; Duponchel, Anne-Charlotte; Chapperon, Coraline


    The two-dimensional motion behaviour of the common intertidal gastropod Littorina littorea is investigated as a function of the immersion time from three sampling sites on an exposed rocky shore. A total of 90 individuals have been individually marked and tracked over 14 consecutive daylight low tide. Successive displacements show very intermittent behaviour, with a few localised large displacements over a wide range of small displacements. We show that successive displacements are described by flight length l d heavy-tailed distributions with P(ld)∼ld-μ. The very low values of the exponent μ ( μ≈2.22, 2.43 and 2.67) indicate that L. littorea flights fall into the category of super-diffusive processes. These exponents were significantly higher than the special value μ≈2 analytically and theoretically predicted to be the most advantageous in optimising long-term encounter statistics, especially for low-prey-density scenario. As natural selection should favour flexible behaviour, leading to different optimum searching statistics, under different conditions, our results support the idea that the differences in food concentration and distribution encountered at the different sites by L. littorea led to different heavy-tailed distributions observed for the most extreme displacements.

  16. Possible environmental chemical cues affecting behaviour of the mangrove gastropod Cerithidea decollata

    NASA Astrophysics Data System (ADS)

    Lazzeri, Anna Marta


    The Indo-West Pacific mangrove gastropod Cerithidea decollata feeds on the ground at low tide and climbs the trees (Avicennia marina) two hours before the arrival of water, settling well above the level that the incoming tide will reach at high tide (from 0 to 80 cm, depending on the tidal phase). In addition, it has been shown that these snails climb twice as high when translocated to lower shore sites (dominated by Rhizophora mucronata), where C. decollata is missing and the high water can reach 1.6 m instead of about 80 cm as within the snail home environment. The study assesses the possible role of chemical cues in the afore-mentioned behaviours. The hypothesis that snails may foresee the periodical tide level variation thanks to airborne chemical cues, possibly released by trees or sediments, has been rejected. On the other hand, airborne chemical cues released by R. mucronata may play a role in inducing snails translocated to low shore sites to climb much higher than control, allowing them to avoid submersion.

  17. Microhabitat use by two rocky shore gastropods in an intertidal sandy substrate with rocky fragments.


    Turra, A; Denadai, M R


    Sandy beaches in some areas of the São Sebastião Channel in southeastern Brazil have unremittingly undergone a variety of impacts, including the deposition of rock fragments in the intertidal region. Consequently, these environments support a rich fauna comprising both sandy beach and rocky shore organisms. Two rocky shore gastropods, Tegula viridula and Morula nodulosa, are particularly abundant in such environments. An evaluation of the use of microhabitats by these two species revealed that they occupy the available microhabitats in different proportions and the presence of one species is associated with the absence of the other. Morula nodulosa is randomly dispersed, occupying mostly areas with rock fragments covered with sediment and branching brown algae. Tegula viridula shows a clumped dispersion associated with the patchiness of the microhabitats used: the presence of encrusting green algae and absence of sediment and branching brown algae covering the rocks. These findings suggest T. viridula has a lower tolerance than M. nodulosa to sand inundation of the rocky fragments, a stochastic event common to the environment in question.

  18. Intracapsular development and dispersal polymorphism in the predatory gastropod Ocenebra erinaceus (Linnaeus 1758)

    NASA Astrophysics Data System (ADS)

    Smith, Kathryn E.; Reed, Adam J.; Thatje, Sven


    Intraspecific polymorphism during development, such as poecilogony or dispersal polymorphism, has rarely been observed in the marine environment. The ecological advantages of this bet-hedging strategy, whereby the offspring from one species exhibit multiple developmental modes, include the potential for rapid colonization of new habitats while simultaneously achieving a degree of gene flow between populations. The muricid gastropod, Ocenebra erinaceus, is a common, shallow-water marine predator found across England and France. Historically, O. erinaceus caused significant damage to shellfisheries, but more recently it has been impacted by TBT-induced imposex. Despite the previous attention given to this species, little is known about its encapsulated development. Studying O. erinaceus egg capsules from the Solent, UK, we describe intracapsular development at 15 °C, the in situ temperature at time of oviposition. Within each capsule, all embryos developed; no nurse eggs were present. Development was categorized into eight ontogenetic stages, although not all individuals displayed every stage; embryos hatched as either swimming late-pediveliger larvae or crawling juveniles after 59-69 days, indicating dispersal polymorphism to occur in this species. Swimming late-pediveliger larvae completed metamorphosis within 72 h of hatching. As O. erinaceus continues to recover from TBT pollution, dispersal polymorphism may facilitate a rapid expansion in both population size and range. If this occurs, O. erinaceus has the potential to, once again, become a serious problem for shellfisheries around Europe.

  19. Biokinetics of different-shaped copper oxide nanoparticles in the freshwater gastropod, Potamopyrgus antipodarum.


    Ramskov, Tina; Croteau, Marie-Noële; Forbes, Valery E; Selck, Henriette


    Sediment is recognized as a major environmental sink for contaminants, including engineered nanoparticles (NPs). Consequently, sediment-living organisms are likely to be exposed to NPs. There is evidence that both accumulation and toxicity of metal NPs to sediment-dwellers increase with decreasing particle size, although NP size does not always predict effects. In contrast, not much is known about the influence of particle shape on bioaccumulation and toxicity. Here, we examined the influence of copper oxide (CuO) NP shape (rods, spheres, and platelets) on their bioaccumulation kinetics and toxicity to the sediment-dwelling gastropod, Potamopyrgus antipodarum. The influence of Cu added as CuCl2 (i.e., aqueous Cu treatment) was also examined. Exposure to sediment mixed with aqueous Cu or with different-shaped CuO NPs at an average measured exposure concentration of 207μg Cu per g dry weight sediment for 14 days did not significantly affect snail mortality. However, growth decreased for snails exposed to sediment amended with CuO NP spheres and platelets. P. antipodarum accumulated Cu from all Cu forms/shapes in significant amounts compared to control snails. In addition, once accumulated, Cu was efficiently retained (i.e., elimination rate constants were generally not significantly different from zero). Consequently, snails are likely to concentrate Cu over time, from both aqueous and NP sources, resulting in a high potential for toxicity.

  20. Intertidal coarse woody debris: A spatial subsidy as shelter or feeding habitat for gastropods?

    NASA Astrophysics Data System (ADS)

    Storry, Kristin A.; Weldrick, Christine K.; Mews, Malte; Zimmer, Martin; Jelinski, Dennis E.


    Coarse woody debris (CWD) in the intertidal region of rocky shores serves as a potential source of nutrients as well as habitat or refugia from predation, ecologically linking the adjacent marine and terrestrial habitats. In a series of field and laboratory experiments, the affinity of slow-moving motile intertidal gastropods to CWD either as food source or as shelter that increases habitat complexity was tested. In intertidal pools, CWD did not increase colonization by Littorina spp., while it did so in supratidal pools. Habitat complexity, brought about by algal cover and barnacles, was apparently sufficient in intertidal pools without woody debris, while the increase in habitat complexity by CWD increased the attractiveness of supratidal pools with little natural complexity to Littorina spp. Overall, however, comparison of pools containing woody debris and those containing artificial shelter provided evidence for CWD, and/or its biofilm, serving as food source rather than refugium per se. Similarly, Tegula funebralis chose CWD as food source rather than as shelter as indicated by comparison of autoclaved and unmanipulated woody debris. Further, both unfed and fed snails from a site where CWD was present significantly preferred CWD over macroalgae. Among snails from a site without woody debris, fed individuals showed no preference, while unfed snails significantly preferred macroalgae. From this, experience appears to be a factor that mediates the role of CWD. Overall, however, CWD appears to provide supplementary food to snails in the inter- and supratidal zone.

  1. Chemoattraction and host preference of the gastropod parasitic nematode Phasmarhabditis hermaphrodita.


    Rae, Robbie G; Robertson, Jamie F; Wilson, Michael J


    Phasmarhabditis hermaphrodita is a parasitic nematode that has been formulated into a biological control agent for slugs. The nematode responds to slug-associated cues such as mucus and feces in order to locate potential hosts. We assessed the olfactory response of P. hermaphrodita to mucus from 9 species of slugs, 2 snails, and 2 earthworms (non-hosts). We then examined the susceptibility of each invertebrate test species to high doses of P. hermaphrodita to determine whether susceptible species are more attractive than non-susceptible species to the nematode. We also studied the numbers of infective juveniles produced in each test species, as well as infectivity. Phasmarhabditis hermaphrodita showed strong attraction to mucus from the non-susceptible slug Arion subfuscus, the snail Helix aspersa, and the highly susceptible slug Deroceras reticulatum. In reproduction experiments, P. hermaphrodita produced the highest number of infective juveniles in D. reticulatum and Deroceras panormitanum; however, there was no significant relationship with attraction. Phasmarhabditis hermaphrodita caused significant mortality in 5-11 gastropod species tested (and showed no chemotactic preference for susceptible or non-susceptible species). There was a significant positive relationship between numbers of P. hermaphrodita penetrating into non-susceptible species and chemotaxis response. These necromenic species represent ideal hosts for P. hermaphrodita in terms of providing protection against abiotic and biotic factors as well as transport to many diverse areas.

  2. Effect of male accessory gland products on egg laying in gastropod molluscs.


    van Iersel, Sander; Swart, Elferra M; Nakadera, Yumi; van Straalen, Nico M; Koene, Joris M


    In internally fertilizing animals, seminal fluid is usually added to the spermatozoa, together forming the semen or ejaculate. Besides nourishing and activating sperm, the components in the seminal fluid can also influence female physiology to augment fertilization success of the sperm donor. While many studies have reported such effects in species with separate sexes, few studies have addressed this in simultaneously hermaphroditic animals. This video protocol presents a method to study effects of seminal fluid in gastropods, using a simultaneously hermaphroditic freshwater snail, the great pond snail Lymnaea stagnalis, as model organism. While the procedure is shown using complete prostate gland extracts, individual components (i.e., proteins, peptides, and other compounds) of the seminal fluid can be tested in the same way. Effects of the receipt of ejaculate components on egg laying can be quantified in terms of frequency of egg laying and more subtle estimates of female reproductive performance such as egg numbers within each egg masses. Results show that seminal fluid proteins affect female reproductive output in this simultaneous hermaphrodite, highlighting their importance for sexual selection.

  3. Old fossils-young species: evolutionary history of an endemic gastropod assemblage in Lake Malawi.


    Schultheiss, Roland; Van Bocxlaer, Bert; Wilke, Thomas; Albrecht, Christian


    Studies on environmental changes provide important insights into modes of speciation, into the (adaptive) reoccupation of ecological niches and into species turnover. Against this background, we here examine the history of the gastropod genus Lanistes in the African Rift Lake Malawi, guided by four general evolutionary scenarios, and compare it with patterns reported from other endemic Malawian rift taxa. Based on an integrated approach using a mitochondrial DNA phylogeny and a trait-specific molecular clock in combination with insights from the fossil record and palaeoenvironmental data, we demonstrate that the accumulation of extant molecular diversity in the endemic group did not start before approximately 600,000 years ago from a single lineage. Fossils of the genus from the Malawi Rift, however, are over one million years older. We argue that severe drops in the lake level of Lake Malawi in the Pleistocene offer a potential explanation for this pattern. Our results also challenge previously established phylogenetic relationships within the genus by revealing parallel evolution and providing evidence that the endemic Lanistes species are not restricted to the lake proper but are present throughout the Malawi Rift.

  4. Fine scale endemism on coral reefs: archipelagic differentiation in turbinid gastropods.


    Meyer, Christopher P; Geller, Jonathan B; Paulay, Gustav


    The perceived wide geographic range of organisms in the sea, facilitated by ready dispersal of waterborne dispersal stages, is a challenge for hypotheses of marine speciation but a boon to efforts of marine conservation. Wide species ranges are especially striking in the reef-rich Indo-west Pacific, the largest and most diverse marine biogeographic region, extending across half the planet. The insular marine biota of the tropical Pacific is characterized by wide-ranging species and provides the most striking examples of long distance dispersal, with endemism largely confined to the most remote island groups. Here we show that the gastropod Astralium "rhodostomum" has developed endemic clades on almost every Pacific archipelago sampled, a pattern unprecedented in marine biogeography, and reminiscent of the terrestrial biota of oceanic islands. Mitochondrial DNA sequences indicate that this species-complex is comprised of at least 30 geographically isolated clades, separated by as little as 180 km. Evidence suggests that such fine scale endemism and high diversity is not exceptional, but likely characterizes a substantial fraction of the reef biota. These results imply that (1) marine speciation can regularly occur over much finer spatial scales than generally accepted, (2) the diversity of coral reefs is even higher than suggested by morphology-based estimates, and (3) conservation efforts need to focus at the archipelagic level in the sea as on land.

  5. Evidence that gastropod torsion is driven by asymmetric cell proliferation activated by TGF-β signalling

    PubMed Central

    Kurita, Yoshihisa; Wada, Hiroshi


    Gastropods are characterized by their asymmetric bodyplan, which develops through a unique ontogenetic process called ‘torsion’. Despite several intensive studies, the driving force of torsion remains to be determined. Although torsion was traditionally believed to be driven by contraction of the retractor muscle connecting the foot and the shell, some recent reports cast doubt on that idea. Here, we report that torsion is accompanied by left–right asymmetric cell proliferation in the mantle epithelium in the limpet Nipponacmea fuscoviridis. Furthermore, we found that pharmacological inhibition of the transforming growth factor-β (TGF-β) signalling pathway, including that of Nodal, blocked torsion. We confirmed that the blocking was brought about through failure of the activation of cell proliferation in the right-hand side of the mantle epithelium, while the retractor muscle apparently developed normally. These results suggest that limpet torsion is driven by left–right asymmetric cell proliferation in the mantle epithelium, induced by the TGF-β pathway. PMID:21525052

  6. Biological strategy for the fabrication of highly ordered aragonite helices: the microstructure of the cavolinioidean gastropods

    PubMed Central

    Checa, Antonio G.; Macías-Sánchez, Elena; Ramírez-Rico, Joaquín


    The Cavolinioidea are planktonic gastropods which construct their shells with the so-called aragonitic helical fibrous microstructure, consisting of a highly ordered arrangement of helically coiled interlocking continuous crystalline aragonite fibres. Our study reveals that, despite the high and continuous degree of interlocking between fibres, every fibre has a differentiated organic-rich thin external band, which is never invaded by neighbouring fibres. In this way, fibres avoid extinction. These intra-fibre organic-rich bands appear on the growth surface of the shell as minuscule elevations, which have to be secreted differentially by the outer mantle cells. We propose that, as the shell thickens during mineralization, fibre secretion proceeds by a mechanism of contact recognition and displacement of the tips along circular trajectories by the cells of the outer mantle surface. Given the sizes of the tips, this mechanism has to operate at the subcellular level. Accordingly, the fabrication of the helical microstructure is under strict biological control. This mechanism of fibre-by-fibre fabrication by the mantle cells is unlike that any other shell microstructure. PMID:27181457

  7. Brefeldin A or monensin inhibits the 3D organizer in gastropod, polyplacophoran, and scaphopod molluscs.


    Gonzales, Eric E; van der Zee, Maurijn; Dictus, Wim J A G; van den Biggelaar, Jo


    In molluscs, the 3D vegetal blastomere acts as a developmental signaling center, or organizer, and is required to establish bilateral symmetry in the embryo. 3D is similar to organizing centers in other metazoans, but detailed comparisons are difficult, in part because its organizing function is poorly understood. To elucidate 3D function in a standardized fashion, we used monensin and brefeldin A (BFA) to rapidly and reversibly interfere with protein processing and secretion, thereby inhibiting the signaling interactions that underlie its specification and patterning. In the gastropods, Patella vulgata and Lymnaea stagnalis, the polyplacophoran, Mopalia muscosa, and the scaphopod, Antalis entalis, treatments initiated before the organizer-dependent onset of bilateral cleavage resulted in radialization of subsequent development. In radialized P. vulgata, L. stagnalis, and M. muscosa, organizer specification was blocked, and embryos failed to make the transition to bilateral cleavage. In all four species, the subsequent body plan was radially symmetric and was similarly organized about a novel aboral-oral axis. Our results demonstrate that brefeldin A (BFA) and monensin can be used to inhibit 3D's organizing function in a comparative fashion and that, at least in M. muscosa, the organizer-dependent developmental architecture of the embryo predicts subsequent patterns of morphogenetic movements in gastrulation and, ultimately, the layout of the adult body plan.

  8. Larval settlement and metamorphosis in a marine gastropod in response to multiple conspecific cues

    PubMed Central

    Koury, Spencer A.


    Larvae of the marine gastropod Crepidula fornicata must complete a transition from the plankton, where they are highly dispersed, to an aggregated group of benthic adults. Previous research has shown that selective settlement of larvae on conspecific adults is mediated by a water-borne chemical cue. However, variable experimental conditions have been used to study this cue, and standardization is needed in order to investigate factors that may have weak effects on settlement. In this study, we developed a time-course bioassay based on a full-factorial design with temporal blocking and statistical analysis of larval settlement rates in the lab. We tested this bioassay by examining settlement in the presence of an abiotic cue (KCl), and biotic cues (water conditioned with adult conspecifics and conspecific pedal mucus). Results confirmed settlement in the presence of both KCl and adult-conditioned water, and discovered the induction of settlement by pedal mucus. This optimized, standardized bioassay will be used in future experiments to characterize the complex process of larval settlement in C. fornicata, particularly to measure components of potentially small effect. PMID:27547586

  9. The relationship between sex change and reproductive success in a protandric marine gastropod

    PubMed Central

    Brante, Antonio; Quiñones, Adriana; Silva, Francisco


    Protandric species switch sex during their lifetime. According to theory, the time (body size) at which sex change occurs is determined by the reproductive success of individuals affected by social interactions as well as by post-copulatory factors. Experimental evidence is biased to few social systems making the exploration of general patterns difficult. We used the protandric marine gastropod Crepidula coquimbensis that partakes in intrabrood sibling cannibalism to test the following hypotheses: 1. Male-male competition for access to females and sibling cannibalism determine male reproductive success; 2. Males with greater access to females and with higher reproductive success will have reduced growth rates and will delay sex change. Artificial aggregations with different social structures were constructed and male reproductive success was estimated by paternity analysis. The results supported our expectations showing that male competitive ability for access to the female, time spent by males in the copulatory position, and sibling cannibalism affect reproductive success and influence time to sex change, with less successful males hastening sex change. Also, males that spent more time in the copulatory position had reduced growth rates. Comparing these results with those reported for other sequential hermaphrodites provides evidence supporting general patterns of sex change in nature. PMID:27385040

  10. [NADPH-diaphorase activity in digestive system of gastropod molluscs Achatina fulica and Littorina littorea].


    Zaĭtseva, O V; Kuznetsova, T V; Markosova, T G


    Localization and peculiarities of NO-ergic elements were studied for he first time throughout the entire length of digestive tract of the marine gastropod mollusc Achatina fulica (Prosobranchia) and the terrestrial molusc Littorina littorea (Pulmonata) by using histochemical method of detection of NADPH-diaphorase (NADPHd). NO-ergic cells and fibers were revealed in all parts of the mollusc digestive tract beginning from pharynx. An intensive NADPHd activity was found in many intraepithelial cells of the open type and in their processes in intra- and subepithelial nerve plexuses, single subepithelial neurons, granular connective tissue cells, and numerous nerve fibers among muscle elements of he digestive tract wall as well as in nerves innervating the tract. NADPHd was also present in receptor cells of he oral area and in the central A. fulica ganglia participating in innervation of the digestive tract. The digestive tract NO-ergic system ofA. fulica has a more complex organization that that of L. littorea. In the A. fulica pharynx, stomach, and midgut, directly beneath epithelium, there is revealed a complex system of glomerular structures formed by thin NADPHd-positive nerve fibers coming from the side of epithelium. More superficially under the main groups of muscle elements, small agglomerations of NADPHd-positive neurons are seen, which could be considered as primitive, non-formed microganglia. Peculiarities of distribution and a possible functional role of NO-ergic elements in the digestive tract of molluscs are discussed as compared with other invertebrate and vertebrate animals.

  11. Green Fluorescence of Cytaeis Hydroids Living in Association with Nassarius Gastropods in the Red Sea.


    Prudkovsky, Andrey A; Ivanenko, Viatcheslav N; Nikitin, Mikhail A; Lukyanov, Konstantin A; Belousova, Anna; Reimer, James D; Berumen, Michael L


    Green Fluorescent Proteins (GFPs) have been reported from a wide diversity of medusae, but only a few observations of green fluorescence have been reported for hydroid colonies. In this study, we report on fluorescence displayed by hydroid polyps of the genus Cytaeis Eschscholtz, 1829 (Hydrozoa: Anthoathecata: Filifera) found at night time in the southern Red Sea (Saudi Arabia) living on shells of the gastropod Nassarius margaritifer (Dunker, 1847) (Neogastropoda: Buccinoidea: Nassariidae). We examined the fluorescence of these polyps and compare with previously reported data. Intensive green fluorescence with a spectral peak at 518 nm was detected in the hypostome of the Cytaeis polyps, unlike in previous reports that reported fluorescence either in the basal parts of polyps or in other locations on hydroid colonies. These results suggest that fluorescence may be widespread not only in medusae, but also in polyps, and also suggests that the patterns of fluorescence localization can vary in closely related species. The fluorescence of polyps may be potentially useful for field identification of cryptic species and study of geographical distributions of such hydroids and their hosts.

  12. Structure and in vitro cytocompatibility of the gastropod shell of Helix pomatia.


    Bächle, M; Hübner, U; Kohal, R J; Han, J S; Wiedmann-Al-Ahmad, M


    Distinguishing features of biological constructions are high stability and adaptation to their environment. Beside biocompatibility, nontoxicity and degradability these characteristics are demanded for new biomaterials in the field of tissue engineering. This study investigated the chemical composition, the organization and the in vitro osteoconductive potential of the terrestrial gastropod shell (Helix pomatia) on CAL72 and human osteoblast-like cells. Chemical composition of the biomaterial was examined by X-ray diffraction (XRD) and scanning electron microscopy (SEM) was performed to analyze the architecture of the snail shell and the morphology of the seeded cells. A double staining procedure (FDA/PI) and a proliferation test (EZ4U) assessed the viability of the cells. Microscopical images showed the multilayered architecture of the aragonite shell with hexagonal crystals on the inner side. The cells spread well on the biomaterial and the highest proliferation rate could be measured with CAL72 cells on the inner shell surface. The osteoconductive effects of this natural biomaterial could encourage further experiments in the field of tissue engineering.

  13. Toxicity of Alexandrium lusitanicum to gastropod larvae is not caused by paralytic-shellfish-poisoning toxins

    PubMed Central

    Juhl, A. R.; Martins, C. A.; Anderson, D. M.


    Laboratory grazing experiments compared ingestion of two subclones of the dinoflagellate Alexandrium lusitanicum by gastropod veliger larvae (Nassarius sp.). While the two prey subclones originated from the same monoclonal isolate of A. lusitanicum, one possessed the ability to produce paralytic-shellfish-poisoning toxins (PSTs), while the other did not. Ingestion rates on the two Alexandrium subclones were not significantly different over a range of prey concentrations (approximately 100 – 660 cells ml-1), indicating that PSTs did not serve as a grazing deterrent for these larvae. However, ingestion rates on both subclones were low at the higher prey concentrations tested. Mortality of the predators also increased linearly with concentration of either subclone. These observations indicated that both A. lusitanicum subclones produced an unknown substance that inhibited and killed the grazers. Veliger mortality was not induced by culture filtrates or lysates, suggesting either that the substance was either highly labile or that contact with intact cells was required. Because toxic algae can produce multiple bioactive substances, experimental demonstrations of alleopathic effects of toxic species should not be assigned to known toxins without supporting evidence. In addition, the results show that the effectiveness of algal grazing deterrents can increase with cell concentration, which may have implications for bloom dynamics. PMID:28729816

  14. Bacterial diversity and tetrodotoxin analysis in the viscera of the gastropods from Portuguese coast.


    Pratheepa, Vijayakumari; Alex, Anoop; Silva, Marisa; Vasconcelos, Vitor


    To trace the pathway of tetrodotoxin (TTX) producing microorganism in the Atlantic coast of Portugal, culture-dependent evaluation of the bacterial isolates from the viscera of the gastropods Monodonta lineata, Gibbula umbilicalis, Nucella lapillus and Patella intermedia, and from the environmental samples (biofilm and surrounding sea water) was carried out. Samples were collected from eight different coastal locations of Northern Portugal. A total of 311 isolates were identified. The observed bacterial diversity was distributed over five different classes (Gammaproteobacteria, Alphaproteobacteria, Flavobacteria, Bacilli and Actinobacteria) with the greatest number of 16S rRNA gene sequence derived from the Gammaproteobacteria (75%). Phylogenetic analysis based on the 16S rRNA gene showed that bacterial isolates were highly diverse and most of which were found in other marine environment. Among the different species isolated, Vibrio was found abundant. Eventhough TTX was not detected (UPLC-MS/MS) in the isolates from this study, PCR screening identified some natural product biosynthesis genes (PKS and NRPS) involved in its assembly. Further PCR screening of the TTX producing two ATCC Vibrio sp. reveals that NRPS might be involved in the biosynthesis of TTX through the incorporation of arginine. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Metabolic mechanisms for anoxia tolerance and freezing survival in the intertidal gastropod, Littorina littorea.


    Storey, Kenneth B; Lant, Benjamin; Anozie, Obiajulu O; Storey, Janet M


    The gastropod mollusk, Littorina littorea L., is a common inhabitant of the intertidal zone along rocky coastlines of the north Atlantic. This species has well-developed anoxia tolerance and freeze tolerance and is extensively used as a model for exploring the biochemical adaptations that support these tolerances as well as for toxicological studies aimed at identifying effective biomarkers of aquatic pollution. This article highlights our current understanding of the molecular mechanisms involved in anaerobiosis and freezing survival of periwinkles, particularly with respect to anoxia-induced metabolic rate depression. Analysis of foot muscle and hepatopancreas metabolism includes anoxia-responsive changes in enzyme regulation, signal transduction, gene expression, post-transcriptional regulation of mRNA, control of translation, and cytoprotective strategies including chaperones and antioxidant defenses. New studies describe the regulation of glucose-6-phosphate dehydrogenase by reversible protein phosphorylation, the role of microRNAs in suppressing mRNA translation in the hypometabolic state, modulation of glutathione S-transferase isozyme patterns, and the regulation of the unfolded protein response. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Tetrodotoxin Poisoning Due to Pufferfish and Gastropods, and Their Intoxication Mechanism

    PubMed Central

    Noguchi, Tamao; Onuki, Kazue; Arakawa, Osamu


    Marine pufferfish generally contain a large amount of tetrodotoxin (TTX) in their skin and viscera, and have caused many incidences of food poisoning, especially in Japan. Edible species and body tissues of pufferfish, as well as their allowable fishing areas, are therefore clearly stipulated in Japan, but still 2 to 3 people die every year due to pufferfish poisoning. TTX is originally produced by marine bacteria, and pufferfish are intoxicated through the food chain that starts with the bacteria. Pufferfish become nontoxic when fed TTX-free diets in a closed environment in which there is no possible invasion of TTX-bearing organisms. On the other hand, TTX poisoning due to marine snails has recently spread through Japan, China, Taiwan, and Europe. In addition, TTX poisoning of dogs due to the ingestion of sea slugs was recently reported in New Zealand. TTX in these gastropods also seems to be exogenous; carnivorous large snails are intoxicated by eating toxic starfish, and necrophagous small-to-medium snails, the viscera of dead pufferfish after spawning. Close attention must be paid to the geographic expansion and/or diversification of TTX-bearing organisms, and to the sudden occurrence of other forms of TTX poisoning due to their ingestion. PMID:23724281

  17. Upper Miocene endemic lacustrine gastropod fauna of the Turiec Basin: addressing taxonomic, paleobiogeographic and stratigraphic issues

    NASA Astrophysics Data System (ADS)

    Neubauer, Thomas A.; Harzhauser, Mathias; Pipík, Radovan


    The present work displays the first detailed taxonomic study on the freshwater gastropod fauna of the Upper Miocene Lake Turiec. Apart from several mentions of species and genus names in the literature, the mollusc fauna has been poorly studied up to now. Some of the cited genera implied peculiar paleobiogeographic relationships, urging a taxonomic investigation to either prove or revise such arising claims. Variable degrees of preservation, however, limited the possibility to identify all the fossils at species level. The fauna includes at least ten species, of which five turned out to be new to science. Four of those were sufficiently well preserved to be described as new species, namely Viviparus pipiki Neubauer & Harzhauser nov. sp., Melanopsis glaubrechti Neubauer & Harzhauser nov. sp., Tournouerina turiecensis Neubauer & Harzhauser nov. sp., and Radix kovaci Neubauer & Harzhauser nov. sp. Additionally, the new genus Popovicia Neubauer & Harzhauser nov. gen. is introduced for the primary homonym Metohia Popović, 1964 non Absolon, 1927. Most importantly, this taxonomic study revises many of the names cited in the literature and proves most of the alleged paleobiogeographic relationships wrong. The only biogeographic and stratigraphic surprise is the record of Popovicia cf. compressa, a species described from lower Pliocene deposits of the Metohia Basin in Kosovo. The majority of the fauna, however, has only been documented for the Turiec Basin, once more confirming the high degree of its endemicity. The faunal relationships indicate a latest Middle to early Late Pannonian (Middle to Late Tortonian) age, which is in agreement with available age models.

  18. Neural control of the velum in larvae of the gastropod, Ilyanassa obsoleta.


    Braubach, Oliver R; Dickinson, Amanda J G; Evans, Carol C E; Croll, Roger P


    Larval molluscs commonly use ciliated vela to swim and feed. In this study we used immunohistochemistry to demonstrate innervation of velar cilia and muscles by monoaminergic and peptidergic fibres in the caenogastropod, Ilyanassa obsoleta. Photoelectric recordings from pre-oral cilia on isolated pieces of velum revealed that serotonin increased, whereas catecholamines (dopamine and norepinephrine) decreased beat frequency at concentrations of 10(-6) to 10(-9) mol l(-1). Catecholamines also increased the frequency of momentary, isolated arrests of pre-oral cilia, but failed to suppress beating of the post-oral cilia at these concentrations. The neuropeptides, FMRFamide and Leu-enkephalin, did not affect the frequency of ciliary beating or of isolated ciliary arrests, but did induce numerous muscular contractions, which were accompanied by sustained ciliary arrests. In terms of whole animal behaviour, serotonin caused larvae to concentrate toward the top of a water column and to increase feeding, whereas catecholamines caused larvae to concentrate toward the bottom of a water column and decrease feeding. Monoamine analogues which facilitated or opposed the effects of synthetic transmitters on larval behaviour, further suggested that these transmitters are released endogenously to control velar function. Finally, applications of peptides to whole larvae caused increased frequency of locomotory arrests. Together these findings demonstrate several potential roles for the nervous system in controlling larval behaviour in gastropods.

  19. Stable Isotope Evidence for Dietary Overlap between Alien and Native Gastropods in Coastal Lakes of Northern KwaZulu-Natal, South Africa

    PubMed Central

    Miranda, Nelson A. F.; Perissinotto, Renzo


    Background Tarebia granifera (Lamarck, 1822) is originally from South-East Asia, but has been introduced and become invasive in many tropical and subtropical parts of the world. In South Africa, T. granifera is rapidly invading an increasing number of coastal lakes and estuaries, often reaching very high population densities and dominating shallow water benthic invertebrate assemblages. An assessment of the feeding dynamics of T. granifera has raised questions about potential ecological impacts, specifically in terms of its dietary overlap with native gastropods. Methodology/Principal Findings A stable isotope mixing model was used together with gut content analysis to estimate the diet of T. granifera and native gastropod populations in three different coastal lakes. Population density, available biomass of food and salinity were measured along transects placed over T. granifera patches. An index of isotopic (stable isotopes) dietary overlap (IDO, %) aided in interpreting interactions between gastropods. The diet of T. granifera was variable, including contributions from microphytobenthos, filamentous algae (Cladophora sp.), detritus and sedimentary organic matter. IDO was significant (>60%) between T. granifera and each of the following gastropods: Haminoea natalensis (Krauss, 1848), Bulinus natalensis (Küster, 1841) and Melanoides tuberculata (Müller, 1774). However, food did not appear to be limiting. Salinity influenced gastropod spatial overlap. Tarebia granifera may only displace native gastropods, such as Assiminea cf. ovata (Krauss, 1848), under salinity conditions below 20. Ecosystem-level impacts are also discussed. Conclusion/Significance The generalist diet of T. granifera may certainly contribute to its successful establishment. However, although competition for resources may take place under certain salinity conditions and if food is limiting, there appear to be other mechanisms at work, through which T. granifera displaces native gastropods

  20. Stable isotope evidence for dietary overlap between alien and native gastropods in coastal lakes of northern KwaZulu-Natal, South Africa.


    Miranda, Nelson A F; Perissinotto, Renzo


    Tarebia granifera (Lamarck, 1822) is originally from South-East Asia, but has been introduced and become invasive in many tropical and subtropical parts of the world. In South Africa, T. granifera is rapidly invading an increasing number of coastal lakes and estuaries, often reaching very high population densities and dominating shallow water benthic invertebrate assemblages. An assessment of the feeding dynamics of T. granifera has raised questions about potential ecological impacts, specifically in terms of its dietary overlap with native gastropods. A stable isotope mixing model was used together with gut content analysis to estimate the diet of T. granifera and native gastropod populations in three different coastal lakes. Population density, available biomass of food and salinity were measured along transects placed over T. granifera patches. An index of isotopic (stable isotopes) dietary overlap (IDO, %) aided in interpreting interactions between gastropods. The diet of T. granifera was variable, including contributions from microphytobenthos, filamentous algae (Cladophora sp.), detritus and sedimentary organic matter. IDO was significant (>60%) between T. granifera and each of the following gastropods: Haminoea natalensis (Krauss, 1848), Bulinus natalensis (Küster, 1841) and Melanoides tuberculata (Müller, 1774). However, food did not appear to be limiting. Salinity influenced gastropod spatial overlap. Tarebia granifera may only displace native gastropods, such as Assiminea cf. ovata (Krauss, 1848), under salinity conditions below 20. Ecosystem-level impacts are also discussed. The generalist diet of T. granifera may certainly contribute to its successful establishment. However, although competition for resources may take place under certain salinity conditions and if food is limiting, there appear to be other mechanisms at work, through which T. granifera displaces native gastropods. Complementary stable isotope and gut content analysis can provide

  1. Impact of toxic cyanobacteria on gastropods and microcystin accumulation in a eutrophic lake (Grand-Lieu, France) with special reference to Physa (= Physella) acuta.


    Lance, Emilie; Brient, Luc; Carpentier, Alexandre; Acou, Anthony; Marion, Loïc; Bormans, Myriam; Gérard, Claudia


    Hepatotoxic microcystins (MCs) produced by cyanobacteria are known to accumulate in gastropods following grazing of toxic cyanobacteria and/or absorption of MCs dissolved in water, with adverse effects on life history traits demonstrated in the laboratory. In the field, such effects may vary depending on species, according to their relative sensitivity and ecology. The aims of this study were to i) establish how various intensities of MC-producing cyanobacteria proliferations alter the structure of gastropod community and ii) compare MC tissue concentration in gastropods in the field with those obtained in our previous laboratory experiments on the prosobranch Potamopyrgus antipodarum and the pulmonate Lymnaea stagnalis. We explored these questions through a one-year field study at three stations at Grand-Lieu Lake (France) affected by different intensities of cyanobacteria proliferations. A survey of the community structure and MC content of both cyanobacteria and gastropods was associated with a caging experiment involving P. antipodarum and L. stagnalis. In total, 2592 gastropods belonging to 7 prosobranch and 16 pulmonate species were collected. However, distribution among the stations was unequal with 62% vs 2% of gastropods sampled respectively at the stations with the lowest vs highest concentrations of MC. Irrespective of the station, pulmonates were always more diverse, more abundant and occurred at higher frequencies than prosobranchs. Only the pulmonate Physa acuta occurred at all stations, with abundance and MC tissue concentration (< or = 4.32 microg g DW(-1)) depending on the degrees of MC-producing cyanobacteria proliferations in the stations; therefore, P. acuta is proposed as a potential sentinel species. The caging experiment demonstrated a higher MC accumulation in L. stagnalis (< or = 0.36 microg g DW(-1) for 71% of individuals) than in P. antipodarum (< or = 0.02 microg g DW(-1) for 12%), corroborating previous laboratory observations. Results

  2. Interstitial Photodynamic Therapy—A Focused Review

    PubMed Central

    Shafirstein, Gal; Bellnier, David; Oakley, Emily; Hamilton, Sasheen; Potasek, Mary; Beeson, Karl; Parilov, Evgueni


    Multiple clinical studies have shown that interstitial photodynamic therapy (I-PDT) is a promising modality in the treatment of locally-advanced cancerous tumors. However, the utilization of I-PDT has been limited to several centers. The objective of this focused review is to highlight the different approaches employed to administer I-PDT with photosensitizers that are either approved or in clinical studies for the treatment of prostate cancer, pancreatic cancer, head and neck cancer, and brain cancer. Our review suggests that I-PDT is a promising treatment in patients with large-volume or thick tumors. Image-based treatment planning and real-time dosimetry are required to optimize and further advance the utilization of I-PDT. In addition, pre- and post-imaging using computed tomography (CT) with contrast may be utilized to assess the response. PMID:28125024

  3. Unclassifiable interstitial lung disease: A review.


    Skolnik, Kate; Ryerson, Christopher J


    Accurate classification of interstitial lung disease (ILD) requires a multidisciplinary approach that incorporates input from an experienced respirologist, chest radiologist and lung pathologist. Despite a thorough multidisciplinary evaluation, up to 15% of ILD patients have unclassifiable ILD and cannot be given a specific diagnosis. The objectives of this review are to discuss the definition and features of unclassifiable ILD, identify the barriers to ILD classification and outline an approach to management of unclassifiable ILD. Several recent studies have described the characteristics of these patients; however, there are inconsistencies in the definition and terminology of unclassifiable ILD due to limited research in this population. Additional studies are required to determine the appropriate evaluation and management of patients with unclassifiable ILD. © 2015 Asian Pacific Society of Respirology.

  4. Pemphigus vulgaris-associated interstitial lung disease.


    Bai, Yi-Xiu; Chu, Jin-Gang; Xiao, Ting; Chen, Hong-Duo


    Autoimmune bullous diseases (AIBDs)-associated interstitial lung disease (ILD) is extremely rare. Pemphigus vulgaris (PV) is an intraepidermal autoimmune blistering disease caused by circulating autoantibodies against desmoglein. To date, PV-associated ILD has rarely been reported in English literature. We report a rare association of PV and ILD. A 53-year-old Chinese female with PV for 8 months developed ILD after a relapse of PV for 2 months due to discontinuation of oral prednisone by herself. She was successfully treated by systemic methylprednisolone. Taken previously reported bullous pemphigoid-associated ILD and linear IgA/IgG bullous dermatosis-associated ILD together, in general, AIBDs-associated ILD occurs when AIBDs relapse or are not controlled, responds well to systemic corticosteroids, and has a relatively better prognosis when compared with rheumatoid arthritis- or dermatomyositis-associated ILD.

  5. Lung alveolar epithelium and interstitial lung disease.


    Corvol, Harriet; Flamein, Florence; Epaud, Ralph; Clement, Annick; Guillot, Loic


    Interstitial lung diseases (ILDs) comprise a group of lung disorders characterized by various levels of inflammation and fibrosis. The current understanding of the mechanisms underlying the development and progression of ILD strongly suggests a central role of the alveolar epithelium. Following injury, alveolar epithelial cells (AECs) may actively participate in the restoration of a normal alveolar architecture through a coordinated process of re-epithelialization, or in the development of fibrosis through a process known as epithelial-mesenchymal transition (EMT). Complex networks orchestrate EMT leading to changes in cell architecture and behaviour, loss of epithelial characteristics and gain of mesenchymal properties. In the lung, AECs themselves may serve as a source of fibroblasts and myofibroblasts by acquiring a mesenchymal phenotype. This review covers recent knowledge on the role of alveolar epithelium in the pathogenesis of ILD. The mechanisms underlying disease progression are discussed, with a main focus on the apoptotic pathway, the endoplasmic reticulum stress response and the developmental pathway.

  6. [Drug-induced interstitial lung diseases].


    Bonniaud, Philippe; Georges, Marjolaine; Favrolt, Nicolas; Camus, Philippe


    Drug-induced infiltrative lung disease may manifest as variable clinical radiological patterns, including subacute or chronic interstitial pneumonia, pulmonary fibrosis, eosinophilic pneumonia, organising pneumonia, pulmonary edema, or sarcoidosis. A large amount of drugs have been incriminated, including those used in cardiovascular diseases (amiodarone, statins and angiotensin converting enzyme inhibitors), antibiotics (minocycline, nitrofurantoin), most of anticancer drugs (and especially chemotherapy and chest radiation), treatment of rheumatoid arthritis, as well as more recent drugs. A high index of suspicion is therefore required in any patient with infiltrative lung disease and the web-based tool will help to list possible causative drugs. The following steps are necessary: history and timing of drug exposure, clinical and imaging pattern, exclusion of other causes of infiltrative lung disease, improvement following drug discontinuation. Rechallenge, dangerous, is not recommended.

  7. Interstitial cells of Cajal in pancreas.


    Popescu, L M; Hinescu, M E; Ionescu, N; Ciontea, Sanda M; Cretoiu, D; Ardelean, Carmen


    We show here (presumably for the first time) a special type of cell in the human and rat exocrine pancreas. These cells have phenotypic characteristics of the enteric interstitial cells of Cajal (ICC). To identify pancreatic interstitial cells of Cajal (pICC) we used routine light microscopy, non-conventional light microscopy (less than 1 mum semi-thin sections of Epon-embedded specimens cut by ultramicrotomy and stained with Toluidine blue), transmission electron microscopy (TEM), and immunocytochemistry. The results showed that pICC can be recognized easily by light microscopy, particularly on semi-thin sections, as well as by TEM. Two-dimensional reconstructions from serial photos suggest a network-like spatial distribution of pICC. pICC represent 3.3+/-0.5% of all pancreatic cells, and seem to establish close spatial relationships with: capillaries (43%), acini (40%), stellate cells (14%), nerve fibres (3%). Most of pICC (88%) have 2 or 3 long processes (tens of mum) emerging from the cell body. TEM data show that pICC meet the criteria for positive diagnosis as ICC (e.g. numerous mitochondria, 8.7+/-0.8% of cytoplasm). Immunocytochemistry revealed that pICC are CD117/c-kit and CD34 positive. We found pICC positive (40-50%) for smooth muscle alpha-actin or S-100, and, occasionally, for CD68, NK1 neurokinin receptor and vimentin. The reactions for desmin and chromogranin A were negative in pICC. At present, only hypotheses and speculations can be formulated on the possible role of the pICC (e.g., juxtacrine and/or paracrine roles). In conclusion, the quite-established dogma: "ICC only in cavitary organs" is overpassed.

  8. Pulmonary interstitial pressure in premature rabbits.


    Miserocchi, G; Poskurica, B H; del Fabbro, M; Crisafulli, B


    By micropuncture technique we measured pulmonary interstitial pressure (Pip) from birth up to 6 h postnatal age in anesthetized and paralyzed cesarian delivered term (31 days gestation) and premature (27 to 30 days gestation) rabbits. In term cesarian delivered rabbits Pip followed the time course of vaginally delivered rabbits, namely, it increased from about zero at birth up to about 5 cmH2O at 2 h, as a result of alveolar fluid reabsorption, subsequently it decreased becoming subatmospheric due to progressive interstitial fluid drainage. In ventilated lung regions of premature rabbits, Pip also peaked to about 5 cmH2O at 2 h but its subsequent decrease was markedly slowed down while in atelectatic regions of premature rabbits Pip remained slightly subatmospheric. Up to 6 h, the wet/dry weight ratio of the lung was higher in premature relative to vaginally and cesarian delivered term rabbits (at birth 8.4 +/- 0.9 vs. 7.5 +/- 0.8). In 29-31 days rabbits, plasma protein concentration at birth was 3.6 +/- 0.5 g/dl (within 95% confidence limits for vaginally delivered rabbits, considered as control) while in 27-28 days rabbit it was 3.1 +/- 0.4 g/dl (at the lower edge of control confidence limits). In the first postnatal hours, the increase in Pip favoured fluid reabsorption into pulmonary microcirculation in term cesarian delivered rabbits and in ventilated regions of premature rabbits. Conversely, in the atelectatic regions of premature rabbits the unchanged Pip value in the postnatal hours favours fluid filtration from microcirculation into lung interstitium.

  9. The multiple faces of leukocyte interstitial migration

    PubMed Central

    Lämmermann, Tim; Germain, Ronald N.


    Spatiotemporal control of leukocyte dynamics within tissues is critical for successful innate and adaptive immune responses. Homeostatic trafficking and coordinated infiltration into and within sites of inflammation and infection rely on signaling in response to extracellular cues that in turn controls a variety of intracellular protein networks regulating leukocyte motility, migration, chemotaxis, positioning, and cell–cell interaction. In contrast to mesenchymal cells, leukocytes migrate in an amoeboid fashion by rapid cycles of actin polymerization and actomyosin contraction, and their migration in tissues is generally referred to as low adhesive and nonproteolytic. The interplay of actin network expansion, contraction, and adhesion shapes the exact mode of amoeboid migration, and in this review, we explore how leukocyte subsets potentially harness the same basic biomechanical mechanisms in a cell-type-specific manner. Most of our detailed understanding of these processes derives from in vitro migration studies in three-dimensional gels and confined spaces that mimic geometrical aspects of physiological tissues. We summarize these in vitro results and then critically compare them to data from intravital imaging of leukocyte interstitial migration in mouse tissues. We outline the technical challenges of obtaining conclusive mechanistic results from intravital studies, discuss leukocyte migration strategies in vivo, and present examples of mode switching during physiological interstitial migration. These findings are also placed in the context of leukocyte migration defects in primary immunodeficiencies. This overview of both in vitro and in vivo studies highlights recent progress in understanding the molecular and biophysical mechanisms that shape robust leukocyte migration responses in physiologically complex and heterogeneous environments. PMID:24573488

  10. Porcine mitral valve interstitial cells in culture.


    Lester, W; Rosenthal, A; Granton, B; Gotlieb, A I


    There are connective tissue cells present within the interstitium of the heart valves. This study was designed to isolate and characterize mitral valve interstitial cells from the anterior leaflet of the mitral valve. Explants obtained from the distal part of the leaflet, having been scraped free of surface endocardial cells, were incubated in medium 199 supplemented with 10% fetal bovine serum. Cells grew out of the explant after 3 to 5 days and by 3 weeks these cells were harvested and passaged. Passages 1 to 22 were characterized in several explant sets. The cells showed a growth pattern reminiscent of fibroblasts. Growth was dependent on serum concentration. Cytoskeletal localization of actin and myosin showed prominent stress fibers. Ultrastructural studies showed many elongated cells with prominent stress fibers and some gap junctions and few adherens junctions. There were as well cells with fewer stress fibers containing prominent Golgi complex and dilated endoplasmic reticulum. In the multilayered superconfluent cultures, the former cells tended to be on the substratum of the dish or surface of the multilayered culture, whereas the latter was generally located within the layer of cells. Extracellular matrix was prominent in superconfluent cultures, often within the layers as well. Labeling of the cells with antibody HHF 35 (Tsukada T, Tippens D, Gordon D, Ross R, Gown AM: Am J Pathol 126:51, 1987), which recognizes smooth muscle cell actin, showed prominent staining of the elongated stress fiber-containing cells and much less in the secretory type cells. These studies show that interstitial mitral valve cells can be grown in culture and that either two different cell types or one cell type with two phenotypic expressions is present in culture.

  11. Comparative studies on extraction of sediment interstitial waters: Discussion and comment on the current state of interstitial water studies

    USGS Publications Warehouse

    Manheim, F. T.


    The implication by Murthy and Ferrell (1972)that interstitial water studies are in a confused state is criticized on the basis that the authors have not drawn on a considerable body of data, especially Soviet studies since the 1950's, and results of the Deep Sea Drilling Project. Pressure filtration systems for extracting interstitial waters are currently the methods of choice for marine studies and have achieved substantial reliability and reproducibility. Although gaps and problems remain, many aspects of interstitial composition of marine sediments have been clarified; these include the substantial constancy of composition of interstitial waters in deep sea pelagic deposits, depletion of interstitial cations owing to authigenic mineral formation in more rapidly accumulated (especially terrigenous) sediments, and special phenomena in sediments overlying salt deposits. ?? 1974.

  12. Reduced boron diffusion under interstitial injection in fluorine implanted silicon

    SciTech Connect

    Kham, M. N.; Matko, I.; Chenevier, B.; Ashburn, P.


    Point defect injection studies are performed to investigate how fluorine implantation influences the diffusion of boron marker layers in both the vacancy-rich and interstitial-rich regions of the fluorine damage profile. A 185 keV, 2.3x10{sup 15} cm{sup -2} F{sup +} implant is made into silicon samples containing multiple boron marker layers and rapid thermal annealing is performed at 1000 deg. C for times of 15-120 s. The boron and fluorine profiles are characterized by secondary ion mass spectroscopy and the defect structures by transmission electron microscopy (TEM). Fluorine implanted samples surprisingly show less boron diffusion under interstitial injection than those under inert anneal. This effect is particularly noticeable for boron marker layers located in the interstitial-rich region of the fluorine damage profile and for short anneal times (15 s). TEM images show a band of dislocation loops around the range of the fluorine implant and the density of dislocation loops is lower under interstitial injection than under inert anneal. It is proposed that interstitial injection accelerates the evolution of interstitial defects into dislocation loops, thereby giving transient enhanced boron diffusion over a shorter period of time. The effect of the fluorine implant on boron diffusion is found to be the opposite for boron marker layers in the interstitial-rich and vacancy-rich regions of the fluorine damage profile. For marker layers in the interstitial-rich region of the fluorine damage profile, the boron diffusion coefficient decreases with anneal time, as is typically seen for transient enhanced diffusion. The boron diffusion under interstitial injection is enhanced by the fluorine implant at short anneal times but suppressed at longer anneal times. It is proposed that this behavior is due to trapping of interstitials at the dislocation loops introduced by the fluorine implant. For boron marker layers in the vacancy-rich region of the fluorine damage profile

  13. Calcium Signaling in Interstitial Cells: Focus on Telocytes

    PubMed Central

    Radu, Beatrice Mihaela; Banciu, Adela; Banciu, Daniel Dumitru; Radu, Mihai; Cretoiu, Dragos; Cretoiu, Sanda Maria


    In this review, we describe the current knowledge on calcium signaling pathways in interstitial cells with a special focus on interstitial cells of Cajal (ICCs), interstitial Cajal-like cells (ICLCs), and telocytes. In detail, we present the generation of Ca2+ oscillations, the inositol triphosphate (IP3)/Ca2+ signaling pathway and modulation exerted by cytokines and vasoactive agents on calcium signaling in interstitial cells. We discuss the physiology and alterations of calcium signaling in interstitial cells, and in particular in telocytes. We describe the physiological contribution of calcium signaling in interstitial cells to the pacemaking activity (e.g., intestinal, urinary, uterine or vascular pacemaking activity) and to the reproductive function. We also present the pathological contribution of calcium signaling in interstitial cells to the aortic valve calcification or intestinal inflammation. Moreover, we summarize the current knowledge of the role played by calcium signaling in telocytes in the uterine, cardiac and urinary physiology, and also in various pathologies, including immune response, uterine and cardiac pathologies. PMID:28208829

  14. Acute Interstitial Nephritis Following Multiple Asian Giant Hornet Stings

    PubMed Central

    Li, Xiang-Dong; Liu, Zheng; Zhai, Ying; Zhao, Ming; Shen, Hai-Yan; Li, Yi; Zhang, Bo; Liu, Tao


    Patient: Male, 42 Final Diagnosis: Acute interstitial nephritis Symptoms: Difficulty breathing • headache • numbness • oliguria Medication: Methylprednisolone Clinical Procedure: Plasma exchange Specialty: Nephrology Objective: Rare disease Background: The Asian giant hornet is the largest wasp species in the world. Its stings can cause acute interstitial nephritis and acute renal failure. From July to October, 2013, Asian giant hornet attacks have killed 42 people and injured 1675 people with their powerful venomous stings in Hanzhong, Ankang, and Shangluo, three cities in the southern part of Shaanxi Province, China. Case Report: We report here a case of a 42-year-old man with acute interstitial nephritis following multiple Asian giant hornet stings. On admission, the patient had difficulty breathing, headache, and numbness in both limbs (arm and leg). He was treated in the Emergency Department and Department of Nephrology with plasma exchange and dialysis within 24 hours after being stung. A kidney biopsy revealed acute interstitial nephritis with interstitial infiltrations of eosinophils and lymphocytes. After intensive treatment, his liver function recovered within 10 days. Along with oral methylprednisolone, his renal function recovered 1 month later. Conclusions: This case shows that acute interstitial nephritis happens several days after being stung. Since the number of deaths in southern Shaanxi province is much higher than other places, our report draws the attention of fellow clinicians to the acute interstitial nephritis following multiple Asian giant hornet stings. PMID:26076055

  15. Calcium Signaling in Interstitial Cells: Focus on Telocytes.


    Radu, Beatrice Mihaela; Banciu, Adela; Banciu, Daniel Dumitru; Radu, Mihai; Cretoiu, Dragos; Cretoiu, Sanda Maria


    In this review, we describe the current knowledge on calcium signaling pathways in interstitial cells with a special focus on interstitial cells of Cajal (ICCs), interstitial Cajal-like cells (ICLCs), and telocytes. In detail, we present the generation of Ca(2+) oscillations, the inositol triphosphate (IP₃)/Ca(2+) signaling pathway and modulation exerted by cytokines and vasoactive agents on calcium signaling in interstitial cells. We discuss the physiology and alterations of calcium signaling in interstitial cells, and in particular in telocytes. We describe the physiological contribution of calcium signaling in interstitial cells to the pacemaking activity (e.g., intestinal, urinary, uterine or vascular pacemaking activity) and to the reproductive function. We also present the pathological contribution of calcium signaling in interstitial cells to the aortic valve calcification or intestinal inflammation. Moreover, we summarize the current knowledge of the role played by calcium signaling in telocytes in the uterine, cardiac and urinary physiology, and also in various pathologies, including immune response, uterine and cardiac pathologies.

  16. Granulomatous interstitial nephritis due to tuberculosis-a rare presentation.


    Sampathkumar, Krishnaswamy; Sooraj, Yesudas S; Mahaldar, Amol R; Ramakrishnan, Muthiah; Rajappannair, Ajeshkumar; Nalumakkal, Seethalekshmy V; Erode, Elango


    Granulomatous interstitial nephritis (GIN) is an uncommon form of acute interstitial nephritis. We report a young male who presented to us with a rapidly progressing renal failure and massive proteinuria. A renal biopsy revealed GIN, and we were able to demonstrate the presence of tuberculous DNA in the biopsy specimen. The patient was started on anti-tuberculous therapy and steroids besides 11 sessions of hemodialysis. He recovered and is currently doing well. This case highlights an uncommon manifestation of renal tuberculosis, namely massive proteinuria, acute renal failure, and granulomatous interstitial lesions.

  17. Glomerular haematuria, renal interstitial haemorrhage and acute kidney injury.


    Martín Cleary, Catalina; Moreno, Juan Antonio; Fernández, Beatriz; Ortiz, Alberto; Parra, Emilio G; Gracia, Carolina; Blanco-Colio, Luis M; Barat, Antonio; Egido, Jesús


    Macroscopic haematuria of glomerular origin has been associated with acute kidney injury. We report a patient with IgA nephropathy, macroscopic haematuria and acute kidney injury. Systemic anticoagulation may have aggravated haematuria. There was extensive interstitial and intratubular red blood cell extravasation, and interstitial haemosiderin deposits. The abundant presence of macrophages expressing the haemoglobin scavenger receptor CD163 and of cells stained for oxidative stress markers (NADPH-p22 phox and heme-oxigenase-1) in areas of interstitial haemorrhage and red blood cell cast-containing tubules provided evidence for a role for free haemoglobin in tubulointerstitial renal injury in human glomerular disease.

  18. [Subsequent pregnancy following uterine artery embolization for interstitial pregnancy].


    Deruelle, P; Closset, E; Lions, C; Lucot, J-P


    Subsequent pregnancy following an interstitial pregnancy is rare. The risk of uterine rupture may be increased in this situation. Uterine selective embolization has been proposed as an effective treatment. However, no further pregnancy has ever been described after this method of management. We are reporting a case of subsequent pregnancy following interstitial pregnancy managed by embolization. The pregnancy was uneventful. A healthy male infant was delivered by C-section. This case supports the hypothesis that selective embolization for interstitial pregnancy may respect fertility. However, as actual risk of uterine rupture in subsequent pregnancies remains unknown, a C-section is advised.

  19. Ecophenotypic plasticity leads to extraordinary gastropod shells found on the “Roof of the World”

    PubMed Central

    Clewing, Catharina; Riedel, Frank; Wilke, Thomas; Albrecht, Christian


    The often extraordinary shell forms and shapes of gastropods found in palaeolakes, such as the highly diverse Gyraulus fauna of the famous Steinheim Basin, have been puzzling evolutionary biologists for centuries, and there is an ongoing debate whether these aberrant shell forms are indicative of true species (or subspecies) or ecophenotypic morphs. Interestingly, one of the Steinheim Gyraulus morphs – a corkscrew-like open-coiled shell – has a recent analogue in the Lake Bangong drainage system on the western Tibetan Plateau. Therefore, a combination of morphological, molecular, palaeolimnological, and ecological analyses was used in this study to assess whether the extraordinary shell shape in Gyraulus sp. from this drainage system represents a (young) ecophenotypic phenomenon or if it has been genetically fixed over an extended period of time. Our morphological, ecological, and palaeolimnological data suggest that the corkscrew-like specimens remain restricted to a small pond near Lake Bangong with an elevated pH value and that the colonization may have occurred recently. The phylogenetic reconstruction based on two gene fragments shows that these nonplanispiral specimens cluster within the previous described Tibetan Plateau Gyraulus clade N2. A network analysis indicates that some haplotypes are even shared by planispiral and nonplanispiral specimens. Given the ephemerality of the phenomenon, the compact network patterns inferred, the likely young phylogenetic age of the aberrant Gyraulus shells studied, and the ecological peculiarities of the study site, we suggest that the evolution of the aberrant shell forms on the Tibetan Plateau could likely be considered as a rapid ecophenotypic response, possibly induced by ecological stress. This finding may thus have implications for the ongoing debate about the processes that have caused the extraordinary shell diversity in palaeolakes such as the Steinheim Basin. PMID:26306180

  20. Growth patterns of an intertidal gastropod as revealed by oxygen isotope analysis

    NASA Astrophysics Data System (ADS)

    Bean, J. R.; Hill, T. M.; Guerra, C.


    The size and morphology of mollusk shells are affected by environmental conditions. As a result, it is difficult to assess growth rate, population age structure, shell morphologies associated with ontogenetic stages, and to compare life history patterns across various environments. Oxygen isotope analysis is a useful tool for estimating minimum ages and growth rates of calcium carbonate secreting organisms. Calcite shell material from members of two northern California populations of the intertidal muricid gastropod Acanthinucella spirata was sampled for isotopic analysis. Individual shells were sampled from apex to margin, thus providing a sequential record of juvenile and adult growth. A. spirata were collected from a sheltered habitat in Tomales Bay and from an exposed reef in Bolinas. Abiotic factors, such as temperature, wave exposure, and substrate consistency, and biotic composition differ significantly between these sites, possibly resulting in local adaptations and variation in life history and growth patterns. Shell morphology of A. spirata changes with age as internal shell margin thickenings of denticle rows associated with external growth bands are irregularly accreted. It is not known when, either seasonally and/or ontogentically, these thickenings and bands form or whether inter or intra-populational variation exists. Preliminary results demonstrate the seasonal oxygen isotopic variability present at the two coastal sites, indicating 5-6 degC changes from winter to summertime temperatures; these data are consistent with local intertidal temperature records. Analysis of the seasonal patterns indicate that: 1) differences in growth rate and seasonal growth patterns at different ontogenetic stages within populations, and 2) differences in growth patterns and possibly age structure between the two A. spirata populations. These findings indicate that isotopic analyses, in addition to field observations and morphological measurements, are necessary to

  1. Haematopoiesis in molluscs: a review of haemocyte development and function in gastropods, cephalopods and bivalves

    PubMed Central

    Pila, EA; Sullivan, JT; Wu, XZ; Fang, J; Rudko, SP; Gordy, MA; Hanington, PC


    Haematopoiesis is a process that is responsible for generating sufficient numbers of blood cells in the circulation and in tissues. It is central to maintenance of homeostasis within an animal, and is critical for defense against infection. While haematopoiesis is common to all animals possessing a circulatory system, the specific mechanisms and ultimate products of haematopoietic events vary greatly. Our understanding of this process in non-vertebrate organisms is primarily derived from those species that serve as developmental and immunological models, with sparse investigations having been carried out in other organisms spanning the metazoa. As research into the regulation of immune and blood cell development advances, we have begun to gain insight into haematopoietic events in a wider array of animals, including the molluscs. What began in the early 1900’s as observational studies on the morphological characteristics of circulating immune cells has now advanced to mechanistic investigations of the cytokines, growth factors, receptors, signalling pathways, and patterns of gene expression that regulate molluscan haemocyte development. Emerging is a picture of an incredible diversity of developmental processes and outcomes that parallels the biological diversity observed within the different classes of the phylum Mollusca. However, our understanding of haematopoiesis in molluscs stems primarily from the three most-studied classes, the Gastropoda, Cephalopoda and Bivalvia. While these represent perhaps the molluscs of greatest economic and medical importance, the fact that our information is limited to only 3 of the 9 extant classes in the phylum highlights the need for further investigation in this area. In this review, we summarize the existing literature that defines haematopoiesis and its products in gastropods, cephalopods and bivalves. PMID:26592965

  2. Molluscs for Sale: Assessment of Freshwater Gastropods and Bivalves in the Ornamental Pet Trade

    PubMed Central

    Tan, Siong Kiat; Wong, Wing Hing; Meier, Rudolf; Chan, Sow-Yan; Tan, Heok Hui; Yeo, Darren C. J.


    The ornamental pet trade is often considered a key culprit for conservation problems such as the introduction of invasive species (including infectious diseases) and overharvesting of rare species. Here, we present the first assessment of the biodiversity of freshwater molluscs in the ornamental pet trade in Singapore, one of the most important global hubs of the ornamental aquarium trade, and discuss associated conservation concerns. We recorded freshwater molluscs from ornamental pet shops and major exporters including non-ornamental species (e.g., hitchhikers, molluscs sold as fish feed). We recorded an unexpectedly high diversity—59 species—of freshwater bivalves and gastropods, with the majority (38 species or 64%) being from the Oriental region. In addition to morphological examination, we sequenced the DNA barcode region of mitochondrial CO1 and 16S genes to provide molecular data for the confirmation of the identification and for future re-identification. DNA barcodes were obtained for 50 species, and all but four were separated by > 3% uncorrected pairwise distances. The trade has been considered a main introduction pathway for non-native species to Singapore, and we found that out of 15 species in the trade as well as in the wild in Singapore, 12 are either introduced or of unknown origin, representing almost half of the known non-native freshwater molluscs in Singapore. Particularly prevalent are non-ornamental species: six hitchhikers on aquarium plants and six species sold as fish feed. We found that a quarter of the trade species have a history of introduction, which includes 11 known or potentially invasive species. We conclude that potential overharvesting is difficult to assess because only half of the trade species have been treated by IUCN. Of these, 21 species are of Least Concern and three are Data Deficient. Our checklist, with accompanying DNA barcodes, images, and museum vouchers, provides an important reference library for future

  3. The Impacts of an Invasive Gastropod Batillaria attramentaria on Benthic Habitats in a Central California bay.

    NASA Astrophysics Data System (ADS)

    Dewar, J.; Bowles, C.; Weiskel, H.; Grosholz, E.


    Invasive species threaten ecosystem function and native biodiversity in many coastal systems. Studies examining the consequences of invasion often focus only on the responses of local species and fail to consider impacts on the sedimentary as well as the biotic environment. In this study, we examine the impacts of a recently introduced deposit feeding gastropod Batillaria attramentaria on the benthic systems in Bodega Harbor, CA. This species reaches extraordinary densities of >14,000 m-2 over significant areas of high intertidal mudflat suggesting the potential for substantial impacts to sedimentary environments as well as both infaunal and epifaunal communities. We conducted short-term enclosure/exclosure experiments using two densities of Batillaria together with cage controls to measure the effects of Batillaria grazing and bioturbation on standing abundance of microalgae (chl a, sediment grain size and percent organics as well as on common infaunal species. Our results demonstrate that over a short time window, Batillaria has a minimal effect on sediment chl a as well as modest effects on sediment organics and grain size. However, Batillaria had a measurable effect on benthic communities substantially reducing densities of small clams Nutricola tantilla, N. confusa and Gemma gemma in high density enclosure experiments. We also used image analysis of bioturbation of grazing snails in laboratory mesocosms and field mark-recapture studies to quantify the area that would be bioturbated by Batillaria as the invasion continues. This species showed very high growth rates at tidal elevations of +3.0 MHHW and the rate of dispersal suggest that the total impact of these deposit feeders at densities that typically exceed 10,000 m-2 can be substantial. However, we suggest that the potential rate of change to the sediment environment as the result of invasion may occur more slowly than changes to benthic infaunal communities, but that high densities over time are likely to

  4. Geographic Variation in Venom Allelic Composition and Diets of the Widespread Predatory Marine Gastropod Conus ebraeus

    PubMed Central

    Duda, Thomas F.; Chang, Dan; Lewis, Brittany D.; Lee, Taehwan


    Background Members of the predatory gastropod genus Conus use a venom comprised of a cocktail of peptide neurotoxins, termed conotoxins or conopeptides, to paralyze prey and conotoxin gene family members diversify via strong positive selection. Because Conus venoms are used primarily to subdue prey, the evolution of venoms is likely affected by predator-prey interactions. Methodology/Principal Findings To identify the selective forces that drive the differentiation of venoms within species of Conus, we examined the distribution of alleles of a polymorphic O-superfamily conotoxin locus of Conus ebraeus at Okinawa, Guam and Hawaii. Previous analyses of mitochondrial cytochrome oxidase I gene sequences suggest that populations of C. ebraeus, a worm-eating Conus, are not structured genetically in the western and central Pacific. Nonetheless, because the sample size from Guam was relatively low, we obtained additional data from this location and reexamined patterns of genetic variation at the mitochondrial gene at Okinawa, Guam and Hawaii. We also utilized a DNA-based approach to identify prey items of individuals of C. ebraeus from Guam and compared this information to published data on diets at Okinawa and Hawaii. Our results show that conotoxin allelic frequencies differ significantly among all three locations, with strongest differentiation at Hawaii. We also confirm previous inferences that C. ebraeus exhibits no genetic differentiation between Okinawa, Guam and Hawaii at the mitochondrial locus. Finally, DNA-based analyses show that eunicid polychaetes comprise the majority of the prey items of C. ebraeus at Guam; while this results compares well with observed diet of this species at Okinawa, C. ebraeus preys predominantly on nereid polychaetes at Hawaii. Conclusions/Significance These results imply that strong selection pressures affect conotoxin allelic frequencies. Based on the dietary information, the selection may derive from geographic variation in dietary

  5. Geographic variation in venom allelic composition and diets of the widespread predatory marine gastropod Conus ebraeus.


    Duda, Thomas F; Chang, Dan; Lewis, Brittany D; Lee, Taehwan


    Members of the predatory gastropod genus Conus use a venom comprised of a cocktail of peptide neurotoxins, termed conotoxins or conopeptides, to paralyze prey and conotoxin gene family members diversify via strong positive selection. Because Conus venoms are used primarily to subdue prey, the evolution of venoms is likely affected by predator-prey interactions. To identify the selective forces that drive the differentiation of venoms within species of Conus, we examined the distribution of alleles of a polymorphic O-superfamily conotoxin locus of Conus ebraeus at Okinawa, Guam and Hawaii. Previous analyses of mitochondrial cytochrome oxidase I gene sequences suggest that populations of C. ebraeus, a worm-eating Conus, are not structured genetically in the western and central Pacific. Nonetheless, because the sample size from Guam was relatively low, we obtained additional data from this location and reexamined patterns of genetic variation at the mitochondrial gene at Okinawa, Guam and Hawaii. We also utilized a DNA-based approach to identify prey items of individuals of C. ebraeus from Guam and compared this information to published data on diets at Okinawa and Hawaii. Our results show that conotoxin allelic frequencies differ significantly among all three locations, with strongest differentiation at Hawaii. We also confirm previous inferences that C. ebraeus exhibits no genetic differentiation between Okinawa, Guam and Hawaii at the mitochondrial locus. Finally, DNA-based analyses show that eunicid polychaetes comprise the majority of the prey items of C. ebraeus at Guam; while this results compares well with observed diet of this species at Okinawa, C. ebraeus preys predominantly on nereid polychaetes at Hawaii. These results imply that strong selection pressures affect conotoxin allelic frequencies. Based on the dietary information, the selection may derive from geographic variation in dietary specialization and local coevolutionary arms races between Conus and

  6. Molluscs for Sale: Assessment of Freshwater Gastropods and Bivalves in the Ornamental Pet Trade.


    Ng, Ting Hui; Tan, Siong Kiat; Wong, Wing Hing; Meier, Rudolf; Chan, Sow-Yan; Tan, Heok Hui; Yeo, Darren C J


    The ornamental pet trade is often considered a key culprit for conservation problems such as the introduction of invasive species (including infectious diseases) and overharvesting of rare species. Here, we present the first assessment of the biodiversity of freshwater molluscs in the ornamental pet trade in Singapore, one of the most important global hubs of the ornamental aquarium trade, and discuss associated conservation concerns. We recorded freshwater molluscs from ornamental pet shops and major exporters including non-ornamental species (e.g., hitchhikers, molluscs sold as fish feed). We recorded an unexpectedly high diversity-59 species-of freshwater bivalves and gastropods, with the majority (38 species or 64%) being from the Oriental region. In addition to morphological examination, we sequenced the DNA barcode region of mitochondrial CO1 and 16S genes to provide molecular data for the confirmation of the identification and for future re-identification. DNA barcodes were obtained for 50 species, and all but four were separated by > 3% uncorrected pairwise distances. The trade has been considered a main introduction pathway for non-native species to Singapore, and we found that out of 15 species in the trade as well as in the wild in Singapore, 12 are either introduced or of unknown origin, representing almost half of the known non-native freshwater molluscs in Singapore. Particularly prevalent are non-ornamental species: six hitchhikers on aquarium plants and six species sold as fish feed. We found that a quarter of the trade species have a history of introduction, which includes 11 known or potentially invasive species. We conclude that potential overharvesting is difficult to assess because only half of the trade species have been treated by IUCN. Of these, 21 species are of Least Concern and three are Data Deficient. Our checklist, with accompanying DNA barcodes, images, and museum vouchers, provides an important reference library for future monitoring

  7. Identifying factors linked to the occurrence of alien gastropods in isolated woodland water bodies

    NASA Astrophysics Data System (ADS)

    Spyra, Aneta; Strzelec, Małgorzata


    Biological invasions are a significant component of human-caused global change and is widely regarded as one of the main threats to natural biodiversity. Isolated anthropogenic water bodies created in the areas that are deprived of natural freshwater habitats allow the survival and reproduction of alien species on newly settled sites. They are often small with water level fluctuations causing frequent environmental disturbances. The colonisation success may be the result of the rate of their degradation. The aims of the study were to determine the environmental conditions that affect the existence of alien species of gastropods in this type of aquatic environment and to examine whether the occurrence of non-native species affects the community structure of the native species. This study made it possible to group woodland ponds according to the occurrence of the three invasive species in snail communities and discuss the environmental conditions present in these pond types. Analysis of water properties emphasised the distinctiveness of the selected pond types. In ponds of the Potamopyrgus antipodarum type, we found the highest values of some parameters mainly hardness, conductivity, and content of calcium and chlorides, in contrast with the Physella acuta type, which were characterised by the lowest values except for phosphates and nitrites. In the Ferrissia fragilis type, we found the highest nitrate content. Data on the occurrence of alien species in different water environments play an important role in actions which are taken to prevent new invasions and spread of non-native species as well as to reduce future impacts of invaders.

  8. Gastropod grazers and nutrients, but not light, interact in determining periphytic algal diversity.


    Liess, Antonia; Kahlert, Maria


    The potential interactions of grazing, nutrients and light in influencing autotroph species diversity have not previously been considered. Earlier studies have shown that grazing and nutrients interact in determining autotroph species diversity, since grazing decreases species diversity when nutrients (i.e. N or P) limit autotroph growth, but increases it when nutrients are replete. We hypothesized that increased light intensities would intensify the interactions between grazing and nutrients on algal species diversity, resulting in even stronger reductions in algal species diversity through grazing under nutrient-poor conditions, and to even stronger increases of algal species diversity through grazing under nutrient-rich conditions. We studied the effects of grazing (absent, present), nutrients (ambient, N + P enriched) and light (low light, high light) on benthic algal diversity and periphyton C:nutrient ratios (which can indicate algal nutrient limitation) in a factorial laboratory experiment, using the gastropod grazer Viviparus viviparus. Grazing decreased algal biomass and algal diversity, but increased C:P and N:P ratios of periphyton. Grazing also affected periphyton species composition, by decreasing the proportion of Spirogyra sp. and increasing the proportion of species in the Chaetophorales. Grazing effects on diversity as well as on periphyton N:P ratios were weakened when nutrients were added (interaction between grazing and nutrients). Chlorophyll a (Chl a) per area increased with nutrient addition and decreased with high light intensities. Light did not increase the strength of the interaction between grazing and nutrients on periphytic algal diversity. This study shows that nutrient addition substantially reduced the negative effects of grazing on periphytic algal diversity, whereas light did not interact with grazing or nutrient enrichment in determining periphytic algal diversity.

  9. Population Genetics of a Trochid Gastropod Broadens Picture of Caribbean Sea Connectivity

    PubMed Central

    Díaz-Ferguson, Edgardo; Haney, Robert; Wares, John; Silliman, Brian


    Background Regional genetic connectivity models are critical for successful conservation and management of marine species. Even though rocky shore invertebrates have been used as model systems to understand genetic structure in some marine environments, our understanding of connectivity in Caribbean communities is based overwhelmingly on studies of tropical fishes and corals. In this study, we investigate population connectivity and diversity of Cittarium pica, an abundant rocky shore trochid gastropod that is commercially harvested across its natural range, from the Bahamas to Venezuela. Methodology/Principal Findings We tested for genetic structure using DNA sequence variation at the mitochondrial COI and 16S loci, AMOVA and distance-based methods. We found substantial differentiation among Caribbean sites. Yet, genetic differentiation was associated only with larger geographic scales within the Caribbean, and the pattern of differentiation only partially matched previous assessments of Caribbean connectivity, including those based on larval dispersal from hydrodynamic models. For instance, the Bahamas, considered an independent region by previous hydrodynamic studies, showed strong association with Eastern Caribbean sites in our study. Further, Bonaire (located in the east and close to the meridional division of the Caribbean basin) seems to be isolated from other Eastern sites. Conclusions/Significance The significant genetic structure and observed in C. pica has some commonalities in pattern with more commonly sampled taxa, but presents features, such as the differentiation of Bonaire, that appear unique. Further, the level of differentiation, together with regional patterns of diversity, has important implications for the application of conservation and management strategies in this commercially harvested species. PMID:20844767

  10. Gastropod diversification and community structuring processes in ancient Lake Ohrid: a metacommunity speciation perspective

    NASA Astrophysics Data System (ADS)

    Hauffe, T.; Albrecht, C.; Wilke, T.


    The Balkan Lake Ohrid is the oldest and most speciose freshwater lacustrine system in Europe. However, it remains unclear whether the diversification of its endemic taxa is mainly driven by neutral processes, environmental factors, or species interactions. This calls for a holistic perspective involving both evolutionary processes and ecological dynamics. Such a unifying framework - the metacommunity speciation model - considers how community assembly affects diversification and vice versa by assessing the relative contribution of the three main community assembly processes, dispersal limitation, environmental filtering, and species interaction. The current study therefore used the species-rich model taxon Gastropoda to assess how extant communities in Lake Ohrid are structured by performing process based metacommunity analyses. Specifically, the study aimed at (i) identifying the relative importance of the three community assembly processes and (ii) to test whether the importance of these individual processes changes gradually with lake depth or whether they are distinctively related to eco-zones. Based on specific simulation steps for each of the three processes, it could be demonstrated that dispersal limitation had the strongest influence on gastropod community structures in Lake Ohrid. However, it was not the exclusive assembly process but acted together with the other two processes - environmental filtering, and species interaction. In fact, the relative importance of the three community assembly processes varied both with lake depth and eco-zones, though the processes were better predicted by the latter. The study thus corroborated the high importance of dispersal limitation for both maintaining species richness in Lake Ohrid (through its impact on community structure) and generating endemic biodiversity (via its influence on diversification processes). However, according to the metacommunity speciation model, the inferred importance of environmental

  11. Conus: first comprehensive conservation red list assessment of a marine gastropod mollusc genus.


    Peters, Howard; O'Leary, Bethan C; Hawkins, Julie P; Carpenter, Kent E; Roberts, Callum M


    Marine molluscs represent an estimated 23% of all extant marine taxa, but research into their conservation status has so far failed to reflect this importance, with minimal inclusion on the authoritative Red List of the International Union for the Conservation of Nature (IUCN). We assessed the status of all 632 valid species of the tropical marine gastropod mollusc, Conus (cone snails), using Red List standards and procedures to lay the groundwork for future decadal monitoring, one of the first fully comprehensive global assessments of a marine taxon. Three-quarters (75.6%) of species were not currently considered at risk of extinction owing to their wide distribution and perceived abundance. However, 6.5% were considered threatened with extinction with a further 4.1% near threatened. Data deficiency prevented 13.8% of species from being categorised although they also possess characteristics that signal concern. Where hotspots of endemism occur, most notably in the Eastern Atlantic, 42.9% of the 98 species from that biogeographical region were classified as threatened or near threatened with extinction. All 14 species included in the highest categories of Critically Endangered and Endangered are endemic to either Cape Verde or Senegal, with each of the three Critically Endangered species restricted to single islands in Cape Verde. Threats to all these species are driven by habitat loss and anthropogenic disturbance, in particular from urban pollution, tourism and coastal development. Our findings show that levels of extinction risk to which cone snails are exposed are of a similar magnitude to those seen in many fully assessed terrestrial taxa. The widely held view that marine species are less at risk is not upheld.

  12. A priming effect of benthic gastropod mucus on sedimentary organic matter remineralization

    NASA Astrophysics Data System (ADS)

    Hannides, A. K.; Aller, R. C.


    Mucous gels are produced by benthic animals rapidly and in copious amounts, and have previously been shown to significantly affect diffusion rates of redox-sensitive ions and organic compounds in sediment pore waters. They are also a highly likely priming substrate whose addition in modest amounts affects sedimentary organic matter remineralization. We tested the priming effect of benthic infaunal mucus using secretions of the common gastropod Neverita duplicata as model substrate. Their composition is typical of marine molluscan mucus, consisting primarily of water (>96% by weight), which is in relative equilibrium with seawater. Salt-free dry weight constitutes 0.7% and 0.6% of total pedal and hypobranchial mucus, respectively. The C:N ratios of pedal and hypobranchial mucus indicate that the organic component consists of a mucopolysaccharide-glycoprotein complex that varies depending on its function, while low C:S ratios of the insoluble component and positive staining with Alcian Blue dye are indicative of S-ester and alkyl-SO42- groups bridging mucopolysaccharide and glycoprotein components. Anoxic incubations of pedal mucus of N. duplicata, sediment, and mucus-sediment mixture, resulted in the anaerobic generation of ΣCO2 and NH4+ at ratios lower than initial C:N ratios, indicating the preferential decomposition of N-rich moieties. Production rates of SCO2 and NH4+ in mucus-sediment incubations are higher, by 9±16% and 29±11%, respectively, than those predicted from linear addition of mucus-only and sediment-only rates. The statistically significant accelerated remineralization rate of N in the presence of modest mucus contribution (0.2% of total N), suggests that benthic mucus addition affects sedimentary organic matter remineralization processes through a "priming" effect.

  13. Effect of tidal regime on the thermal tolerance of the marine gastropod Lunella smaragda (Gmelin 1791).


    Mortensen, B J D; Dunphy, B J


    The tidal cycle around New Zealand results in spring low tides consistently occurring during the hottest part of the day (mid-afternoon) in north-eastern New Zealand, and during the cooler dawn/dusk periods in the north-west of the country. We hypothesised that due to mid-afternoon spring low tides, intertidal populations residing at north-eastern sites would show greater thermotolerance than their north-west conspecifics. To test this we used the marine gastropod, Lunella smaragda, which were collected from sites on both the East and West coasts of the Auckland region and exposed to an acute heat shock. Thermotolerance was measured as survivorship (LT50), drop down time (time to heat coma) and thermal stability of the anaerobic energy producing enzyme Tauropine dehydrogenase. Furthermore, temperature loggers were deployed at each site so as to record and compare thermal regimes among sites. A strong temperature spike associated with spring low tide was found at all sites, and maximal temperatures of all East coast sites were higher than West coast sites (in some case by up to 10°C). In terms of thermotolerance, mortality of L. smaragda occurred at 42°C leading to 100% mortality at 45°C. However, comparison of LT50 showed snails were equally thermotolerant regardless of site of collection. Similar results were found in TDH thermal stability with animals from all sites showing an approximately 80% decrease in enzyme activity after 10min exposure to 42°C. Whilst drop down times were different among sites these were correlated with animal size as opposed to site of collection. Thus, East coast populations of L. smaragda appear no more thermotolerant than their West coast counterparts. Such a result is concerning as maximal temperatures at East coast sites already exceed the LT50 values of L. smaragda recorded in the lab suggesting these populations have less of a thermal safety margin.

  14. Haematopoiesis in molluscs: A review of haemocyte development and function in gastropods, cephalopods and bivalves.


    Pila, E A; Sullivan, J T; Wu, X Z; Fang, J; Rudko, S P; Gordy, M A; Hanington, P C


    Haematopoiesis is a process that is responsible for generating sufficient numbers of blood cells in the circulation and in tissues. It is central to maintenance of homeostasis within an animal, and is critical for defense against infection. While haematopoiesis is common to all animals possessing a circulatory system, the specific mechanisms and ultimate products of haematopoietic events vary greatly. Our understanding of this process in non-vertebrate organisms is primarily derived from those species that serve as developmental and immunological models, with sparse investigations having been carried out in other organisms spanning the metazoa. As research into the regulation of immune and blood cell development advances, we have begun to gain insight into haematopoietic events in a wider array of animals, including the molluscs. What began in the early 1900's as observational studies on the morphological characteristics of circulating immune cells has now advanced to mechanistic investigations of the cytokines, growth factors, receptors, signalling pathways, and patterns of gene expression that regulate molluscan haemocyte development. Emerging is a picture of an incredible diversity of developmental processes and outcomes that parallels the biological diversity observed within the different classes of the phylum Mollusca. However, our understanding of haematopoiesis in molluscs stems primarily from the three most-studied classes, the Gastropoda, Cephalopoda and Bivalvia. While these represent perhaps the molluscs of greatest economic and medical importance, the fact that our information is limited to only 3 of the 9 extant classes in the phylum highlights the need for further investigation in this area. In this review, we summarize the existing literature that defines haematopoiesis and its products in gastropods, cephalopods and bivalves.

  15. Dietary preferences of two seagrass inhabiting gastropods: Allochthonous vs autochthonous resources

    NASA Astrophysics Data System (ADS)

    Doropoulos, C.; Hyndes, G. A.; Lavery, P. S.; Tuya, F.


    The movement of allochthonous resources between habitats can provide important trophic linkages in marine landscapes. In coastal south-western Australia, the kelp Ecklonia radiata is removed from reefs and accumulates in large quantities in neighbouring seagrass meadows. This study investigated the feeding preferences and grazing rates of two locally abundant gastropods, Pyrene bidentata and Cantharidus lepidus, which exhibit inverse distribution patterns with proximity to reefs in seagrass meadows, to determine whether allochthonous kelp has the potential to contribute to the seagrass food web. Using laboratory choice and no-choice feeding experiments, we tested whether detached kelp is consumed preferentially, and at greater rates, by these two species than autochthonous resources (i.e. seagrass, epiphytic red macroalgae and seagrass periphyton). Both species displayed a preference for macroalgae and seagrass periphyton over seagrass leaves. In choice experiments, neither species displayed any clear preference between kelp (fresh or aged), red macroalgae or periphyton (consumption rates ranged between 0.39 and 3.64 mg ind -1 day -1), but consumption rates were always higher relative to seagrass. In no-choice experiments, P. bidentata displayed minimal consumption of seagrass, but consumed fresh and aged kelp, red macroalgae and seagrass periphyton at similar rates (2.00-7.22 mg ind -1 day -1). In comparison, C. lepidus consumed periphyton at far greater rates than any other food source (3.61 vs 0.33-1.10 mg ind -1 day -1). The results indicate that both P. bidentata and C. lepidus showed a clear preference for macroalgae and periphyton over seagrass, but no consistent preference towards any autochthonous or allochthonous algal resource. Reef-derived kelp therefore has the potential to contribute to the food web of seagrass meadows, and subsidise secondary production.

  16. Recurrent camouflaged invasions and dispersal of an Asian freshwater gastropod in tropical Africa.


    Van Bocxlaer, Bert; Clewing, Catharina; Mongindo Etimosundja, Jean-Papy; Kankonda, Alidor; Wembo Ndeo, Oscar; Albrecht, Christian


    Non-indigenous taxa currently represent a large fraction of the species and biomass of freshwater ecosystems. The accumulation of invasive taxa in combination with other stressors in these ecosystems may alter the habitats to which native taxa are adapted, which could elicit evolutionary changes in native populations and their ecological interactions. Assessing ecological and evolutionary consequences of invasions simultaneously may therefore be the most effective approach to study taxa with complex invasion histories. Here we apply such an integrated approach to the cerithioid gastropod Melanoides tuberculata, a model system in invasion biology. Molecular phylogenetics and ancestral range reconstructions allowed us to identify several independent Asian invasions in Lakes Malawi and Tanganyika, the Congo River, Nigeria and Cameroon. Some invasive M. tuberculata populations display much variation in shell morphology, and overlap in morphospace with M. tuberculata populations native to Africa. Experiments confirmed great ecophenotyic plasticity in some invasive populations, which, in combination with the overlap in disparity with native populations, masks invaders and their dispersal through Africa. Finally, the results of geographic modeling indicate that cryptic M. tuberculata invasions occurred primarily in densely populated areas. We reveal the continental nature of invasions of Asian M. tuberculata to Africa. Several of the affected ecosystems have high endemicity in Cerithioidea: Lake Tanganyika has an unparalleled diversity in freshwater cerithioids (>10 endemic genera) and the Congo Basin and Lake Malawi are home to the two largest endemic species clusters of Melanoides in Africa (~12 and ~8 species, respectively). Cerithioids perform ecologically important functions in the benthic ecosystems of African freshwaters, but invaders and ecosystem change pose risks to their native diversity. We draw suggestions for more effective conservation strategies from our

  17. De novo transcriptome assembly of the marine gastropod Reishia clavigera for supporting toxic mechanism studies.


    Ip, Jack C H; Leung, Priscilla T Y; Ho, Kevin K Y; Qiu, J W; Leung, Kenneth M Y


    The intertidal whelk Reishia clavigera is commonly used as a biomonitor of chemical contamination in the marine environment along Western Pacific region, and as a model for mechanistic studies of organotin-mediated imposex development. However, limited genomic resources of R. clavigera have restricted its role for the investigation of molecular mechanisms of such endocrine disruptions. This study, therefore, aimed to establish tissue-specific transcriptomes of the digestive gland, gonad, head ganglia, penis and the remaining body part of the male and female R. clavigera. By combining the results, a global transcriptome was obtained. A total of 578,134,720 high-quality filtered reads were obtained using Illumina sequencing. The R. clavigera transcriptome comprised of 38,466 transcripts and 32,798 unigenes with predicted open reading frames. The average length of transcripts was 1,709bp with N50 of 2,236bp. Based on sequence similarity searches against public databases, 28,657 transcripts and 24,403 unigenes had at least one BLAST hit. There were 17,530 transcripts and 14,897 unigenes annotated with at least one Gene Ontology (GO) term. Moreover, 5,776 transcripts and 5,137 unigenes were associated with 333 Kyoto Encyclopaedia of Genes and Genomes (KEGG) pathways. The numbers of unigenes were similar among the five target tissues and between sexes, but tissue-specific expression profiles were revealed by multivariate analyses. Based on the functional annotation, putative steroid hormone-associated unigenes were identified. In particular, we highlighted the presence of steroid hormone receptor homologues that could be the targets for mechanistic studies of the organotin-mediated imposex development in marine gastropods. This newly generated transcriptome assembly of R. clavigera provides a valuable molecular resource for ecotoxicological and environmental genomic studies. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Surveys of arthropod and gastropod diversity in the geothermal resource subzones, Puna, Hawaii

    SciTech Connect

    Miller, S.E.; Burgett, J.; Bruegmann, M.


    The invertebrate surveys reported here were carried out as part of ecological studies funded by the Department of Energy in support of their environmental impact statement (EIS) for the Hawaii Geothermal Project. Currently, preparation of the EIS has been suspended, and all supporting information is being archived and made available to the public. The invertebrate surveys reported here assessed diversity and abundance of the arthropod and gastropod fauna in forested habitat and lava tubes in or near the three geothermal resource subzones. Recommendations for conservation of these organisms are given in this report. Surveys were conducted along three 100-m transect lines at each of the six forested locations. Malaise traps, baited pitfall traps, yellow pan traps, baited sponge lures, and visual examination of vegetation were used to assess invertebrate diversity along each transect line. Three of these locations were adjacent to roads, and three were adjacent to lava flows. Two of these lava-forest locations (Keauohana Forest Reserve and Pu`u O`o) were relatively remote from direct human impacts. The third location (Southeast Kula) was near a low-density residential area. Two lava tubes were surveyed. The forest over one of these tubes (Keokea tube) had recently been burned away. This tube was used to assess the effects of loss of forest habitat on the subterranean fauna. An undisturbed tube (Pahoa tube) was used as a control. Recommendations offered in this report direct geothermal development away from areas of high endemic diversity and abundance, and toward areas where natural Hawaiian biotic communities have already been greatly disturbed. These disturbed areas are mainly found in the lower half of the Kamaili (middle) geothermal subzone and throughout most of the Kapoho (lower) geothermal subzone. These recommendation may also generally apply to other development projects in the Puna District.

  19. Conus: First Comprehensive Conservation Red List Assessment of a Marine Gastropod Mollusc Genus

    PubMed Central

    Peters, Howard; O'Leary, Bethan C.; Hawkins, Julie P.; Carpenter, Kent E.; Roberts, Callum M.


    Marine molluscs represent an estimated 23% of all extant marine taxa, but research into their conservation status has so far failed to reflect this importance, with minimal inclusion on the authoritative Red List of the International Union for the Conservation of Nature (IUCN). We assessed the status of all 632 valid species of the tropical marine gastropod mollusc, Conus (cone snails), using Red List standards and procedures to lay the groundwork for future decadal monitoring, one of the first fully comprehensive global assessments of a marine taxon. Three-quarters (75.6%) of species were not currently considered at risk of extinction owing to their wide distribution and perceived abundance. However, 6.5% were considered threatened with extinction with a further 4.1% near threatened. Data deficiency prevented 13.8% of species from being categorised although they also possess characteristics that signal concern. Where hotspots of endemism occur, most notably in the Eastern Atlantic, 42.9% of the 98 species from that biogeographical region were classified as threatened or near threatened with extinction. All 14 species included in the highest categories of Critically Endangered and Endangered are endemic to either Cape Verde or Senegal, with each of the three Critically Endangered species restricted to single islands in Cape Verde. Threats to all these species are driven by habitat loss and anthropogenic disturbance, in particular from urban pollution, tourism and coastal development. Our findings show that levels of extinction risk to which cone snails are exposed are of a similar magnitude to those seen in many fully assessed terrestrial taxa. The widely held view that marine species are less at risk is not upheld. PMID:24376693

  20. Phenotypic differentiation of the Red Sea gastropods in response to the environmental deterioration: Geometric morphometric approach

    NASA Astrophysics Data System (ADS)

    Abdelhady, Ahmed Awad


    The negative impacts of degradation in the coastal zone of the Red Sea are becoming well known in upper portions of the trophic web (e.g., humans and fish), but are less well known among the benthic primary consumers. In addition, the degree to which heavy metals are entering the trophic web can be better-quantified using macrobenthos. Two-gastropod genera encompassing Echinolittorina subnodosa and Planaxis sulcatus from three different localities on the Egyptian coast of the Red Sea were examined in order to deduce the impact of environmental deterioration on the morphology of shells. The examined sites include clean pristine, slightly polluted, and markedly polluted rocky shores. Phosphate/lead industry is the main source of pollution in this zone. Because landmarks on the rugose Echinolittorina are difficult to define and to ensure finer resolution of the analyses, a newly 'grid-based' landmarks was implemented. Both Canonical Variate Analysis (CVA) and Thin Plate Spline (TPS) were particularly capable to capture and terrace the minor morphological variations accurately. Two phenotypes portioned among the environmentally different populations were recognized and interpreted as ecotypes with many intermediate forms. The first ecotype has a higher spire and smaller aperture and dominating the pristine site North of Marsa Alam, whereas the second ecotype has a globular shell shape with big aperture and dominating the markedly polluted site. The intermediate forms dominating the slightly polluted site. The shape differences are interpreted as an adaptive differentiation to different metal concentrations. As the morphological variation between the two-ecotypes of both taxa is still minors, and both ecotypes occur together with many intermediate forms, the phenotypic divergence stage has not yet accomplished. The gradational shape change among the investigated populations was positively correlated with index of Pollution (IP). As the human activities were the main

  1. Development of cardiovascular function in the marine gastropod Littorina obtusata (Linnaeus).


    Bitterli, Tabitha S; Rundle, Simon D; Spicer, John I


    The molluscan cardiovascular system typically incorporates a transient extracardiac structure, the larval heart, early in development, but the functional importance of this structure is unclear. We documented the ontogeny and regulatory ability of the larval heart in relation to two other circulatory structures, the true heart and the velum, in the intertidal gastropod Littorina obtusata. There was a mismatch between the appearance of the larval heart and the velum. Velar lobes appeared early in development (day 4), but the larval heart did not begin beating until day 13. The beating of the larval heart reached a maximum on day 17 and then decreased until the structure itself disappeared (day 24). The true heart began to beat on day 17. Its rate of beating increased as that of the larval heart decreased, possibly suggesting a gradual shift from a larval heart-driven to a true heart-driven circulation. The true heart was not sensitive to acutely declining P(O(2)) shortly after it began to beat, but increased in activity in response to acutely declining P(O(2)) by day 21. Larval heart responses were similar to those of the true heart, with early insensitivity to declining P(O(2)) (day 13) followed by a response by day 15. Increased velum-driven rotational activity under acutely declining P(O(2)) was greatest in early developmental stages. Together, these findings point to cardiovascular function in L. obtusata larvae being the result of a complex interaction between velum, larval and true heart activities, with the functions of the three structures coinciding but their relative importance changing throughout larval development.

  2. Directional interstitial brachytherapy from simulation to application

    NASA Astrophysics Data System (ADS)

    Lin, Liyong

    Organs at risk (OAR) are sometimes adjacent to or embedded in or overlap with the clinical target volume (CTV) to be treated. The purpose of this PhD study is to develop directionally low energy gamma-emitting interstitial brachytherapy sources. These sources can be applied between OAR to selectively reduce hot spots in the OARs and normal tissues. The reduction of dose over undesired regions can expand patient eligibility or reduce toxicities for the treatment by conventional interstitial brachytherapy. This study covers the development of a directional source from design optimization to construction of the first prototype source. The Monte Carlo code MCNP was used to simulate the radiation transport for the designs of directional sources. We have made a special construction kit to assemble radioactive and gold-shield components precisely into D-shaped titanium containers of the first directional source. Directional sources have a similar dose distribution as conventional sources on the treated side but greatly reduced dose on the shielded side, with a sharp dose gradient between them. A three-dimensional dose deposition kernel for the 125I directional source has been calculated. Treatment plans can use both directional and conventional 125I sources at the same source strength for low-dose-rate (LDR) implants to optimize the dose distributions. For prostate tumors, directional 125I LDR brachytherapy can potentially reduce genitourinary and gastrointestinal toxicities and improve potency preservation for low risk patients. The combination of better dose distribution of directional implants and better therapeutic ratio between tumor response and late reactions enables a novel temporary LDR treatment, as opposed to permanent or high-dose-rate (HDR) brachytherapy for the intermediate risk T2b and high risk T2c tumors. Supplemental external-beam treatments can be shortened with a better brachytherapy boost for T3 tumors. In conclusion, we have successfully finished the

  3. Interstitial rotating shield brachytherapy for prostate cancer

    SciTech Connect

    Adams, Quentin E. Xu, Jinghzu; Breitbach, Elizabeth K.; Li, Xing; Rockey, William R.; Kim, Yusung; Wu, Xiaodong; Flynn, Ryan T.; Enger, Shirin A.


    Purpose: To present a novel needle, catheter, and radiation source system for interstitial rotating shield brachytherapy (I-RSBT) of the prostate. I-RSBT is a promising technique for reducing urethra, rectum, and bladder dose relative to conventional interstitial high-dose-rate brachytherapy (HDR-BT). Methods: A wire-mounted 62 GBq{sup 153}Gd source is proposed with an encapsulated diameter of 0.59 mm, active diameter of 0.44 mm, and active length of 10 mm. A concept model I-RSBT needle/catheter pair was constructed using concentric 50 and 75 μm thick nickel-titanium alloy (nitinol) tubes. The needle is 16-gauge (1.651 mm) in outer diameter and the catheter contains a 535 μm thick platinum shield. I-RSBT and conventional HDR-BT treatment plans for a prostate cancer patient were generated based on Monte Carlo dose calculations. In order to minimize urethral dose, urethral dose gradient volumes within 0–5 mm of the urethra surface were allowed to receive doses less than the prescribed dose of 100%. Results: The platinum shield reduced the dose rate on the shielded side of the source at 1 cm off-axis to 6.4% of the dose rate on the unshielded side. For the case considered, for the same minimum dose to the hottest 98% of the clinical target volume (D{sub 98%}), I-RSBT reduced urethral D{sub 0.1cc} below that of conventional HDR-BT by 29%, 33%, 38%, and 44% for urethral dose gradient volumes within 0, 1, 3, and 5 mm of the urethra surface, respectively. Percentages are expressed relative to the prescription dose of 100%. For the case considered, for the same urethral dose gradient volumes, rectum D{sub 1cc} was reduced by 7%, 6%, 6%, and 6%, respectively, and bladder D{sub 1cc} was reduced by 4%, 5%, 5%, and 6%, respectively. Treatment time to deliver 20 Gy with I-RSBT was 154 min with ten 62 GBq {sup 153}Gd sources. Conclusions: For the case considered, the proposed{sup 153}Gd-based I-RSBT system has the potential to lower the urethral dose relative to HDR-BT by 29

  4. Cenozoic climate change and diversification on the continental shelf and slope: evolution of gastropod diversity in the family Solariellidae (Trochoidea).


    Williams, S T; Smith, L M; Herbert, D G; Marshall, B A; Warén, A; Kiel, S; Dyal, P; Linse, K; Vilvens, C; Kano, Y


    Recent expeditions have revealed high levels of biodiversity in the tropical deep-sea, yet little is known about the age or origin of this biodiversity, and large-scale molecular studies are still few in number. In this study, we had access to the largest number of solariellid gastropods ever collected for molecular studies, including many rare and unusual taxa. We used a Bayesian chronogram of these deep-sea gastropods (1) to test the hypothesis that deep-water communities arose onshore, (2) to determine whether Antarctica acted as a source of diversity for deep-water communities elsewhere and (3) to determine how factors like global climate change have affected evolution on the continental slope. We show that although fossil data suggest that solariellid gastropods likely arose in a shallow, tropical environment, interpretation of the molecular data is equivocal with respect to the origin of the group. On the other hand, the molecular data clearly show that Antarctic species sampled represent a recent invasion, rather than a relictual ancestral lineage. We also show that an abrupt period of global warming during the Palaeocene Eocene Thermal Maximum (PETM) leaves no molecular record of change in diversification rate in solariellids and that the group radiated before the PETM. Conversely, there is a substantial, although not significant increase in the rate of diversification of a major clade approximately 33.7 Mya, coinciding with a period of global cooling at the Eocene-Oligocene transition. Increased nutrients made available by contemporaneous changes to erosion, ocean circulation, tectonic events and upwelling may explain increased diversification, suggesting that food availability may have been a factor limiting exploitation of deep-sea habitats. Tectonic events that shaped diversification in reef-associated taxa and deep-water squat lobsters in central Indo-West Pacific were also probably important in the evolution of solariellids during the Oligo-Miocene.

  5. Spatial variability in the structure of intertidal crab and gastropod assemblages within the Seychelles Archipelago (Indian Ocean)

    NASA Astrophysics Data System (ADS)

    Smale, Dan A.; Barnes, David K. A.; Barnes, Richard S. K.; Smith, David J.; Suggett, David J.


    Tropical nearshore ecosystems represent global hotspots of marine biodiversity and endemism but are often poorly understood and impacted by human activities. The Seychelles Archipelago (Western Indian Ocean) sustains a wealth of marine life, much of which is threatened by rapid development associated with tourism and climate change. Six marine parks exist within the Archipelago, but their biodiversity value and ecological health are poorly known, especially with regards to non-fish and coral species. Here we investigate spatial patterns of littoral biodiversity on 6 islands, 5 of which were granitic and within marine parks, including the first surveys of Curieuse and Ile Cocos. Our surveys formed a nested sampling design, to facilitate an examination of variability in species richness, faunal abundance, taxonomic distinctness and assemblage composition at multiple spatial scales, from islands (> 100 s km) to quadrats (metres). We identified (mostly to species) and enumerated two target taxa, brachyuran decapod crustaceans and gastropod molluscs, and recorded over 8300 individuals belonging to over 150 species. Crabs and gastropods exhibited different patterns of spatial variability, as crab assemblages were generally more distinct between islands, while gastropod assemblages were markedly variable at the smallest spatial scales of 'patch' and 'quadrat'. Intertidal biodiversity was greatest on Curieuse Island and least at Desroches, the latter was being the only coral atoll we surveyed and thereby differing in its geological and ecological context. We discuss likely drivers of these biodiversity patterns and highlight urgently-needed research directions. Our assessment of the status of poorly-known invertebrate assemblages across the Seychelles will complement more extensive surveys of coral and fish assemblages and, in doing so, provide a useful baseline for monitoring the effects of key stressors in the region, such as coastal development and climate change.

  6. Cenozoic climate change and diversification on the continental shelf and slope: evolution of gastropod diversity in the family Solariellidae (Trochoidea)

    PubMed Central

    Williams, S T; Smith, L M; Herbert, D G; Marshall, B A; Warén, A; Kiel, S; Dyal, P; Linse, K; Vilvens, C; Kano, Y


    Recent expeditions have revealed high levels of biodiversity in the tropical deep-sea, yet little is known about the age or origin of this biodiversity, and large-scale molecular studies are still few in number. In this study, we had access to the largest number of solariellid gastropods ever collected for molecular studies, including many rare and unusual taxa. We used a Bayesian chronogram of these deep-sea gastropods (1) to test the hypothesis that deep-water communities arose onshore, (2) to determine whether Antarctica acted as a source of diversity for deep-water communities elsewhere and (3) to determine how factors like global climate change have affected evolution on the continental slope. We show that although fossil data suggest that solariellid gastropods likely arose in a shallow, tropical environment, interpretation of the molecular data is equivocal with respect to the origin of the group. On the other hand, the molecular data clearly show that Antarctic species sampled represent a recent invasion, rather than a relictual ancestral lineage. We also show that an abrupt period of global warming during the Palaeocene Eocene Thermal Maximum (PETM) leaves no molecular record of change in diversification rate in solariellids and that the group radiated before the PETM. Conversely, there is a substantial, although not significant increase in the rate of diversification of a major clade approximately 33.7 Mya, coinciding with a period of global cooling at the Eocene–Oligocene transition. Increased nutrients made available by contemporaneous changes to erosion, ocean circulation, tectonic events and upwelling may explain increased diversification, suggesting that food availability may have been a factor limiting exploitation of deep-sea habitats. Tectonic events that shaped diversification in reef-associated taxa and deep-water squat lobsters in central Indo-West Pacific were also probably important in the evolution of solariellids during the Oligo

  7. Beginning of a new age: How did freshwater gastropods respond to the Quaternary climate change in Europe?

    NASA Astrophysics Data System (ADS)

    Georgopoulou, Elisavet; Neubauer, Thomas A.; Strona, Giovanni; Kroh, Andreas; Mandic, Oleg; Harzhauser, Mathias


    The well documented fossil record of European Quaternary freshwater gastropods offers a unique resource for continental-scale biogeographical analyses. Here, we assembled a dataset including 338 freshwater gastropod taxa from 1058 localities across Europe, which we used to explore how freshwater gastropod communities varied in space and time across six distinct time intervals of the Quaternary, i.e. Gelasian, Calabrian, Middle Pleistocene, Last Interglacial, Last Glacial and Holocene. We took into consideration both species richness and qualitative structural patterns, comparing turnover rates between time intervals and examining variations in community nestedness-segregation patterns. Species richness differed significantly between time intervals. The Early Pleistocene showed the highest diversity, likely because of the contribution of long-lived aquatic systems like the lakes Bresse and Tiberino that promoted speciation and endemism. The rich Middle to Late Pleistocene and Holocene assemblages were mostly linked to fluvial and/or lacustrine systems with short temporal durations. We identified a major turnover event at the Plio-Pleistocene boundary, related to the demise of long-lived lakes and of their rich, endemic faunas at the end of the Pliocene. In the subsequent intervals, little or no turnover was observed. We also observed a pattern of high segregation in Early Pleistocene communities, associated with the abundance of endemic species with small distribution ranges, and reflecting the provincial character of the aquatic freshwater systems at that time. This structured pattern disintegrated gradually towards the Middle Pleistocene and remained unstructured up to present. In particular, spatial patterns of community nestedness-segregation in the Last Interglacial and Holocene suggest a random recolonization of freshwater habitats mostly by generalist species following deglaciation.

  8. Failure of Gallium-67 scintigraphy to identify reliably noninfectious interstitial nephritis: concise communication

    SciTech Connect

    Graham, G.D.; Lundy, M.M.; Moreno, A.J.


    Gallium-67 scintigraphy has been reported to be useful in the diagnosis of noninfectious interstitial nephritis. We studied 12 patients with Ga-67 citrate that were diagnosed as having noninfectious interstitial nephritis on renal biopsy. Only seven of the twelve patients with interstitial nephritis on biopsy were scan-positive. Gallium-67 scintigraphy may not reliably identify noninfectious interstitial nephritis.

  9. CT in the diagnosis of interstitial lung disease

    SciTech Connect

    Bergin, C.J.; Mueller, N.L.


    The computed tomographic (CT) appearance of interstitial lung disease was assessed in 23 patients with known interstitial disease. These included seven patients with fibrosing alveolitis, six with silicosis, two with hypersensitivity pneumonitis, three with lymphangitic spread of tumor, two with sarcoidosis, one with rheumatoid lung disease, and two with neurofibromatosis. The CT appearance of the interstitial changes in the different disease entities was assessed. Nodules were a prominent CT feature in silicosis, sarcoidosis, and lymphangitic spread of malignancy. Distribution of nodules and associated interlobular septal thickening provided further distinguishing features in these diseases. Reticular densities were the predominant CT change in fibrosing alveolitis, rheumatoid lung disease, and extrinsic allergic alveolitis. CT can be useful in the investigation of selected instances of interstitial pulmonary disease.

  10. [Key features in the management of diffuse interstitial pulmonary disease].


    Fernández, David Iturbe; Sánchez, Ricardo Peris; Moreno, Alicia Ferreira; Fernández Fabrellas, Estrella


    Diffuse interstitial lung disease is a heterogeneous group of diseases in which the common denominator is involvement of the area between the basement membrane of the alveolar epithelium and the capillary endothelium, known as the interstitial space. Diffuse interstitial lung disease poses a tremendous challenge to the clinician due to the diagnostic approach, the complications that can appear in the natural history of these entities, and the scarcity of available therapeutic resources. This brief review discusses key features of the management of diffuse interstitial pulmonary disease, such as prognostic factors, the therapeutic options -including the role of lung transplantation- and the diagnosis and treatment of two complications with crucial impact on the clinical course of the disease: exacerbations and associated pulmonary hypertension. Copyright © 2009 Sociedad Española de Neumología y Cirugía Torácica. Published by Elsevier Espana. All rights reserved.

  11. Phenotypic characterization of rare interstitial deletion of chromosome 4

    PubMed Central

    Ismail, Samira; Helmy, Nivine A.; Mahmoud, Wael M.; El-Ruby, Mona O.


    Interstitial deletion of the long arm of chromosome 4 is rare. Patients with interstitial deletion of the long arm of chromosome 4 differ from those with terminal deletions. Phenotypes may be variable, depending upon the specific length and location of the deleted portion. Here, we report on a boy exhibiting most of the congenital malformations encountered in terminal 4q syndrome. The conventional karyotyping and Fluorescence in-situ hybridization revealed a de novo interstitial del (4)(q31q32). The current report is a further document highlighting that deletion of segment q31 could be contributing to the expression of most of the phenotype of 4q deletion syndrome. Using array comparative genome hybridization methodology is recommended for investigating further cases with similar segmental interstitial deletions to support and delineate findings and to define genes implicated in the pathogenesis of the disorder. PMID:27625821

  12. View of first level from north showing interstitial structural columns ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    View of first level from north showing interstitial structural columns for the Shuttle assemble configuration. - Marshall Space Flight Center, Saturn V Dynamic Test Facility, East Test Area, Huntsville, Madison County, AL

  13. Complexes of self-interstitials with oxygen atoms in Ge

    SciTech Connect

    Khirunenko, L. I.; Pomozov, Yu. V.; Sosnin, M. G.; Abrosimov, N. V.; Riemann, H.


    Interactions of germanium self-interstitials with interstitial oxygen atoms in Ge subjected to irradiation at ∼80 K and subsequently to annealing have been studied. To distinguish the processes involving vacancies and self-interstitials the doping with tin was used. It was shown that absorption lines with maximum at 602, 674, 713 and 803 cm{sup −1} are self-interstitials-related. Two lines at 602 and 674, which develop upon annealing in the temperature range 180–240 K, belong to IO complexes, while the bands at 713 and 803 cm{sup −1}, which emerge after annealing at T>220 K, are associated with I{sub 2}O. It is argued that the annealing of IO occurs by two mechanisms: by dissociation and by diffusion.

  14. Management of interstitial pregnancy using selective uterine artery embolization.


    Deruelle, Philippe; Lucot, Jean-Philippe; Lions, Christophe; Robert, Yann


    Interstitial pregnancy is a rare and dangerous form of ectopic pregnancy which is treated by surgery, medical treatment, or both. Management options are not standardized. Currently, conservative nonsurgical treatment seems to be an alternative method in case of interstitial pregnancy. A right interstitial pregnancy was diagnosed in a 28-year-old woman. She was successfully treated by 2 courses of systemic methotrexate (1 mg/kg) 24 hours apart followed by selective uterine artery embolization. The postembolization course was uneventful, and no rupture occurred. Ten weeks after embolization, human chorionic gonadotropin level was negative. Uterine embolization associated with methotrexate can be used successfully in treating selected cases of early interstitial pregnancy. We hypothesize that this procedure combined with methotrexate could reduce hemorrhagic risk.

  15. Evaluation of the wear properties of high interstitial stainless steels

    SciTech Connect

    Tylczak, J.H.; Rawers, J.C.; Alman, D.E.


    Adding carbon to high nitrogen steels increases interstitial concentrations over what can be obtained with nitrogen addition alone. This can results in an increase in hardness, strength, and wear resistance. The alloys produced for this study were all based on commercially available high-nitrogen Fe-18Cr-18Mn stainless steel. This study is the first significant wear study of these new high interstitial nitrogen-carbon stainless steel alloys. Wear tests included: scratch, pin-on-disk abrasion, dry sand/rubber wheel abrasion, impeller impact, and jet erosion. Increasing interstitial concentration increased strength and hardness and improved wear resistance under all test conditions. The results are discussed in terms of overall interstitial alloy concentration.

  16. Interstitial laser photocoagulation of uterine leimyoma

    NASA Astrophysics Data System (ADS)

    Gordon, Alastair D.; Buonaccorsi, Giovanni A.; Patel, Bipin L.; Broadbent, Jeff J.; Thurrell, Wendy; Bown, Stephen G.


    Uterine leiomyomas (fibroids) are common benign tumors which may cause heavy or painful periods, may present as a pelvic mass and are associated with infertility. Local excision of symptomatic lesions can be difficult and hazardous, and the alternative is hysterectomy. We are investigating interstitial laser photocoagulation (ILP) as a less invasive alternative. Initial experiments were undertaken on 40 fibroids after surgical removal. One or two bare tipped, precharred fibers from a 25 W semiconductor laser (805 nm) were inserted into the center of the fibroid and treatment delivered with 2 - 10 W for 100 - 1000 sec. Specimens were subsequently sectioned perpendicular to the fiber track. Fibroids are very pale and apart from occasional charred tracts there was little evidence of thermal coagulation macroscopically or after haematoxylon and eosin staining. However, using a diaphorase stain technique we were able to demonstrate ellipsoid zones of devitalized tissue up to 20 mm across (15 mm for single fibers). These results suggest that ILP is producing gentle, uniform coagulation which could lead to resorption of treated areas. With appropriate numbers of treatment sites, this could permit minimally invasive management of clinically significant lesions. Clinical studies have commenced treating fibroids with ILP at the time of surgical excision by myomectomy or hysterectomy.

  17. Emergent pattern formation in an interstitial biofilm

    NASA Astrophysics Data System (ADS)

    Zachreson, Cameron; Wolff, Christian; Whitchurch, Cynthia B.; Toth, Milos


    Collective behavior of bacterial colonies plays critical roles in adaptability, survivability, biofilm expansion and infection. We employ an individual-based model of an interstitial biofilm to study emergent pattern formation based on the assumptions that rod-shaped bacteria furrow through a viscous environment and excrete extracellular polymeric substances which bias their rate of motion. Because the bacteria furrow through their environment, the substratum stiffness is a key control parameter behind the formation of distinct morphological patterns. By systematically varying this property (which we quantify with a stiffness coefficient γ ), we show that subtle changes in the substratum stiffness can give rise to a stable state characterized by a high degree of local order and long-range pattern formation. The ordered state exhibits characteristics typically associated with bacterial fitness advantages, even though it is induced by changes in environmental conditions rather than changes in biological parameters. Our findings are applicable to a broad range of biofilms and provide insights into the relationship between bacterial movement and their environment, and basic mechanisms behind self-organization of biophysical systems.

  18. Distal interstitial epididymitis in young rats.


    Hoffmann, Guenther; Belote, Duane A; Suttie, Andrew W; Buetow, Bernard S; Muhumuza, Luke


    A sporadic, diffuse, interstitial mixed cell epididymitis of unknown etiology was noted in the epididymal cauda and distal corpus of young control Sprague-Dawley (SD) rats. Rats from 2 different suppliers were examined as part of routine toxicology studies. The incidence of this finding was 5/5 (study 1), 2/7 (study 2), and 2/7 (study 3). Although 2 of these studies partially overlapped temporally, none of the affected animals from any study was maintained concurrently with affected animals from any of the other 2 studies, and infectious causes, control article toxicity, or autoimmune processes were considered unlikely etiologies. Inflammation similar to that noted in the epididymides of these young rats was not present in other tissues and was not noted in study cohorts sacrificed at ages older than approximately 11 weeks or in rats of similar age from other concurrent studies. Similar findings were noted sporadically in historical control data, and consequently an age-related finding of unknown etiology and occurring in sporadic clusters is reported in SD rats ≤11 weeks old.

  19. Self-Interstitial Transport in Vanadium

    SciTech Connect

    Zepeda-Ruiz, L A; Rottler, J; Wirth, B D; Car, R; Srolovitz, D J


    We study the diffusion of self-interstitial atoms (SIAs) and SIA clusters in vanadium via molecular dynamics simulations with an improved Finnis-Sinclair potential (fit to first-principles results for SIA structure and energetics). The present results demonstrate that single SIAs exist in a <111>-dumbbell configuration and migrate easily along <111> directions. Changes of direction through rotations into other <111> directions are infrequent at low temperatures, but become prominent at higher temperatures, thereby changing the migration path from predominantly one-dimensional to almost isotropically three-dimensional. SIA clusters (i.e., clusters of <111>-dumbbells) can be described as perfect prismatic dislocation loops with Burgers vector and habit planes of 1/2<111>{l_brace}220{r_brace} that migrate only along their glide cylinder. SIA clusters also migrate along <111>-directions, but do not rotate. Both single SIAs and their clusters exhibit a highly non-Arrhenius diffusivity, which originates from a combination of a temperature dependent correlation factor and the presence of very low migration barriers. At low temperature, the diffusion is approximately Arrhenius, while above room temperature, the diffusivity is a linear function of temperature. A simple model is proposed to describe these diffusion regimes and the transition between them.

  20. Acute interstitial nephritis induced by Dioscorea quinqueloba

    PubMed Central


    Background The use of herbal medicine may be a risk factor for the development of kidney injury, as it has been reported to cause various renal syndromes. Dioscorea quinqueloba is a medicinal herb that is used as an alternative therapy for cardiovascular disease and various medical conditions. Case presentation A 52-year-old man was admitted with complaints of skin rash and burning sensation. He had ingested a raw extract of D. quinqueloba as a traditional remedy. Laboratory tests revealed the following values: absolute eosinophil count, 900/mm3; serum creatinine level, 2.7 mg/dL; and blood urea nitrogen, 33.0 mg/dL. The immunoglobulin E level was markedly increased at 1320.0 IU/mL. Urinalysis revealed a fractional excretion of sodium of 3.77%, protein 1+, and blood 3+. Histological examination of the renal biopsy specimen showed a diffusely edematous interstitium with infiltrates composed of eosinophils, lymphocytes, and neutrophils. Conclusion Here, we present the first reported case of biopsy-proven acute interstitial nephritis following ingestion of D. quinqueloba associated with skin rash, eosinophilia, and increased plasma immunoglobulin E level. PMID:25186588

  1. Technique of after-loading interstitial implants.


    Syed, A M; Feder, B H


    Interstitial implants are either removable or permanent (and occasionally a combination of both). Permanent implants are generally utilized where tumors are not accessible enough to permit easy removal of sources or where accurate source distribution is less critical. They are useful for cancers of the lung, pancreas, prostate, bladder, lymph nodes, etc. Radon and gold-198 have been largely replaced by iodine-125. Our major interests are in the removable after-loading iridium-192 implant techniques. Template (steel guide) and non-template (plastic tube) techniques are utilized. Templates are preferred where the tumor volume can only be approached from one side and where accurate positioning of sources would otherwise be difficult. They are useful for cancers of the cervix, vagina, urethra, and rectum. Non-template (plastic tube) techniques are preferred where the tumor volume can be approached from at least two sides and where templates are either not feasible or not essential for accurate positioning of sources. The single needle non-template approach is useful for cancers of lip, nodes, and breast (plastic button) and for cancers of the oral cavity and oropharynx (gold button). The paired needle non-template approach is useful for cancers of the gum, retromolar trigone, and base of tongue (loop technique) and for cancers of the palate (arch technique). Procedures for each technique are described in detail.

  2. Standardising Responsibility? The Significance of Interstitial Spaces.


    Wickson, Fern; Forsberg, Ellen-Marie


    Modern society is characterised by rapid technological development that is often socially controversial and plagued by extensive scientific uncertainty concerning its socio-ecological impacts. Within this context, the concept of 'responsible research and innovation' (RRI) is currently rising to prominence in international discourse concerning science and technology governance. As this emerging concept of RRI begins to be enacted through instruments, approaches, and initiatives, it is valuable to explore what it is coming to mean for and in practice. In this paper we draw attention to a realm that is often backgrounded in the current discussions of RRI but which has a highly significant impact on scientific research, innovation and policy-namely, the interstitial space of international standardization. Drawing on the case of nanoscale sciences and technologies to make our argument, we present examples of how international standards are already entangled in the development of RRI and yet, how the process of international standardization itself largely fails to embody the norms proposed as characterizing RRI. We suggest that although current models for RRI provide a promising attempt to make research and innovation more responsive to societal needs, ethical values and environmental challenges, such approaches will need to encompass and address a greater diversity of innovation system agents and spaces if they are to prove successful in their aims.

  3. Magnetic effects of interstitial hydrogen in nickel

    NASA Astrophysics Data System (ADS)

    León, Andrea; Velásquez, E. A.; Mazo-Zuluaga, J.; Mejía-López, J.; Florez, J. M.; Vargas, P.


    Hydrogen storage in materials is among the most relevant fields when thinking about energy conversion and storage. In this work we present a study that responds to a couple of questions concerning induced electronic changes that H produces in ferromagnetic nickel (Ni) host. We calculate and explain the change of magnetic properties of Ni with different concentrations of H. Density functional theory calculations (DFT) were performed for super-cells of fcc Ni with interstitial H in octahedral sites at different concentrations. In order to physically explain the effect of magnetization diminishing as the hydrogen concentration increases, we propose a simple Stoner type of model to describe the influence of the H impurity on the magnetic properties of Ni. The exchange splitting reduction, as shown in first principles calculations, is clearly explained within this physical model. Using a paramagnetic Ni fcc band with variable number of electrons and a Stoner model allow us to obtain the correct trend for the magnetic moment of the system as a function of the H concentration.

  4. Renaissance of laser interstitial thermal ablation.


    Missios, Symeon; Bekelis, Kimon; Barnett, Gene H


    Laser interstitial thermal therapy (LITT) is a minimally invasive technique for treating intracranial tumors, originally introduced in 1983. Its use in neurosurgical procedures was historically limited by early technical difficulties related to the monitoring and control of the extent of thermal damage. The development of magnetic resonance thermography and its application to LITT have allowed for real-time thermal imaging and feedback control during laser energy delivery, allowing for precise and accurate provision of tissue hyperthermia. Improvements in laser probe design, surgical stereotactic targeting hardware, and computer monitoring software have accelerated acceptance and clinical utilization of LITT as a neurosurgical treatment alternative. Current commercially available LITT systems have been used for the treatment of neurosurgical soft-tissue lesions, including difficult to access brain tumors, malignant gliomas, and radiosurgery-resistant metastases, as well as for the ablation of such lesions as epileptogenic foci and radiation necrosis. In this review, the authors aim to critically analyze the literature to describe the advent of LITT as a neurosurgical, laser excision tool, including its development, use, indications, and efficacy as it relates to neurosurgical applications.

  5. Optical dosimetry for interstitial photodynamic therapy

    SciTech Connect

    Arnfield, M.R.; Tulip, J.; Chetner, M.; McPhee, M.S. )


    An approach to photodynamic treatment of tumors is the interstitial implantation of fiber optic light sources. Dosimetry is critical in identifying regions of low light intensity in the tumor which may prevent tumor cure. We describe a numerical technique for calculating light distributions within tumors, from multiple fiber optic sources. The method was tested using four translucent plastic needles, which were placed in a 0.94 X 0.94 cm grid pattern within excised Dunning R3327-AT rat prostate tumors. A cylindrical diffusing fiber tip, illuminated by 630 nm dye laser light was placed within one needle and a miniature light detector was placed within another. The average penetration depth in the tumor region between the two needles was calculated from the optical power measured by the detector, using a modified diffusion theory. Repeating the procedure for each pair of needles revealed significant variations in penetration depth within individual tumors. Average values of penetration depth, absorption coefficient, scattering coefficient, and mean scattering cosine were 0.282 cm, 0.469 cm-1, 250 cm-1 and 0.964, respectively. Calculated light distributions from four cylindrical sources in tumors gave reasonable agreement with direct light measurements using fiber optic probes.

  6. Granular Material Flows with Interstitial Fluid Effects

    NASA Technical Reports Server (NTRS)

    Hunt, Melany L.; Brennen, Christopher E.


    The research focused on experimental measurements of the rheological properties of liquid-solid and granular flows. In these flows, the viscous effects of the interstitial fluid, the inertia of the fluid and particles, and the collisional interactions of the particles may all contribute to the flow mechanics. These multiphase flows include industrial problems such as coal slurry pipelines, hydraulic fracturing processes, fluidized beds, mining and milling operation, abrasive water jet machining, and polishing and surface erosion technologies. In addition, there are a wide range of geophysical flows such as debris flows, landslides and sediment transport. In extraterrestrial applications, the study of transport of particulate materials is fundamental to the mining and processing of lunar and Martian soils and the transport of atmospheric dust (National Research Council 2000). The recent images from Mars Global Surveyor spacecraft dramatically depict the complex sand and dust flows on Mars, including dune formation and dust avalanches on the slip-face of dune surfaces. These Aeolian features involve a complex interaction of the prevailing winds and deposition or erosion of the sediment layer; these features make a good test bed for the verification of global circulation models of the Martian atmosphere.

  7. Pulmonary hypertension in chronic interstitial lung diseases.


    Caminati, Antonella; Cassandro, Roberto; Harari, Sergio


    Pulmonary hypertension (PH) is a common complication of interstitial lung diseases (ILDs), particularly in idiopathic pulmonary fibrosis and ILD associated with connective tissue disease. However, other lung diseases, such as combined pulmonary fibrosis and emphysema syndrome, pulmonary Langerhans cell histiocytosis, and lymphangioleiomyomatosis, may also include PH in their clinical manifestations. In all of these diseases, PH is associated with reduced exercise capacity and poor prognosis. The degree of PH in ILDs is typically mild-to-moderate. However, some of these patients may develop a disproportionate increase in PH that cannot be justified solely by hypoxia and parenchymal injury: this condition has been termed "out-of-proportion" PH. The pathogenesis of PH in these diseases is various, incompletely understood and may be multifactorial. The clinical suspicion (i.e. increased dyspnoea, low diffusion capacity) and echocardiographic assessment are the first steps towards proper diagnosis of PH; however, right heart catheterisation remains the current gold standard for diagnosis of PH. At present, no specific therapies have been approved for the treatment of PH in patients with ILDs.

  8. Arsenic interstitial diffusion in gallium arsenide: A computational physicist's perspective

    NASA Astrophysics Data System (ADS)

    Papoulias, Panagiotis

    This thesis elucidates the importance of interstitial diffusion in semiconductors. Although more investigations have been made for silicon, the most widely used semiconductor, much less is known about arsenic interstitial diffusion in gallium arsenide -- another important technological material. Because a quantitative and qualitative description of diffusion of the arsenic split interstitial in gallium arsenide is expected to be dependent on the electrical conditions of the material, this thesis begins by examining the convergence of density-functional supercell calculations for defect formation energies, charge transition levels, localized defect state properties, defect atomic structure, relaxation. Supercells containing up to 217 atoms and a variety of k-space sampling schemes are considered. It is shown that a good description of the localized defect state and charge state transition levels requires at least a 217-atom supercell, although the defect structure and atomic relaxations can be well converged in a 65-atom cell. Formation energies are calculated for the arsenic split interstitial, gallium vacancy, and arsenic antisite defects in gallium arsenide, taking into account the dependence upon chemical potential and Fermi energy. It is found that equilibrium concentrations of arsenic interstitials will be much lower than equilibrium concentrations of arsenic antisites in arsenic-rich, n-type or semi-insulating gallium arsenide. The migration barriers for diffusion of arsenic split interstitials that are evaluated indicate that arsenic interstitials are mobile. A qualitative description of the minimum energy path shows that depending on the charge state arsenic interstitials can interact with defects and dopants on either sublattice. These results can be used as inputs into computational simulations of experiments. Also, this thesis shows that under near equilibrium conditions it is expected positively charged interstitials will dominate the diffusion for a

  9. Interstitial Area Final Range Environmental Assessment, Revision 1

    DTIC Science & Technology


    Cryptotis parva Gopher Apple Licania michauxii Cottontail Rabbit Sylvilagus floridanus Sand Blackberry Rubus cuneifolius Pocket Gopher Geomys...not display a currently valid OMB control number. 1. REPORT DATE APR 2009 2. REPORT TYPE 3. DATES COVERED 00-00-2009 to 00-00-2009 4. TITLE AND...set of mitigations imposed on interstitial activities. The 200-percent increase applied to all types of interstitial activity, including troop

  10. Rheumatoid arthritis associated interstitial lung disease: a review.


    Assayag, Deborah; Lee, Joyce S; King, Talmadge E


    Rheumatoid arthritis is a common inflammatory disease affecting about 1% of the population. Interstitial lung disease is a serious and frequent complication of rheumatoid arthritis. Rheumatoid arthritis associated interstitial lung disease (RA-ILD) is characterized by several histopathologic subtypes. This article reviews the proposed pathogenesis and risk factors for RA-ILD. We also outline the important steps involved in the work-up of RA-ILD and review the evidence for treatment and prognosis.

  11. Interstitial granulomatous dermatitis: rare cutaneous manifestation of rheumatoid arthritis*

    PubMed Central

    Veronez, Isis Suga; Dantas, Fernando Luiz; Valente, Neusa Yuriko; Kakizaki, Priscila; Yasuda, Thaís Helena; Cunha, Thaís do Amaral


    Besides being an uncommon clinicopathological entity, interstitial granulomatous dermatitis, also described as interstitial granulomatous dermatitis with arthritis (IGDA), has shown a wide spectrum of clinical manifestations, such as linear and erythematous lesions, papules, plaques and nodules. Histological features include dense dermal histiocytic infiltrate, usually in a palisade configuration, and scattered neutrophils and eosinophils. We describe a middle aged woman with rheumatoid arthritis of difficult management and cutaneous lesions compatible with IGDA. PMID:26131871

  12. Intravesical NGF Antisense Therapy using Lipid Nanoparticle for Interstitial Cystitis

    DTIC Science & Technology


    disease of the urinary bladder . The goal of this project is to advance key preclinical experiments towards the development of a new drug. Specific...factor (NGF) bladder drug delivery system targeting Interstitial Cystitis/Painful Bladder Syndrome (IC/PBS), IC/PBS is a chronic, severely debilitating...interstitial cystitis, painful bladder syndrome, liposome, nerve growth factor, afferent hyper-excitability, antisense 16. SECURITY CLASSIFICATION OF

  13. Interstitial fluid flow of alveolar primary septa after pneumonectomy.


    Haber, Shimon; Weisbord, Michal; Mishima, Michiaki; Mentzer, Steve J; Tsuda, Akira


    Neoalveolation is known to occur in the remaining lung after pneumonectomy. While compensatory lung growth is a complex process, stretching of the lung tissue appears to be crucial for tissue remodeling. Even a minute shear stress exerted on fibroblasts in the interstitial space is known to trigger cell differentiation into myofibroblast that are essential to building new tissues. We hypothesize that the non-uniform motion of the primary septa due to their heterogeneous mechanical properties under tidal breathing induces a spatially unique interstitial flow and shear stress distribution in the interstitial space. This may in turn trigger pulmonary fibroblast differentiation and neoalveolation. In this study, we developed a theoretical basis for how cyclic motion of the primary septal walls with heterogeneous mechanical properties affects the interstitial flow and shear stress distribution. The velocity field of the interstitial flow was expressed by a Fourier (complex) series and its leading term was considered to induce the basic structure of stress distribution as long as the dominant length scale of heterogeneity is the size of collapsed alveoli. We conclude that the alteration of mechanical properties of the primary septa caused by pneumonectomy can develop a new interstitial flow field, which alters the shear stress distribution. This may trigger the differentiation of resident fibroblasts, which may in turn induce spatially unique neoalveolation in the remaining lung. Our example illustrates that the initial forming of new alveoli about half the size of the original ones.

  14. Idiopathic interstitial pneumonias: progress in classification, diagnosis, pathogenesis and management.

    PubMed Central

    King, Talmadge E.


    The idiopathic interstitial pneumonias are a heterogeneous group of poorly understood diseases with often devastating consequences for those afflicted. Subclassification of the idiopathic interstitial pneumonia based on clinical-radiological-pathological criteria has highlighted important pathogenic, therapeutic and prognostic implications. The most critical distinction is the presence of usual interstitial pneumonia, the histopathological pattern seen in idiopathic pulmonary fibrosis. Idiopathic pulmonary fibrosis has a worse response to therapy and prognosis. New insight into the pathophysiology of usual interstitial pneumonia suggests a distinctly fibroproliferative process, and antifibrotic therapies show promise. While the clinical and radiographic diagnosis of idiopathic interstitial pneumonias can be made confidently in some cases, many patients require surgical lung biopsy to determine their underlying histopathology. A structured, clinical-radiological-pathological approach to the diagnosis of the idiopathic interstitial pneumonias, with particular attention to the identification of idiopathic pulmonary fibrosis, insures proper therapy, enhances prognostication, and allows for further investigation of therapies aimed at distinct pathophysiology. Images Fig. 2 Fig. 4 Fig. 5 Fig. 6 PMID:17060957

  15. Lansoprazole-induced acute allergic interstitial nephritis in a renal transplant recipient: a case report.


    Yildirim, Tolga; Yilmaz, Rahmi; Baydar, Dilek Ertoy; Kutlugun, Aysun Aybal; Aki, Tuncay; Turgan, Cetin


    Drug-induced interstitial nephritis is one of the causes of graft dysfunction in renal transplant recipients. Although commonly implicated as a cause of drug-induced interstitial nephritis in the general population, proton pump inhibitor-induced interstitial nephritis has not yet been reported in renal transplant recipients. Trimethoprim-sulfamethoxazole is responsible for most cases of interstitial nephritis in this population. Here, we describe the first case of proton pump inhibitor-related interstitial nephritis in a renal transplant recipient.

  16. Lung Volumes and Emphysema in Smokers with Interstitial Lung Abnormalities

    PubMed Central

    Washko, George R.; Hunninghake, Gary M.; Fernandez, Isis E.; Nishino, Mizuki; Okajima, Yuka; Yamashiro, Tsuneo; Ross, James C.; Estépar, Raúl San José; Lynch, David A.; Brehm, John M.; Andriole, Katherine P.; Diaz, Alejandro A.; Khorasani, Ramin; D’Aco, Katherine; Sciurba, Frank C.; Silverman, Edwin K.; Hatabu, Hiroto; Rosas, Ivan O.


    BACKGROUND Cigarette smoking is associated with emphysema and radiographic interstitial lung abnormalities. The degree to which interstitial lung abnormalities are associated with reduced total lung capacity and the extent of emphysema is not known. METHODS We looked for interstitial lung abnormalities in 2416 (96%) of 2508 high-resolution computed tomographic (HRCT) scans of the lung obtained from a cohort of smokers. We used linear and logistic regression to evaluate the associations between interstitial lung abnormalities and HRCT measurements of total lung capacity and emphysema. RESULTS Interstitial lung abnormalities were present in 194 (8%) of the 2416 HRCT scans evaluated. In statistical models adjusting for relevant covariates, interstitial lung abnormalities were associated with reduced total lung capacity (−0.444 liters; 95% confidence interval [CI], −0.596 to −0.292; P<0.001) and a lower percentage of emphysema defined by lung-attenuation thresholds of −950 Hounsfield units (−3%; 95% CI, −4 to −2; P<0.001) and −910 Hounsfield units (−10%; 95% CI, −12 to −8; P<0.001). As compared with participants without interstitial lung abnormalities, those with abnormalities were more likely to have a restrictive lung deficit (total lung capacity <80% of the predicted value; odds ratio, 2.3; 95% CI, 1.4 to 3.7; P<0.001) and were less likely to meet the diagnostic criteria for chronic obstructive pulmonary disease (COPD) (odds ratio, 0.53; 95% CI, 0.37 to 0.76; P<0.001). The effect of interstitial lung abnormalities on total lung capacity and emphysema was dependent on COPD status (P<0.02 for the interactions). Interstitial lung abnormalities were positively associated with both greater exposure to tobacco smoke and current smoking. CONCLUSIONS In smokers, interstitial lung abnormalities — which were present on about 1 of every 12 HRCT scans — were associated with reduced total lung capacity and a lesser amount of emphysema. (Funded by the

  17. [Perioperative interstitial brachytherapy for recurrent keloid scars].


    Rio, E; Bardet, E; Peuvrel, P; Martinet, L; Perrot, P; Baraer, F; Loirat, Y; Sartre, J-Y; Malard, O; Ferron, C; Dreno, B


    Evaluation of the results of perioperative interstitial brachytherapy with low dose-rate (LDR) Ir-192 in the treatment of keloid scars. We performed a retrospective analysis of 73 histologically confirmed keloids (from 58 patients) resistant to medicosurgical treated by surgical excision plus early perioperative brachytherapy. All lesions were initially symptomatic. Local control was evaluated by clinical evaluation. Functional and cosmetic results were assessed in terms of patient responses to a self-administered questionnaire. Median age was 28 years (range 13-71 years). Scars were located as follows: 37% on the face, 32% on the trunk or abdomen, 16% on the neck, and 15% on the arms or legs. The mean delay before loading was four hours (range, 1-6h). The median dose was 20Gy (range, 15-40Gy). Sixty-four scars (from 53 patients) were evaluated. Local control was 86% (follow-up, 44.5 months; range, 14-150 months). All relapses occurred early - within 2 years posttreatment. At 20 months, survival without recurrence was significantly lower when treated lengths were more than 6cm long. The rate was 100% for treated scars below 4.5cm in length, 95% (95% CI: 55-96) for those 4.5-6cm long, and 75% (95% CI: 56-88) beyond 6cm (p=0.038). Of the 35 scars (28 patients) whose results were reassessed, six remained symptomatic and the esthetic results were considered to be good in 51% (18/35) and average in 37% (13/35) (median follow-up, 70 months; range, 16-181 months). Early perioperative LDR brachytherapy delivering 20Gy at 5mm reduced the rate of recurrent keloids resistant to other treatments and gave good functional results. 2009 Société française de radiothérapie oncologique (SFRO). Published by Elsevier SAS. All rights reserved.

  18. Interstitial thermotherapy with bipolar electrosurgical devices

    NASA Astrophysics Data System (ADS)

    Desinger, Kai; Stein, Thomas; Boehme, A.; Mack, Martin G.; Mueller, Gerhard J.


    In addition to the laser, microwave or other energy sources, interstitial thermotherapy with radio-frequency current (RFITT) in bipolar technique has already been shown in vitro to be a safe and economical alternative energy source with a comparable operating performance. The bipolar technique is, from the technical point of view, completely without risk whereas with monopolar devices, where a neutral electrode has to be applied, an uncontrolled current flow passes through the patient's body. The therapeutical application efficiency of these bipolar RF-needle applicators was evaluated using newly designed high performance flushed and cooled probes (qq 3 mm). These can be used to create large coagulation volumes in tissue such as for the palliative treatment of liver metastases or the therapy of the benign prostate hyperplasia. As a result, the achievable lesion size resulting from these flushed and internally cooled RF- probes could be increased by a factor of three compared to a standard bipolar probe. With these bipolar power RF- applicators, coagulation dimensions of 5 cm length and 4 cm diameter with a power input of 40 watt could be achieved within 20 minutes. No carbonization and electrode tissue adherence was found. Investigations in vitro with adapted RFITT-probes using paramagnetic materials such as titanium alloys and high performance plastic have shown that monitoring under MRI (Siemens Magnetom, 1.5 Tesla), allows visualization of the development of the spatial temperature distribution in tissue using an intermittent diagnostic and therapeutical application. This does not lead to a loss in performance compared to continuous application. A ratio of 1:4 (15 s Thermo Flash MRI, 60 s RF-energy) has shown to be feasible.

  19. Paternity and gregariousness in the sex-changing sessile marine gastropod Crepidula convexa: comparison with other protandrous Crepidula species.


    Le Cam, Sabrina; Riquet, Florentine; Pechenik, Jan A; Viard, Frédérique


    In sex-changing animals with internal fertilization, gregarious behavior may increase mating opportunities and the frequency of multiple paternity, thus increasing maternal reproductive success. Crepidula convexa is a direct-developing protandrous gastropod characterized by only modest gregarious behavior compared with previously studied members of the genus: females are frequently found isolated. Using 6 microsatellite markers, we analyzed paternity profiles in 10 broods (25 embryos per mother). The number of assigned fathers varied among families from 1 to 4 fathers per brood. Interestingly, polyandry was not detected in solitary females but only in females grouped with conspecific individuals. Overall, we found an average of 1.8 fathers per brood, but this increased to 2.6 fathers per brood when considering only the nonisolated females. Among 18 unambiguously identified fathers, only 5 were collected in our samples, suggesting substantial male mobility. Comparison with previous paternity analyses in Crepidula fornicata and Crepidula coquimbensis revealed that polyandry appears as a common trait of these sex-changing gastropods despite their different grouping behaviors and life histories. As expected, the level of polyandry was nevertheless lower in the modestly gregarious C. convexa.

  20. [Taphonomy of the gastropod cf. Donaldina robusta (Heterobranchia: Streptacididae) from the Middle Pennsylvanian, La Joya Formation, Sonora, Mexico].


    Gómez E, Catalina; Buitrón S, Blanca; Vachard, Daniel


    Gastropods are an important component in most of the fossil record; however, investigations have focused mainly on the characterization of the tafofacies and signatures in determined environments. We present qualitative and quantitative taphonomic data for the gastropod cf. Donaldina robusta assemblages from the La Joya Formation of the Sierra Agua Verde, Sonora State, (NW) Mexico. We analyzed 176 shells. Good preservation received ahigh taphonomic grade (A) and poor preservation a D. The shells were complete in 72% of cases (taphonomic grade B). Less than 10% are corroded or are parallel to the layer (grade A). This rock is petrographycally classified as wackestone, sedimentologically it is characterized by middle sorting (grade B) and low grading (grade A). The fossiliferous assemblage grades as A and B. Biostratinomic features of the skeletal assemblage are characteristic of sedimentologic concentrations of autochthonous-parautochthonous elements at the accumulation site. There was minimal reworking and transport in an environment of low energy, locally produced during a short period of accumulation.

  1. Geometric morphometric character suites as phylogenetic data: extracting phylogenetic signal from gastropod shells.


    Smith, Ursula E; Hendricks, Jonathan R


    Despite being the objects of numerous macroevolutionary studies, many of the best represented constituents of the fossil record-including diverse examples such as foraminifera, brachiopods, and mollusks-have mineralized skeletons with limited discrete characteristics, making morphological phylogenies difficult to construct. In contrast to their paucity of phylogenetic characters, the mineralized structures (tests and shells) of these fossil groups frequently have distinctive shapes that have long proved useful for their classification. The recent introduction of methodologies for including continuous data directly in a phylogenetic analysis has increased the number of available characters, making it possible to produce phylogenies based, in whole or part, on continuous character data collected from such taxa. Geometric morphometric methods provide tools for accurately characterizing shape variation and can produce quantitative data that can therefore now be included in a phylogenetic matrix in a nonarbitrary manner. Here, the marine gastropod genus Conus is used to evaluate the ability of continuous characters-generated from a geometric morphometric analysis of shell shape-to contribute to a total evidence phylogenetic hypothesis constructed using molecular and morphological data. Furthermore, the ability of continuous characters derived from geometric morphometric analyses to place fossil taxa with limited discrete characters into a phylogeny with their extant relatives was tested by simulating the inclusion of fossil taxa. This was done by removing the molecular partition of individual extant species to produce a "cladistic pseudofossil" with only the geometric morphometric derived characters coded. The phylogenetic position of each cladistic pseudofossil taxon was then compared with its placement in the total evidence tree and a symmetric resampling tree to evaluate the degree to which morphometric characters alone can correctly place simulated fossil species

  2. Cytochrome P450 diversity and induction by gorgonian allelochemicals in the marine gastropod Cyphoma gibbosum

    PubMed Central


    Background Intense consumer pressure strongly affects the structural organization and function of marine ecosystems, while also having a profound effect on the phenotype of both predator and prey. Allelochemicals produced by prey often render their tissues unpalatable or toxic to a majority of potential consumers, yet some marine consumers have evolved resistance to host chemical defenses. A key challenge facing marine ecologists seeking to explain the vast differences in consumer tolerance of dietary allelochemicals is understanding the biochemical and molecular mechanisms underlying diet choice. The ability of marine consumers to tolerate toxin-laden prey may involve the cooperative action of biotransformation enzymes, including the inducible cytochrome P450s (CYPs), which have received little attention in marine invertebrates despite the importance of allelochemicals in their evolution. Results Here, we investigated the diversity, transcriptional response, and enzymatic activity of CYPs possibly involved in allelochemical detoxification in the generalist gastropod Cyphoma gibbosum, which feeds exclusively on chemically defended gorgonians. Twelve new genes in CYP family 4 were identified from the digestive gland of C. gibbosum. Laboratory-based feeding studies demonstrated a 2.7- to 5.1-fold induction of Cyphoma CYP4BK and CYP4BL transcripts following dietary exposure to the gorgonian Plexaura homomalla, which contains high concentrations of anti-predatory prostaglandins. Phylogenetic analysis revealed that C. gibbosum CYP4BK and CYP4BL were most closely related to vertebrate CYP4A and CYP4F, which metabolize pathophysiologically important fatty acids, including prostaglandins. Experiments involving heterologous expression of selected allelochemically-responsive C. gibbosum CYP4s indicated a possible role of one or more CYP4BL forms in eicosanoid metabolism. Sequence analysis further demonstrated that Cyphoma CYP4BK/4BL and vertebrate CYP4A/4F forms share

  3. Biodiversity census of Lake St Lucia, iSimangaliso Wetland Park (South Africa): Gastropod molluscs.


    Perissinotto, Renzo; Miranda, Nelson A F; Raw, Jacqueline L; Peer, Nasreen


    The recent dry phase experienced by the St Lucia estuarine system has led to unprecedented desiccation and hypersaline conditions through most of its surface area. This has changed only recently, at the end of 2011, with the onset of a new wet phase that has already caused a major shift to oligo- and mesohaline conditions. The estuary mouth, however, remains closed to the ocean, making the weak connection recently established between the St Lucia and the Mfolozi estuaries the only conveyance for marine recruitment. As a result, only 10 indigenous and two alien aquatic gastropod species are currently found living in the St Lucia estuarine lake. This is out of a total of 37 species recorded within the system since the earliest survey undertaken in 1924, half of which have not been reported in the literature before. The tick shell, Nassarius kraussianus, which was consistently found in large abundance prior to the recent dry phase, appears to have temporarily disappeared from the system, probably as a result of the extinction of Zostera marine grasses inside the lake. Population explosions of the bubble shell Haminoea natalensis, with its distinct egg masses, were recorded seasonally until 2009, but the species has subsequently not been observed again. A molecular DNA analysis of the various populations previously reported as belonging to the same assimineid species, variably referred to as Assiminea capensis, A. ovata, or A. bifasciata, has revealed that the St Lucia assemblage actually comprises two very distinct taxa, A. cf. capensis and a species provisionally referred to here as "A." aff. capensis or simply Assimineidae sp. In the mangroves, the climbing whelk Cerithidea decollata is still found in numbers, while ellobiids such as Cassidula labrella, Melampus semiaratus and M. parvulus are present in low abundances and all previously recorded littorinids have disappeared. A number of alien freshwater species have colonized areas of the system that have remained

  4. Inferring Paleoenvironments Using Seasonal Isotope and Trace-Metal Profiles of Serially-Sampled Gastropods

    NASA Astrophysics Data System (ADS)

    Gentry, K.; Sosdian, S.; Grossman, E. L.; Lear, C.; Rosenthal, Y.


    Early Cenozoic (e.g., Eocene-Oligocene), foraminiferal records of tropical SSTs are controversial, due to the possible alteration of the shells' isotopic and elemental composition by diagenetic recrystalization. Here we test the fidelity of shallow water molluskan skeletons as an alternative archive of tropical SSTs. Because of the long life-spans and rapid growth of mollusks, mollusk shells provide excellent records for Cenozoic seasonality, provided that seasonal variations in the isotopic and trace-metal composition of the carbonate shells reflect the ambient temperature and δ 18O of the water in which the organisms grew. To evaluate the fidelity of gastropod skeletons as recorders of such paleoenvironmental information, we performed isotopic and trace-metal analyses on specimens of Conus ermineus from the Gulf of Mexico. Three adult specimens were collected at Stetson Bank in the Flower Garden Banks National Marine Sanctuary from depths of 21-24 m. Two were sampled alive and remain in aquaria. The shells were milled parallel to growth banding to produce time series profiles along the axes of growth. These profiles were compared with temperature and salinity records from water quality data recorders at the reef surface for the later part of the growth period. For the earlier growth record, we estimated 24 m temperatures using records from nearby surface data buoys. The δ 18O and Sr/Ca profiles covary in a saw-tooth pattern, with a high degree of coherency. Such saw-tooth patterns are often interpreted as resulting from slower growth rates during summer and winter months. However, environmental records show that temperatures at 24 m change in a pattern similar to that seen in the profiles, with summer warming at 24 m lagging behind warming at the surface by up to three months. This asymmetric pattern of temperature change suggests that the shapes of isotope and trace-metal profiles may be dominantly controlled by local hydrography, rather than by intra

  5. Environmental and developmental controls of morphological diversity in a thermal spring gastropod from Coahuila, Mexico

    NASA Astrophysics Data System (ADS)

    Roopnarine, P. D.; Tang, C. M.


    Isolated thermal springs and associated aquatic environments near Cuatro Ciénegas, in north-central Mexico provide an opportunity to study patterns of evolutionary diversification under extreme conditions. Significant differences in temperature, seasonality, pH, and salinities among other variables may allow for high levels of differentiation and endemism. Biological studies of the unique faunas in this type of environment may serve as analogues for extreme and/or evaporitic environments as targeted by astrobiological research. The endemic hydrobiid gastropod \\textit{Mexipyrgus} is widely distributed in a variety of aquatic environments within the Cuatro Cienégas basin. Original description of this genus by Taylor listed six distinct species reflecting shell and anatomical features. Later revision by Hershler suggests that this diversity be reduced to one single, highly-variable species, based mainly on the morphology of reproductive structures. The systematic conflict emphasizes the need to understand the bases of morphological variation at small scales and in environmentally unusual settings. Shells of \\textit{Mexipyrgus} were collected from six localities and the following species were identified based on Taylor's classification: \\textit{M. carranzae}, \\textit{M. escobedae}, \\textit{M. multilineatus}, and specimens intermediate in character between \\textit{M. carranzae}, \\textit{M. lugoi} and \\textit{M. mojarralis}. All specimens consisted of 4-6 whorls. Shell shape was archived by the digitization of geometrically homologous landmarks on the spire (apex, whorl sutures in apertural view) and aperture. Shell size was calculated as Centroid Size. Data were analyzed using uniform and principal warp analysis of raw landmark coordinates, followed by relative warp analysis of uniform and partial warp scores. Three separate analyses were performed for 4, 5 and 6 whorled specimens. Results indicate two different levels of variation based on individual age

  6. A new aquatic gastropod stable isotopic continental paleoclimate proxy for New Zealand systems

    NASA Astrophysics Data System (ADS)

    Horton, T. W.


    Endemic to New Zealand, the aquatic gastropod Potamopyrgus antipodarum (i.e. New Zealand Mud Snail), is extremely common in modern aqueous environments and is an abundant subfossil preserved in Quaternary sediments throughout the country. This ubiquity presents unprecedented opportunities to explore stable isotope based paleoclimatic and paleoenvironmental research across New Zealand’s diverse natural systems through time. In an effort to evaluate the utility of New Zealand Mud Snail shells as isotopic proxies, approximately 10 modern snails were collected at each of 18 freshwater systems located throughout New Zealand and analyzed for stable carbon and oxygen isotopic compositions. Results indicate: 1) the oxygen isotope composition of P. antipodarum shells collected from through-flowing lakes and streams exhibit a significant positive correlation with mean annual catchment temperature; 2) shell isotopic compositions typically vary over an approximately 2 permil range for both carbon and oxygen within a single site; 3) inter-site variability is also relatively high with each site defining an isotopically distinct population; 4) shells collected from closed-basin lakes showed markedly more positive delta-values than geographically similar through-flowing systems most likely due to evaporative effects. These results suggest P. antipodarum represents an important new continental climate change proxy for New Zealand systems. However, the modern snail shell results indicate there are also several weaknesses associated with this new proxy. Most importantly, the relatively high degree of natural variability within individual sites indicates multiple contemporaneous shells are needed when performing paleo-research. Additionally, the modern results indicate, as expected, the oxygen isotope composition of snails shells is sensitive to both changes in temperature and hydrologic balance, making it difficult to differentiate between paleo-hydrologic and thermal signals. In

  7. Biodiversity census of Lake St Lucia, iSimangaliso Wetland Park (South Africa): Gastropod molluscs

    PubMed Central

    Perissinotto, Renzo; Miranda, Nelson A.F.; Raw, Jacqueline L.; Peer, Nasreen


    Abstract The recent dry phase experienced by the St Lucia estuarine system has led to unprecedented desiccation and hypersaline conditions through most of its surface area. This has changed only recently, at the end of 2011, with the onset of a new wet phase that has already caused a major shift to oligo- and mesohaline conditions. The estuary mouth, however, remains closed to the ocean, making the weak connection recently established between the St Lucia and the Mfolozi estuaries the only conveyance for marine recruitment. As a result, only 10 indigenous and two alien aquatic gastropod species are currently found living in the St Lucia estuarine lake. This is out of a total of 37 species recorded within the system since the earliest survey undertaken in 1924, half of which have not been reported in the literature before. The tick shell, Nassarius kraussianus, which was consistently found in large abundance prior to the recent dry phase, appears to have temporarily disappeared from the system, probably as a result of the extinction of Zostera marine grasses inside the lake. Population explosions of the bubble shell Haminoea natalensis, with its distinct egg masses, were recorded seasonally until 2009, but the species has subsequently not been observed again. A molecular DNA analysis of the various populations previously reported as belonging to the same assimineid species, variably referred to as Assiminea capensis, A. ovata, or A. bifasciata, has revealed that the St Lucia assemblage actually comprises two very distinct taxa, A. cf. capensis and a species provisionally referred to here as “A.” aff. capensis or simply Assimineidae sp. In the mangroves, the climbing whelk Cerithidea decollata is still found in numbers, while ellobiids such as Cassidula labrella, Melampus semiaratus and M. parvulus are present in low abundances and all previously recorded littorinids have disappeared. A number of alien freshwater species have colonized areas of the system that

  8. High contents of hypotaurine and thiotaurine in hydrothermal-vent gastropods without thiotrophic endosymbionts.


    Rosenberg, Noah K; Lee, Raymond W; Yancey, Paul H


    Invertebrates at hydrothermal vents and cold seeps must cope with high levels of toxic H2S. In addition, these and all marine invertebrates must balance internal osmotic pressure with that of the ocean. Cells usually do so with organic osmolytes, primarily free amino acids (e.g., taurine, glycine) and methylamines (e.g., betaine). At vents and seeps, clams, mussels, and vestimentiferans with thiotrophic endosymbionts have high levels of hypotaurine and thiotaurine (a product of hypotaurine and HS-). These serve as osmolytes but their primary function may be to transport and/or detoxify sulfide; indeed, thiotaurine has been proposed to be a marker of thiotrophic symbiosis. To test this, we analyzed Depressigyra globulus snails and Lepetodrilus fucensis limpets from Juan de Fuca Ridge vents (1,530 m). Neither has endosymbionts, though the latter has thiotrophic ectosymbionts. Some specimens were rapidly frozen, while other live ones were kept in laboratory chambers, some with and others without sulfide. Non-vent gastropods from a variety of depths (2-3,000 m) were also collected. Tissues were analyzed for major osmolytes and taurine derivatives. The dominant osmolytes of non-vent snails were betaine in all species, and either taurine in shallow-living species or scyllo-inositol, glycerophosphorylcholine, and other amino acids in deep-sea species. In contrast, the dominant osmolytes were hypotaurine and betaine in D. globulus, and hypotaurine in L. fucensis. Both species had thiotaurine (as well as hypotaurine) at levels much greater than previously reported for vent and seep animals without endosymbionts. The ratio of thio- to thio- plus hypotaurine, a possible indicator of sulfide exposure, decreased in both species when kept in laboratory chambers with low or no sulfide, but stayed at high levels in snails kept with 3-5 mM sulfide. Thus, in some vent animals without endosymbionts, sulfide may be detoxified via conversion of hypotaurine to thiotaurine. The latter

  9. Cytochrome P450 diversity and induction by gorgonian allelochemicals in the marine gastropod Cyphoma gibbosum.


    Whalen, Kristen E; Starczak, Victoria R; Nelson, David R; Goldstone, Jared V; Hahn, Mark E


    Intense consumer pressure strongly affects the structural organization and function of marine ecosystems, while also having a profound effect on the phenotype of both predator and prey. Allelochemicals produced by prey often render their tissues unpalatable or toxic to a majority of potential consumers, yet some marine consumers have evolved resistance to host chemical defenses. A key challenge facing marine ecologists seeking to explain the vast differences in consumer tolerance of dietary allelochemicals is understanding the biochemical and molecular mechanisms underlying diet choice. The ability of marine consumers to tolerate toxin-laden prey may involve the cooperative action of biotransformation enzymes, including the inducible cytochrome P450s (CYPs), which have received little attention in marine invertebrates despite the importance of allelochemicals in their evolution. Here, we investigated the diversity, transcriptional response, and enzymatic activity of CYPs possibly involved in allelochemical detoxification in the generalist gastropod Cyphoma gibbosum, which feeds exclusively on chemically defended gorgonians. Twelve new genes in CYP family 4 were identified from the digestive gland of C. gibbosum. Laboratory-based feeding studies demonstrated a 2.7- to 5.1-fold induction of Cyphoma CYP4BK and CYP4BL transcripts following dietary exposure to the gorgonian Plexaura homomalla, which contains high concentrations of anti-predatory prostaglandins. Phylogenetic analysis revealed that C. gibbosum CYP4BK and CYP4BL were most closely related to vertebrate CYP4A and CYP4F, which metabolize pathophysiologically important fatty acids, including prostaglandins. Experiments involving heterologous expression of selected allelochemically-responsive C. gibbosum CYP4s indicated a possible role of one or more CYP4BL forms in eicosanoid metabolism. Sequence analysis further demonstrated that Cyphoma CYP4BK/4BL and vertebrate CYP4A/4F forms share identical amino acid

  10. Mortality, behavior and the effects of predators on the intertidal distribution of littorinid gastropods.


    Rochette; Dill


    Predators can affect the vertical distribution of mobile intertidal invertebrates in two ways: they can (1) cause greater mortality of prey at certain intertidal levels, and (2) induce prey to seek safer intertidal areas. In this study, we investigate whether low-intertidal and subtidal predators affect the intertidal distribution of two congeneric species of small herbivorous gastropods of northeastern Pacific shores, Littorina sitkana Philippi 1846, and L. scutulata Gould 1849. In particular, we tested the hypothesis that predators affect the distribution of these snails by inducing them to seek higher and safer intertidal areas. On a wave-sheltered shore in Barkley Sound, British Columbia, L. sitkana and L. scutulata were both killed by predatory crabs (e.g., Cancer productus) more frequently when tethered near the lower limit of their intertidal distribution ( approximately 1 m) than when tethered where they were most common ( approximately 2.5 m), suggesting that high mortality rates are partly responsible for the lower-limit of these snails' intertidal distribution. However, two field mark-recapture experiments indicated that the snails' behavioral response to predation risk also influences their distribution. In the first experiment, snails from the 2.5-m level (low risk) transplanted to the 1.0-m level (high risk) displayed a strong and consistent tendency to move shoreward, especially L. sitkana, some traveling 10-15 m in 2-3 days to regain their original level. These shoreward movements were especially precise in the northern part of the study area, where predation rates on tethered snails were greatest. Furthermore, larger more vulnerable snails were more strongly oriented shoreward than smaller individuals, indicating that antipredator behavior might also contribute to intertidal size gradients in these species. In the second mark-recapture experiment, we manipulated predation risk using small cages and found that snails exposed to the odors of C

  11. Terrestrial and lacustrine gastropods from the Priabonian (upper Eocene) of the Sultanate of Oman.


    Harzhauser, Mathias; Neubauer, Thomas A; Kadolsky, Dietrich; Pickford, Martin; Nordsieck, Hartmut


    Terrestrial and aquatic gastropods from the upper Eocene (Priabonian) Zalumah Formation in the Salalah region of the Sultanate of Oman are described. The assemblages reflect the composition of the continental mollusc fauna of the Palaeogene of Arabia, which, at that time, formed parts of the southeastern Tethys coast. Several similarities with European faunas are observed at the family level, but are rarer at the genus level. These similarities point to an Eocene (Priabonian) rather than to a Rupelian age, although the latter correlation cannot be entirely excluded. At the species level, the Omani assemblages lack any relations to coeval faunas. This suggests the possible presence of a distinct biogeographic province during the Palaeogene or may simply reflect the extremely sparse non-marine fossil record of the Eocene in the Tethys region. The occurrence of the genera Lanistes, Pila, and Gulella along with some pomatiids, probably related to extant genera, suggests that the modern African-Arabian continental faunas can be partly traced back to Eocene times and reflect very old autochthonous developments. In contrast, the diverse Vidaliellidae went extinct, and the morphologically comparable Neogene Achatinidae may have occupied the equivalent niches in extant environments. Carnevalea Harzhauser and Neubauer nov. gen., Arabiella Kadolsky, Harzhauser and Neubauer nov. gen., Pyrgulella Harzhauser, Kadolsky and Neubauer nov. gen., Salalahia Kadolsky, Harzhauser and Neubauer nov. gen., Omanitopsis Harzhauser and Neubauer nov. gen., Arabicolaria Harzhauser and Neubauer nov. gen., Pacaudiella Harzhauser and Neubauer nov. gen., Goniodomulus Harzhauser and Neubauer nov. gen., Eoquickia Harzhauser and Neubauer nov. gen., Omanillya H. Nordsieck nov. gen. and Omanifera H. Nordsieck nov. gen. are introduced as new genera. Pila neuberti Harzhauser and Neubauer nov. sp., Arabiella arabica Kadolsky, Harzhauser and Neubauer nov. sp., Pyrgulella parva Harzhauser, Kadolsky and

  12. [Clinical study on interstitial lung disease in children of China].


    Chen, Hui-zhong


    Interstitial lung disease in children represents a heterogeneous group of disorders of both known and unknown causes. This study aimed to understand better the causes of the disease in children and to provide information on the current approach to diagnosis and management of the disease. Through the Pediatric Diffuse Parenchymal Lung Disease/Pediatric Interstitial Lung Disease Cooperative Group of China, data of 93 cases of interstitial lung disease of children from 11 hospitals were collected with the same questionnaire in 2009. Respiratory tract secretions were obtained for bacterial culture. Respiratory virus antigen examination, mycoplasma antibody, EB virus, cytomegalovirus, and herpes simplex viruses antibody detection were performed. Cells in the sputum, gastric juice and bronchoalveolar lavage fluid (BALF) were tested for hemosiderin. The CT or high resolution CT (HRCT) of the lung and blood-gas analysis were also performed. Fourteen cases underwent lung biopsy and 25 cases underwent bronchomicrocopy. Data were then pooled and discussed through a series of meetings. Fifty-three cases were male, 40 were female and their age ranged from 8 months to 14 years. Thirty-nine cases were diagnosed as bronchiolitis obliterans (BO); 39 as idiopathic pulmonary hemosiderosis (IPH); 7 as idiopathic interstitial pneumonia (IIP) of unknown causes, of whom 4 cases had non specific interstitial pneumonia, 1 case as acute interstitial pneumonia and 1 case as lymphocytic interstitial pneumonia, 1 case as idiopathic pulmonary fibrosis; 2 cases as secondary interstitial lung disease, one was secondary to SLE, one to human immunodeficiency virus (HIV) infection; 2 cases had hypersensitive pneumonitis; 2 cases had pulmonary alveolar proteinosis; 1 case had bronchiolitis obliterans organizing pneumonia; 1 case had lipoid pneumonia;1 case of diffuse panbronchiolitis; 1 case of microlithiasis alveolaris pulmonum. Forty two cases had cough, 24 of them also had tachypnea, 8 cases had

  13. Bathymetric zonation and diversity gradient of gastropods and bivalves in West Antarctica from the South Shetland Islands to the Bellingshausen Sea

    NASA Astrophysics Data System (ADS)

    Aldea, Cristian; Olabarria, Celia; Troncoso, Jesús S.


    Depth-related zonation and diversity patterns are important topics in the study of deep-sea fauna, at both species and assemblage levels. These patterns may be attributed to complex and combined physical and/or biological factors. The lack of information about the West Antarctic deep sea is an important handicap to understanding the global-scale benthic diversity patterns. Detailed studies of the bathymetric distributions and diversity of deep-sea species in the Antarctic are needed to elucidate the factors contributing to global-scale benthic patterns. This study, based on a large data set, examined the bathymetric distribution, patterns of zonation and diversity-depth trends of gastropods and bivalves in West Antarctica, from the South Shetland Islands to the Bellingshausen Sea, a very poorly known area. A total of 647 individuals of gastropods belonging to 82 species and a total of 2934 individuals of bivalves belonging to 52 species were collected. Most gastropods showed discrete depth distributions, whereas most bivalves showed broader depth ranges. Replacement of species with depth was more gradual for bivalves than gastropods. Nevertheless, three bathymetric boundaries could be recognized: (1) a continental shelf zone from 0 to 400 m with a gradual rate of succession, (2) an upper slope zone from 400 to 800 m and (3) a lower slope zone from 800 to 2000 m, extending to 3300 m for bivalves. Diversity patterns were complex for both groups with no significant trends with depth.

  14. Modulation of pulmonary neuroendocrine cells in idiopathic interstitial pneumonia.


    Ito, T; Ogura, T; Ogawa, N; Udaka, N; Hayashi, H; Inayama, Y; Yazawa, T; Kitamura, H


    In order to reveal modulation of the number of pulmonary neuroendocrine cells (PNEC) in interstitial lung diseases and to clarify significance of cell proliferation activity in occurrence of PNEC, we counted airway PNEC of the patients of idiopathic interstitial pneumonia, secondary interstitial pneumonia and control lungs, and compared the number of PNEC with airway Ki-67 labeling. The lung tissue samples were obtained by video-assisted thoracoscopic surgery from 22 patients with usual interstitial pneumonia (UIP), 7 with non-specific interstitial pneumonia (NSIP), 8 with chronic hypersensitivity pneumonia (CHP), 13 with collagen vascular disease (CVD), and were compared with age-matched control lungs. The tissues were immunostained for chromogranin A and for Ki-67. Average incidence of bronchiolar PNEC in normal, UIP, NSIP, CHP, CVD lungs was 0.169%, 0.348%, 0.326%, 0.175% and 0.201%, respectively, and average Ki-67 labeling index in them was 0.241%, 1.186%, 1.605%, 1.058%, and 2.353%, respectively. And, in UIP lungs, PNEC incidence or Ki-67 labeling index was different according to pathological lesions. Thus, PNEC increase in the bronchiole of UIP, and the incidence of PNEC varies according to degree of activity of epithelial cell proliferation probably related to epithelial cell injury. Moreover, enhanced expression of human homolog of achaete-scute complex (hASH1) mRNA in UIP lungs suggests that hASH1 could play roles in the regulation of PNEC.

  15. Migration processes of the As interstitial in GaAs

    NASA Astrophysics Data System (ADS)

    Wright, A. F.; Modine, N. A.


    Thermal migration processes of the As interstitial in GaAs were investigated using density-functional theory and the local-density approximation for exchange and correlation. The lowest-energy processes were found to involve the -1, 0, and +1 charge states, and to produce migration along ⟨110⟩-type directions. In the -1 and 0 charge states, migration proceeds via hops between split-interstitial stable configurations at bulk As sites through bridging saddle-point configurations in which the interstitial atom is equidistant from two adjacent bulk As sites. In the +1 charge state, the roles of these two configurations are approximately reversed and migration proceeds via hops between bridging stable configurations through higher-energy split-interstitial stable configurations bounded by a pair of distorted split-interstitial saddle-point configurations. The predicted activation energies for migration in the 0 and +1 charge states agree well with measurements in semi-insulating and p-type material, respectively. Also consistent with experiments, the approximate reversal of the stable and saddle-point configurations between the 0 and +1 charge states is predicted to enable carrier-induced migration with a residual activation energy of 0.05 eV.

  16. Interstitial pneumonitis after acetylene welding: a case report.


    Brvar, Miran


    Acetylene is a colorless gas commonly used for welding. It acts mainly as a simple asphyxiant. In this paper, however, we present a patient who developed a severe interstitial pneumonitis after acetylene exposure during aluminum welding. A 44-year old man was welding with acetylene, argon and aluminum electrode sticks in a non-ventilated aluminum tank for 2 h. Four hours after welding dyspnea appeared and 22 h later he was admitted at the Emergency Department due to severe respiratory insufficiency with pO2 = 6.7 kPa. Chest X-ray showed diffuse interstitial infiltration. Pulmonary function and gas diffusion tests revealed a severe restriction (55% of predictive volume) and impaired diffusion capacity (47% of predicted capacity). Toxic interstitial pneumonitis was diagnosed and high-dose systemic corticosteroid methylprednisolone and inhalatory corticosteroid fluticasone therapy was started. Computed Tomography (CT) of the lungs showed a diffuse patchy ground-glass opacity with no signs of small airway disease associated with interstitial pneumonitis. Corticosteroid therapy was continued for the next 8 weeks gradually reducing the doses. The patient's follow-up did not show any deterioration of respiratory function. In conclusion, acetylene welding might result in severe toxic interstitial pneumonitis that improves after an early systemic and inhalatory corticosteroid therapy.

  17. Interstitial pneumonitis induced by bicalutamide given for prostate cancer.


    Masago, Toshihiko; Watanabe, Takeshi; Nemoto, Ryosuke; Motoda, Kinya


    We describe interstitial pneumonitis induced by bicalutamide prescribed to treat prostate cancer. A 78-year-old man with severe lower paralysis and a bladder/rectal disorder was referred to our hospital. Prostate-specific antigen was elevated to 1418 ng/mL at that time and magnetic resonance imaging revealed multiple bone metastases. A rectal examination revealed hard nodules in the bilateral lobes of the prostate. We diagnosed prostate cancer without a biopsy, and then maximally blockaded androgens by castration and bicalutamide administration. Eight months later, he was admitted to a local hospital with breathing difficulties, and a computed tomography scan revealed interstitial pneumonitis. A physician concluded that the cause of the interstitial pneumonitis was bicalutamide, which was immediately withdrawn and replaced with prednisolone. The patient recovered over a period of 3 months. Bicalutamide-induced interstitial pneumonitis is quite rare. However, adverse reactions to maximal androgen blockade therapy should be considered and appropriate treatment for interstitial pneumonitis should be promptly initiated, as this condition is reversible.

  18. Lymphangiogenesis and Lesion Heterogeneity in Interstitial Lung Diseases

    PubMed Central

    Yamashita, Masahiro


    The lymphatic system has several physiological roles, including fluid homeostasis and the activation of adaptive immunity by fluid drainage and cell transport. Lymphangiogenesis occurs in adult tissues during various pathologic conditions. In addition, lymphangiogenesis is closely linked to capillary angiogenesis, and the balanced interrelationship between capillary angiogenesis and lymphangiogenesis is essential for maintaining homeostasis in tissues. Recently, an increasing body of information regarding the biology of lymphatic endothelial cells has allowed us to immunohistochemically characterize lymphangiogenesis in several lung diseases. Particular interest has been given to the interstitial lung diseases. Idiopathic interstitial pneumonias (IIPs) are characterized by heterogeneity in pathologic changes and lesions, as typified by idiopathic pulmonary fibrosis/usual interstitial pneumonia. In IIPs, lymphangiogenesis is likely to have different types of localized functions within each disorder, corresponding to the heterogeneity of lesions in terms of inflammation and fibrosis. These functions include inhibitory absorption of interstitial fluid and small molecules and maturation of fibrosis by excessive interstitial fluid drainage, caused by an unbalanced relationship between capillary angiogenesis and lymphangiogenesis and trafficking of antigen-presenting cells and induction of fibrogenesis via CCL21 and CCR7 signals. Better understanding for regional functions of lymphangiogenesis might provide new treatment strategies tailored to lesion heterogeneity in these complicated diseases. PMID:26823655

  19. Food availability and predation risk drive the distributional patterns of two pulmonate gastropods in a mangrove-saltmarsh transitional habitat.


    Peng, Yisheng; Zhang, Min; Lee, Shing Yip


    The pulmonate gastropods, Phallomedusa solida (Martens, 1878) and Ophicardelus ornatus (Férussac, 1821), exhibit characteristic distributional patterns at the upper intertidal zones in estuarine mangrove and saltmarsh habitats on the eastern Australian coast. Past studies suggested inundation condition, soil salinity, and percent of vegetation cover were responsible for these patterns. In this study, the role of environmental parameters, food availability, physical stress, and predation pressure in determining the distributional patterns of these gastropods was evaluated along transects spanning saltmarsh, mangrove, and the ecotone habitats. For both species, the maximum population abundance occurred in the upper saltmarsh and the ecotone between mangrove and saltmarsh at 361.0 and 358.0 ind.m(-2), respectively, which was four times that of the lower saltmarsh. Mangroves were evaluated as the optimal habitat for the pulmonates in terms of the environmental parameters moisture content and food availability. However, due to its longer inundation duration within each tidal cycle, use of the mangrove habitat by the pulmonates was impeded because of difficulties in oxygen acquisition under submerged conditions. Laboratory experiments revealed the oxygen intake of the pulmonates dropped abruptly to 4.3-9.0% of aerial rates when submerged. This result indicated that mangroves were not the optimal habitat for the pulmonates. Furthermore, the visiting frequency of predators (yellowfin bream Acanthopagrus australis and toadfishes, Tetraodontidae) was 1.3 times higher in the mangrove compared to those in the ecotone and upper saltmarsh habitats. Underwater video recording also suggested high mortality of these gastropods at 31.7-88.9% in mangrove and 0.80-0.98 times higher than that in saltmarsh, resulting from the predators preying in the mangrove habitat during high tides. Despite the abiotic factors facilitating the distribution of the pulmonates in the mangrove, the

  20. A baseline measure of tree and gastropod biodiversity in replanted and natural mangrove stands in malaysia: langkawi island and sungai merbok.


    Hookham, Brenda; Shau-Hwai, Aileen Tan; Dayrat, Benoit; Hintz, William


    THE DIVERSITIES OF MANGROVE TREES AND OF THEIR ASSOCIATED GASTROPODS WERE ASSESSED FOR TWO MANGROVE REGIONS ON THE WEST COAST OF PENINSULAR MALAYSIA: Langkawi Island and Sungai Merbok. The mangrove area sampled on Langkawi Island was recently logged and replanted, whereas the area sampled in Sungai Merbok was part of a protected nature reserve. Mangrove and gastropod diversity were assessed in four 50 m(2) (10 × 5 m) sites per region. The species richness (S), Shannon Index (H') and Evenness Index (J') were calculated for each site, and the mean S, H' and J' values were calculated for each region. We report low tree and gastropod S, H' and J' values in all sites from both regions. For Langkawi Island, the mean S, H' and J' values for mangrove trees were S = 2.00±0, H' = 0.44±0.17 and J' = 0.44±0.17; the mean S, H' and J' values for gastropods were S = 4.00±1.63, H' = 0.96±0.41 and J' = 0.49±0.06. In Sungai Merbok, the mean S, H' and J' values for mangrove trees were S = 1.33±0.58, H' = 0.22±0.39 and J' = 0.22 ±0.39; the mean S, H' and J' values for gastropods were S = 4.75±2.22, H' = 1.23±0.63 and J' = 0.55±0.12. This study emphasises the need for baseline biodiversity measures to be established in mangrove ecosystems to track the impacts of anthropogenic disturbances and to inform management and restoration efforts.

  1. A Baseline Measure of Tree and Gastropod Biodiversity in Replanted and Natural Mangrove Stands in Malaysia: Langkawi Island and Sungai Merbok

    PubMed Central

    Hookham, Brenda; Shau-Hwai, Aileen Tan; Dayrat, Benoit; Hintz, William


    The diversities of mangrove trees and of their associated gastropods were assessed for two mangrove regions on the west coast of Peninsular Malaysia: Langkawi Island and Sungai Merbok. The mangrove area sampled on Langkawi Island was recently logged and replanted, whereas the area sampled in Sungai Merbok was part of a protected nature reserve. Mangrove and gastropod diversity were assessed in four 50 m2 (10 × 5 m) sites per region. The species richness (S), Shannon Index (H’) and Evenness Index (J’) were calculated for each site, and the mean S, H’ and J’ values were calculated for each region. We report low tree and gastropod S, H’ and J’ values in all sites from both regions. For Langkawi Island, the mean S, H’ and J’ values for mangrove trees were S = 2.00±0, H’ = 0.44±0.17 and J’ = 0.44±0.17; the mean S, H’ and J’ values for gastropods were S = 4.00±1.63, H’ = 0.96±0.41 and J’ = 0.49±0.06. In Sungai Merbok, the mean S, H’ and J’ values for mangrove trees were S = 1.33±0.58, H’ = 0.22±0.39 and J’ = 0.22 ±0.39; the mean S, H’ and J’ values for gastropods were S = 4.75±2.22, H’ = 1.23±0.63 and J’ = 0.55±0.12. This study emphasises the need for baseline biodiversity measures to be established in mangrove ecosystems to track the impacts of anthropogenic disturbances and to inform management and restoration efforts. PMID:25210584

  2. Desquamative interstitial pneumonia associated with chrysotile asbestos fibres.


    Freed, J A; Miller, A; Gordon, R E; Fischbein, A; Kleinerman, J; Langer, A M


    The drywall construction trade has in the past been associated with exposure to airborne asbestos fibres. This paper reports a drywall construction worker with 32 years of dust exposure who developed dyspnoea and diminished diffusing capacity, and showed diffuse irregular opacities on chest radiography. He did not respond to treatment with corticosteroids. Open lung biopsy examination showed desquamative interstitial pneumonia. Only a single ferruginous body was seen on frozen section, but tissue examination by electron microscopy showed an extraordinary pulmonary burden of mineral dust with especially high concentrations of chrysotile asbestos fibres. This report emphasises the need to consider asbestos fibre as an agent in the aetiology of desquamative interstitial pneumonia. The coexistent slight interstitial fibrosis present in this case is also considered to have resulted from exposure to mineral dust, particularly ultramicroscopic asbestos fibres.

  3. The lipid geochemistry of interstitial waters of recent marine sediments

    SciTech Connect

    Saliot, A.; Brault, M.; Boussuge, C. )


    To elucidate the nature of biogeochemical processes occurring at the water-sediment interface, the authors have analyzed fatty acids, n-alkanes and sterols contained in interstitial waters collected from oxic and anoxic marine sediments in the eastern and western intertropical Atlantic Ocean and in the Arabian Sea. Lipid concentrations in interstitial waters vary widely and are generally much higher than concentrations encountered in the overlying sea water. Higher concentrations in interstitial water are observed in environments favorable for organic input and preservation of the organic matter in the water column and in the surficial sediment. The analysis of biogeochemical markers in the various media of occurrence of the organic matter such as sea water, suspended particles, settling particles and sediment is discussed in terms of differences existing between these media and bio-transformations of the organic matter at the water-sediment interface.

  4. Interstitial carbon formation in irradiated copper-doped silicon

    SciTech Connect

    Yarykin, N. A.; Weber, J.


    The influence of a copper impurity on the spectrum of defects induced in p-Si crystals containing a low oxygen concentration by irradiation with electrons with an energy of 5 MeV at room temperature is studied by deep-level transient spectroscopy. It is found that interstitial carbon atoms (C{sub i}) which are the dominant defects in irradiated samples free of copper are unobservable immediately after irradiation, if the concentration of mobile interstitial copper atoms (Cu{sub i}) is higher than the concentration of radiation defects. This phenomenon is attributed to the formation of (Cu{sub i}, C{sub i}) complexes, which do not introduce levels into the lower half of the band gap. It is shown that these complexes dissociate upon annealing at temperatures of 300–340 K and, thus, bring about the appearance of interstitial carbon.

  5. Ulcerative colitis and steroid-responsive, diffuse interstitial lung disease

    SciTech Connect

    Balestra, D.J.; Balestra, S.T.; Wasson, J.H.


    The authors describe a patient with ulcerative colitis and extracolonic manifestations in whom diffuse interstitial pulmonary disease developed that was responsive to glucocorticoid therapy one year after total proctocolectomy. The patient presented in December 1983 with a subacute course marked by cough and progressive exertional dyspnea, abnormal chest examination results, and a chest roentgenogram that revealed diffuse interstitital and alveolar infiltrates. A transbronchial biopsy specimen revealed a polymorphic interstitial infiltrate, mild interstitial fibrosis without apparent intraluminal fibrosis, and no vasculitis, granulomas, or significant eosinophilic infiltration. Within one week of the initiation of daily high-dose steroid therapy, the patient's symptoms dramatically improved; chest roentgenogram and forced vital capacity (60%) improved at a slower rate. All three measures deteriorated when alternate-day prednisone therapy was started but once again improved until the patient was totally asymptomatic, chest roentgenograms were normal, and forced vital capacity was 80% of the predicted value 2 1/2 years later.

  6. Improvement in idiopathic nonspecific interstitial pneumonia after smoking cessation

    PubMed Central

    Shinohara, Tsutomu; Kadota, Naoki; Hino, Hiroyuki; Naruse, Keishi; Ohtsuki, Yuji; Ogushi, Fumitaka


    Although cigarette smoking has been recognized as a risk factor for the development of several interstitial lung diseases, the relationship between smoking and nonspecific interstitial pneumonia (NSIP) has not yet been fully elucidated. We here present a case of fibrotic NSIP with mild emphysema in an elderly male with normal pulmonary function, whose symptoms, serum KL-6 level, and high-resolution computed tomography findings of interstitial changes markedly improved without medication following the cessation of smoking. Our case suggests that smoking may be an etiological factor in some patients with NSIP and that early smoking cessation before a clinically detectable decline in pulmonary function may be critical for smokers with idiopathic NSIP. PMID:26029566

  7. The behaviour of stacking fault energy upon interstitial alloying.


    Lee, Jee-Yong; Koo, Yang Mo; Lu, Song; Vitos, Levente; Kwon, Se Kyun


    Stacking fault energy is one of key parameters for understanding the mechanical properties of face-centered cubic materials. It is well known that the plastic deformation mechanism is closely related to the size of stacking fault energy. Although alloying is a conventional method to modify the physical parameter, the underlying microscopic mechanisms are not yet clearly established. Here, we propose a simple model for determining the effect of interstitial alloying on the stacking fault energy. We derive a volumetric behaviour of stacking fault energy from the harmonic approximation to the energy-lattice curve and relate it to the contents of interstitials. The stacking fault energy is found to change linearly with the interstitial content in the usual low concentration domain. This is in good agreement with previously reported experimental and theoretical data.

  8. Interstitial lung disease in infancy: A general approach.


    Hines, Erica J; Walsh, Mark; Armes, Jane E; Douglas, Tonia; Chawla, Jasneek


    Childhood Interstitial lung disease (chILD) is an umbrella term used to define a broad range of rare, diffuse pulmonary disorders with altered interstitial structure that leads to abnormal gas exchange. Presentation of chILD in infancy can be difficult to differentiate from other common causes of diffuse lung disease. This article aimed at paediatricians provides an overview of interstitial lung disease presenting in infancy and includes key clinical features, a suggested approach to investigation and a summary of management. An overview of three clinical cases has been included to demonstrate the diagnostic approach, characteristic investigation findings and varied clinical outcomes. © 2016 Paediatrics and Child Health Division (The Royal Australasian College of Physicians).

  9. [TINU syndrome and lymphoid interstitial alveolitis: a new observation].


    Khammassi, Naziha; Mohsen, Dorsaf; Ounissi, Mondher; Tougourti, Mohamed Nejib; Hamza, Mohsen


    TINU syndrome is a rare entity known Dobrin disease, combining uveitis mostly bilateral and recurrent with acute tubulo interstitial nephritis (AIN) occurring in young adults. The etiology and pathogenesis of this syndrome remain unknown. To report a new case of TINU syndrome and to discuss its etiopathogenesis. This 33 year old women is hospitalized for exploration of acute renal failure, in a context of deterioration of general condition, associated with a unilateral anterior uveitis. The bronchoalveolar lavage showed lymphoid interstitial alveolitis with CD4 and the renal biopsy found lesions characteristic of AIN. Evolution under corticoïd treatment was favorable. Lymphoid interstitial alveolitis associated with TINU syndrome has been reported only twice before. The discovery of a TINU syndrome must practice bronchoalveolar lavage in search of sub clinical pulmonary involvement.

  10. Nonspecific interstitial pneumonia in collagen vascular diseases: comparison of the clinical characteristics and prognostic significance with usual interstitial pneumonia.


    Nakamura, Yutaro; Chida, Kingo; Suda, Takafimi; Hayakawa, Hiroshi; Iwata, Masatoshi; Imokawa, Shiro; Tsuchiya, Tomoyoshi; Ida, Masaaki; Gemma, Hitoshi; Yasuda, Kazumasa; Yagi, Takeshi; Shirai, Toshihiro; Tamura, Ryoji; Nakano, Yutaka; Hirata, Takeo; Nakamura, Hirotoshi; Colby, Thomas V


    Nonspecific interstitial pneumonia (NSIP) has recently been described as a distinct clinicopathological entity among idiopathic interstitial pneumonias (IIP), having more favorable prognosis than usual interstitial pneumonia (UIP). Although NSIP was initially reported to also occur in patients with interstitial pneumonia associated with collagen vascular diseases (IP-CVD), the prevalence of NSIP and its prognostic significance in IP-CVD remains to be determined. Thus, we attempted to clarify clinical characteristics and prognostic significance of NSIP in IP-CVD. We histologically examined surgical lung biopsies from 43 patients with IP-CVD based on a current classification of interstitial pneumonias, and compared the clinical characteristics and prognostic significance of NSIP with UIP in IP-CVD. We also studied 98 patients with biopsy-proven NSIP and UIP in IIP, and compared the prognostic significance of histopathologic subclassification in IIP with that in IP-CVD. In IP-CVD, twenty-six patients (60%) were classified as NSIP, 17 (40%) as UIP. In contrast, 76 (77%) were categorized into UIP and 22 (23%) into NSIP of the patients with IIP. No significant difference in survival rates was observed between UIP and NSIP in IP-CVD (p = 0.3863), while, in IIP, NSIP has a significant better survival than UIP (p = 0.022). These results suggest that NSIP is more common histologic pattern than UIP in IP-CVD and, unlike in IIP, the prognosis of NSIP patients may not be different from that of UIP patients in IP-CVD.

  11. Comparison of an interstitial cystitis/bladder pain syndrome clinical cohort with symptomatic community women from the RAND Interstitial Cystitis Epidemiology study.


    Konkle, Katy S; Berry, Sandra H; Elliott, Marc N; Hilton, Lara; Suttorp, Marika J; Clauw, Daniel J; Clemens, J Quentin


    The RAND Interstitial Cystitis Epidemiology survey estimated that 2.7% to 6.5% of United States women have urinary symptoms consistent with a diagnosis of interstitial cystitis/bladder pain syndrome. We describe the demographic and clinical characteristics of the symptomatic community based RAND Interstitial Cystitis Epidemiology cohort, and compare them with those of a clinically based interstitial cystitis/bladder pain syndrome cohort. Subjects included 3,397 community women who met the criteria for the RAND Interstitial Cystitis Epidemiology high sensitivity case definition, and 277 women with an interstitial cystitis/bladder pain syndrome diagnosis recruited from specialist practices across the United States (clinical cohort). Questions focused on demographic information, symptom severity, quality of life indicators, concomitant diagnoses and treatment. Average symptom duration for both groups was approximately 14 years. Women in the clinical cohort reported worse baseline pain and maximum pain, although the absolute differences were small. Mean Interstitial Cystitis Symptom Index scores were approximately 11 for both groups, but mean Interstitial Cystitis Problem Index scores were 9.9 and 13.2 for the clinical cohort and the RAND Interstitial Cystitis Epidemiology cohort, respectively (p <0.001). The RAND Interstitial Cystitis Epidemiology subjects were more likely to be uninsured. The RAND Interstitial Cystitis Epidemiology community cohort was remarkably similar to an interstitial cystitis/bladder pain syndrome clinical cohort with respect to demographics, symptoms and quality of life measures. In contrast to other chronic pain conditions for which clinical cohorts typically report worse symptoms and functional status than population based samples, our data suggest that many measures of symptom severity and functional impact are similar, and sometimes worse, in the RAND Interstitial Cystitis Epidemiology cohort. These findings suggest that interstitial

  12. MUC5B Promoter Polymorphism and Interstitial Lung Abnormalities

    PubMed Central

    Hunninghake, Gary M.; Hatabu, Hiroto; Okajima, Yuka; Gao, Wei; Dupuis, Josée; Latourelle, Jeanne C.; Nishino, Mizuki; Araki, Tetsuro; Zazueta, Oscar E.; Kurugol, Sila; Ross, James C.; Estépar, Raúl San José; Murphy, Elissa; Steele, Mark P.; Loyd, James E.; Schwarz, Marvin I.; Fingerlin, Tasha E.; Rosas, Ivan O.; Washko, George R.; O’Connor, George T.; Schwartz, David A.


    BACKGROUND A common promoter polymorphism (rs35705950) in MUC5B, the gene encoding mucin 5B, is associated with idiopathic pulmonary fibrosis. It is not known whether this polymorphism is associated with interstitial lung disease in the general population. METHODS We performed a blinded assessment of interstitial lung abnormalities detected in 2633 participants in the Framingham Heart Study by means of volumetric chest computed tomography (CT). We evaluated the relationship between the abnormalities and the genotype at the rs35705950 locus. RESULTS Of the 2633 chest CT scans that were evaluated, interstitial lung abnormalities were present in 177 (7%). Participants with such abnormalities were more likely to have shortness of breath and chronic cough and reduced measures of total lung and diffusion capacity, as compared with participants without such abnormalities. After adjustment for covariates, for each copy of the minor rs35705950 allele, the odds of interstitial lung abnormalities were 2.8 times greater (95% confidence interval [CI], 2.0 to 3.9; P<0.001), and the odds of definite CT evidence of pulmonary fibrosis were 6.3 times greater (95% CI, 3.1 to 12.7; P<0.001). Although the evidence of an association between the MUC5B genotype and interstitial lung abnormalities was greater among participants who were older than 50 years of age, a history of cigarette smoking did not appear to influence the association. CONCLUSIONS The MUC5B promoter polymorphism was found to be associated with interstitial lung disease in the general population. Although this association was more apparent in older persons, it did not appear to be influenced by cigarette smoking. (Funded by the National Institutes of Health and others; number, NCT00005121.) PMID:23692170

  13. Low temperature diffusivity of self-interstitial defects in tungsten

    NASA Astrophysics Data System (ADS)

    Swinburne, Thomas D.; Ma, Pui-Wai; Dudarev, Sergei L.


    The low temperature diffusivity of nanoscale crystal defects, where quantum mechanical fluctuations are known to play a crucial role, are essential to interpret observations of irradiated microstructures conducted at cryogenic temperatures. Using density functional theory calculations, quantum heat bath molecular dynamics and open quantum systems theory, we evaluate the low temperature diffusivity of self-interstitial atom clusters in tungsten valid down to temperatures of 1 K. Due to an exceptionally low defect migration barrier, our results show that interstitial defects exhibit very high diffusivity of order {10}3 μ {{{m}}}2 {{{s}}}-1 over the entire range of temperatures investigated.

  14. Ectrodactyly and proximal/intermediate interstitial deletion 7q

    SciTech Connect

    McElveen, C.; Carvajal, M.V.; Moscatello, D.


    We report on an individual with severe mental retardation, seizures, microcephaly, unusual face, scoliosis, and cleft feet and cleft right hand. The chromosomal study showed a proximal interstitial deletion 7q (q11.23q22). From our review of the literature, 11 patients have been reported with ectrodactyly (split hand/split foot malformation) and proximal/intermediate interstitial deletions or rearrangements of 7q. The critical segment for ectrodactyly seems to be located between 7q21.2 and 7q22.1. This malformation is present in 41% of the patients whose deletion involves the critical segment. 37 refs., 3 figs., 1 tab.

  15. Association Between Interstitial Lung Abnormalities and All-Cause Mortality

    PubMed Central

    Putman, Rachel K.; Hatabu, Hiroto; Araki, Tetsuro; Gudmundsson, Gunnar; Gao, Wei; Nishino, Mizuki; Okajima, Yuka; Dupuis, Josée; Latourelle, Jeanne C.; Cho, Michael H.; El-Chemaly, Souheil; Coxson, Harvey O.; Celli, Bartolome R.; Fernandez, Isis E.; Zazueta, Oscar E.; Ross, James C.; Harmouche, Rola; Estépar, Raúl San José; Diaz, Alejandro A.; Sigurdsson, Sigurdur; Gudmundsson, Elías F.; Eiríksdottír, Gudny; Aspelund, Thor; Budoff, Matthew J.; Kinney, Gregory L.; Hokanson, John E.; Williams, Michelle C; Murchison, John T.; MacNee, William; Hoffmann, Udo; O’Donnell, Christopher J.; Launer, Lenore J.; Harrris, Tamara B.; Gudnason, Vilmundur; Silverman, Edwin K.; O’Connor, George T.; Washko, George R.; Rosas, Ivan O.; Hunninghake, Gary M.


    IMPORTANCE Interstitial lung abnormalities have been associated with decreased six-minute walk distance, diffusion capacity for carbon monoxide and total lung capacity; however to our knowledge, an association with mortality has not been previously investigated. OBJECTIVE To investigate whether interstitial lung abnormalities are associated with increased mortality. DESIGN, SETTING, POPULATION Prospective cohort studies of 2633 participants from the Framingham Heart Study (FHS) (CT scans obtained 9/08–3/11), 5320 from the Age Gene/Environment Susceptibility (AGES)-Reykjavik (recruited 1/02–2/06), 2068 from COPDGene (recruited 11/07–4/10), and 1670 from the Evaluation of COPD Longitudinally to Identify Predictive Surrogate End-points (ECLIPSE) (between 12/05–12/06). EXPOSURES Interstitial lung abnormality status as determined by chest CT evaluation. MAIN OUTCOMES AND MEASURES All cause mortality over approximately 3 to 9 year median follow up time. Cause-of-death information was also examined in the AGES-Reykjavik cohort. RESULTS Interstitial lung abnormalities were present in 177 (7%) of the participants from FHS, 378 (7%) from AGES-Reykjavik, 156 (8%) from COPDGene, and in 157 (9%) from ECLIPSE. Over median follow-up times of ~3–9 years there were more deaths (and a greater absolute rate of mortality) among those with interstitial lung abnormalities compared to those without interstitial lung abnormalities in each cohort; 7% compared to 1% in FHS (6% difference, 95% confidence interval [CI] 2%, 10%), 56% compared to 33% in AGES-Reykjavik (23% difference, 95% CI 18%, 28%), 16% compared to 11% in COPDGene (5% difference, 95% CI −1%, 11%) and 11% compared to 5% in ECLIPSE (6% difference, 95% CI 1%, 11%). After adjustment for covariates, interstitial lung abnormalities were associated with an increase in the risk of death in the FHS (HR=2.7, 95% CI, 1.1–65, P=0.030), AGES-Reykjavik (HR 1.3, 95% CI 1.2–1.4, P<0.001), COPDGene (HR=1.8, 95% CI, 1.1, 2

  16. Dose and volume specification for reporting interstitial therapy

    SciTech Connect


    The ICRU has previously published reports dealing with Dose Specification for Reporting External Beam Therapy with Photons and Electrons (ICRU Report 29, ICRU, 1978), Dose Specification for Reporting External Beam Therapy (ICRU Report 50, ICRU, 1993) and Dose and Volume Specification for Reporting Intracavitary Therapy in Gynecology (ICRU Report 38, ICRU, 1985). The present report addresses the problem of absorbed dose specification for report interstitial therapy. Although specific to interstitial therapy, many of the concepts developed in this report are also applicable to certain other kinds of brachytherapy applications. In particular, special cases of intraluminal brachytherapy and plesio-brachytherapy via surface molds employing x or gamma emitters are addressed in this report.

  17. Intraluminal crawling versus interstitial neutrophil migration during inflammation.


    Pick, Robert; Brechtefeld, Doris; Walzog, Barbara


    Site-directed trafficking of polymorphonuclear neutrophils (PMN) to their target regions within the tissue is an important prerequisite for efficient host defense during the acute inflammatory response. This process requires intraluminal crawling of PMN on the activated endothelial cells to their extravasation sites. Upon transendothelial diapedesis, PMN migrate in the interstitial tissue to sites of inflammation. These crucial steps within the recruitment cascade are defined as intraluminal crawling and interstitial migration. In this review, we will focus on the molecular mechanisms that control and fine-tune these migratory processes and discuss the role of adhesion molecules of the β2 integrin (CD11/CD18) family for these cellular functions.

  18. Acute interstitial nephritis following kudzu root juice ingestion.


    Jung, Jae Myun; Kwon, Soon Hyo; Noh, Hyunjin; Han, Dong Cheol; Jeon, Jin Seok; Jin, So Young


    Recently, the use of herbal remedies and complementary and alternative medicine has increased globally. Kudzu root (Pueraria lobata) is a plant commonly used in traditional medicine to promote health. A middle-aged woman consumed kudzu root juice to promote health and well-being for 10 days. Subsequently, she developed anorexia, epigastric discomfort and azotemia. These symptoms improved rapidly within several days after discontinuation of the suspected offending agent and conservative treatment. Acute interstitial nephritis was diagnosed by renal biopsy. To our knowledge, this is the first case report describing acute interstitial nephritis following the ingestion of kudzu root juice.

  19. Association Between Interstitial Lung Abnormalities and All-Cause Mortality.


    Putman, Rachel K; Hatabu, Hiroto; Araki, Tetsuro; Gudmundsson, Gunnar; Gao, Wei; Nishino, Mizuki; Okajima, Yuka; Dupuis, Josée; Latourelle, Jeanne C; Cho, Michael H; El-Chemaly, Souheil; Coxson, Harvey O; Celli, Bartolome R; Fernandez, Isis E; Zazueta, Oscar E; Ross, James C; Harmouche, Rola; Estépar, Raúl San José; Diaz, Alejandro A; Sigurdsson, Sigurdur; Gudmundsson, Elías F; Eiríksdottír, Gudny; Aspelund, Thor; Budoff, Matthew J; Kinney, Gregory L; Hokanson, John E; Williams, Michelle C; Murchison, John T; MacNee, William; Hoffmann, Udo; O'Donnell, Christopher J; Launer, Lenore J; Harrris, Tamara B; Gudnason, Vilmundur; Silverman, Edwin K; O'Connor, George T; Washko, George R; Rosas, Ivan O; Hunninghake, Gary M


    Interstitial lung abnormalities have been associated with lower 6-minute walk distance, diffusion capacity for carbon monoxide, and total lung capacity. However, to our knowledge, an association with mortality has not been previously investigated. To investigate whether interstitial lung abnormalities are associated with increased mortality. Prospective cohort studies of 2633 participants from the FHS (Framingham Heart Study; computed tomographic [CT] scans obtained September 2008-March 2011), 5320 from the AGES-Reykjavik Study (Age Gene/Environment Susceptibility; recruited January 2002-February 2006), 2068 from the COPDGene Study (Chronic Obstructive Pulmonary Disease; recruited November 2007-April 2010), and 1670 from ECLIPSE (Evaluation of COPD Longitudinally to Identify Predictive Surrogate Endpoints; between December 2005-December 2006). Interstitial lung abnormality status as determined by chest CT evaluation. All-cause mortality over an approximate 3- to 9-year median follow-up time. Cause-of-death information was also examined in the AGES-Reykjavik cohort. Interstitial lung abnormalities were present in 177 (7%) of the 2633 participants from FHS, 378 (7%) of 5320 from AGES-Reykjavik, 156 (8%) of 2068 from COPDGene, and in 157 (9%) of 1670 from ECLIPSE. Over median follow-up times of approximately 3 to 9 years, there were more deaths (and a greater absolute rate of mortality) among participants with interstitial lung abnormalities when compared with those who did not have interstitial lung abnormalities in the following cohorts: 7% vs 1% in FHS (6% difference [95% CI, 2% to 10%]), 56% vs 33% in AGES-Reykjavik (23% difference [95% CI, 18% to 28%]), and 11% vs 5% in ECLIPSE (6% difference [95% CI, 1% to 11%]). After adjustment for covariates, interstitial lung abnormalities were associated with a higher risk of death in the FHS (hazard ratio [HR], 2.7 [95% CI, 1.1 to 6.5]; P = .03), AGES-Reykjavik (HR, 1.3 [95% CI, 1.2 to 1.4]; P < .001), COPDGene (HR

  20. Empirical potential simulations of interstitial dislocation loops in uranium dioxide

    NASA Astrophysics Data System (ADS)

    Le Prioux, Arno; Fossati, Paul; Maillard, Serge; Jourdan, Thomas; Maugis, Philippe


    Stoichiometric circular shaped interstitial dislocation loop energies are calculated in stoichiometric UO2 by empirical potential simulation. The Burgers vector directions studied are <110> and <111>. The main structural properties of each type of interstitial dislocation loop are determined, including stacking fault energy. Defect energies are compared and a maximum size for stable <111> dislocation loops before transition to <110> dislocation loops is given. A model of dislocation loop energy based on elasticity theory is then fitted on the basis of these simulation results.

  1. Mox homeobox expression in muscle lineage of the gastropod Haliotis asinina: evidence for a conserved role in bilaterian myogenesis.


    Hinman, V F; Degnan, B M


    Mox homeobox genes are expressed during early vertebrate somitogenesis. Here we describe the expression of Has-Mox, a Mox gene from the gastropod Haliotis asinina. Has-Moxis expressed in the trochophore larva in paraxial mesodermal bands. During larval development, Has-Mox expression remains restricted to mesodermal cells destined to form adult muscle in the foot. This restricted expression of Has-Mox in Haliotis is similar to that observed for vertebrate Mox genes, suggesting a conserved role in myogenesis in deuterostomes and lophotrochozoans. In contrast, Mox is not expressed in muscle lineages in the ecdysozoan representatives Caenorhabditis elegans or Drosophila; the C. elegansgenome has lost Mox altogether. Electronic supplementary material to this paper can be obtained by using the Springer Link server located at

  2. A Mox homeobox gene in the gastropod mollusc Haliotis rufescens is differentially expressed during larval morphogenesis and metamorphosis.


    Degnan, B M; Degnan, S M; Fentenany, G; Morse, D E


    We have isolated a homeobox-containing cDNA from the gastropod mollusc Haliotis rufescens that is most similar to members of the Mox homeobox gene class. The derived Haliotis homeodomain sequence is 85% identical to mouse and frog Mox-2 homeodomains and 88.9% identical to the partial cnidarian cnox5-Hm homeodomain. Quantitative reverse transcription-polymerase chain reaction analysis of mRNA accumulation reveals that this gene, called HruMox, is expressed in the larva, but not in the early embryo. Transcripts are most prevalent during larval morphogenesis from trochophore to veliger. There are also transient increases in transcript prevalence 1 and 3 days after the intitiation of metamorphosis from veliger to juvenile. The identification of a molluscan Mox homeobox gene that is more closely related to vertebrate genes than other protostome (e.g. Drosophila) genes suggests the Mox class of homeobox genes may consist of several different families that have been conserved through evolution.

  3. Phylogeny of hydrothermal-vent-endemic gastropods Alviniconcha spp. from the western Pacific revealed by mitochondrial DNA sequences.


    Kojima, S; Segawa, R; Fijiwara, Y; Fujikura, K; Ohta, S; Hashimoto, J


    Mitochondrial genes for cytochrome oxidase I (COI) from hydrothermal-vent-endemic gastropods of the genus Alviniconcha were sequenced to determine the phylogenetic relationships among specimens from three areas in the western Pacific. Individuals of Alviniconcha hessleri were collected at two vent fields (depths 1470 m and 3600 m) in the Mariana Trough. Specimens collected in the North Fiji Basin could be divided into two genetically distinct groups, both of which also differed from A. hessleri from the Mariana Trough. None of the specimens of the genus Alviniconcha collected in the Manus Basin differed genetically from the dominant group from the North Fiji Basin. We suggest that the specimens of the genus Alviniconcha analyzed in the present study can be tentatively classified into A. hessleri and two undescribed species.

  4. Mechanism of a plastic phenotypic response: predator-induced shell thickening in the intertidal gastropod Littorina obtusata.


    Brookes, J I; Rochette, Rémy


    Phenotypic plasticity has been the object of considerable interest over the past several decades, but in few cases are mechanisms underlying plastic responses well understood. For example, it is unclear whether predator-induced changes in gastropod shell morphology represent an active physiological response or a by-product of reduced feeding. We address this question by manipulating feeding and growth of intertidal snails, Littorina obtusata, using two approaches: (i) exposure to predation cues from green crabs Carcinus maenas and (ii) reduced food availability, and quantifying growth in shell length, shell mass, and body mass, as well as production of faecal material and shell micro-structural characteristics (mineralogy and organic fraction) after 96 days. We demonstrate that L. obtusata actively increases calcification rate in response to predation threat, and that this response entails energetic and developmental costs. That this induced response is not strictly tied to the animal's behaviour should enhance its evolutionary potential.



    Petrova, T A; Lianguzov, A Yu; Malygina, N M


    The set of normal biochemical indicators of the hemolymph plasma of gastropod pulmonate mollusc Achatinafulica is described. Comparative analysis of the whole plasma and its subfractions enriched and depleted of oxygen-carrying protein hemocyanin was performed by spectrophotometry and spectrofluorimetry methods. Individual features of the absorption spectra were analyzed using fourth derivatives. The optimum method for estimating protein concentration was chosen. To characterize acid-base properties of plasma hemolymph and its sub-fractions we calculated buffer capacity, equivalence points and pK values of dominant buffer groups. It is shown that the major role in maintaining the buffer capacity of hemolymph belongs to the bicarbonate system. These results are compared with data for Helix pomatia available in literature. In the future the indicators studied in this work will be used to develop ecotoxicological criteria for the environmental assessment.

  6. [Composition and content of carotenoids in body of the Black Sea gastropod mollusc Rapana venosa (Valenciennes, 1846)].


    Borodina, A V; Maoka, T; Soldatov, A A


    There were studied content and composition of carotenoids in body of the Black Sea gastropod mollusc Rapana venosa. To separate and identify this group of compounds, methods of thin layer and high performance liquid chromatography, mass-spectra and spectra in UV-VIS range were used. There were identified 84-87% of carotenoids. The main proportion belonged to mytiloxanthine--28-30%. The rest--pectenolon, diatoxanthin, alloxanthin--accounted for 10-15% of the total content except for beta-carotene--3-4%. The fraction is also isolated which contains complex esters of pectenolon, diatoxanthin, alloxanthin, and mytiloxanthin. It amounts to 17-20 % of pigments of carotenoid line. Minor components were not determined. Pathways of metabolic transformation of carotenoids in tissues of R. venosa are considered on the basis of study of the trophic system "mollusc-filtrator--mollusc-predator" by the example of Mytilus galloprovincialis and R. venosa.

  7. [Composition, distribution and abundance of gastropod larvae in the South of Quintana Roo,Mexico and north of Belice].


    Oliva Rivera, J; de Jesús Navarrete, A


    To know the composition, abundance and distribution of gastropod larvae, monthly samplings were carried out in the south of Quintana Roo, Mexico and north of Belize, from April to December, 1996. Collections were made in six sites at Chinchorro Bank, four in the South Coast and six at Hol-Chan, Belize, between the 10 and 20 hrs. At each station 2.5 m3 of seawater were pumped through a 202 microns mesh; 27 species were identified. The most abundant species were: South Coast, Rissoina sp. 1., Limacina sp. 1 and Natica sp. 1, Chinchorro Bank, Limacina sp. 1, Creseis acicula, Cerithiopsis hero and Rissoina sp. 1 and Hol-Chan, Limacina sp. 2, Alaba incerta and Rissoina sp. 1. The highest abundance was in rainy season. Apparently the presence of winds, coastal currents and food availability, control the distribution and abundance of larvae.

  8. Effects of temperature and salinity on emergence of Gynaecotyla adunca cercariae from the intertidal gastropod Ilyanassa obsoleta.


    Koprivnikar, J; Ellis, D; Shim, K C; Forbes, M R


    Fluctuating abiotic conditions within intertidal zones have been shown to affect the emergence of free-swimming trematode infectious stages (cercariae) from their gastropod first intermediate hosts, likely reflecting adaptations to maximize transmission in this marine environment. We investigated the influences of temperature (17 and 22 C) and salinity (25, 30, and 35 ppt) on the emergence of marine cercariae (Gynaecotyla adunca) from their mud snail first intermediate host ( Ilyanassa obsoleta ). Cercariae emerged in greater numbers at 22 C and the 2 lowest salinities, with a sharp decrease at the 35 ppt level, but there was no interactive effect. We discuss these patterns of G. adunca emergence as possible adaptations to facilitate transmission to its amphipod second intermediate host ( Corophium volutator ) in conditions common to the Upper Bay of Fundy.

  9. Assessment of heavy metal contamination in intertidal gastropod and bivalve shells from central Arabian Gulf coastline, Saudi Arabia

    NASA Astrophysics Data System (ADS)

    El-Sorogy, Abdelbaset S.; Youssef, Mohamed


    In order to assess pollutants and impact of environmental changes along the Saudi Arabian Gulf coast, forty specimens of gastropod and bivalve shells belonging to Diodora funiculata, Lunella coronata, Cerithium caeruleum, Barbatia parva, Pinctada margaritifera, Amiantis umbonella, Acrosterigma assimile and Asaphis violascens from five localities are selected for Fe, Cu, Pb, Mn, Cd, Se, As, Co, B, Cr, Hg, Mo analysis. The analysis indicated that heavy metal values (except Fe) were less than those recorded in molluscan shells from Gulf of Oman, Red Sea and Indian Ocean. D. funiculate, L. coronata, B. parva and P. margaritifera are good accumulators of Cu, As, Cr. The other species gave a nearly constant concentration in all the studied areas. Al Jubail coast recorded the highest heavy metal concentrations (except Mn at Ras Al-Ghar and Se at Al Jubail industrial city). Heavy metal contamination is mostly attributed to anthropogenic sources, especially effluents from petrochemical industries, sewage and desalination plants.

  10. Food preference, food quality and diets of three herbivorous gastropods (Trochidae: Tegula) in a temperate kelp forest habitat.


    Watanabe, J M


    The relationship between food preference and food quality (i.e. a food's contribution to growth and reproductive development) was examined in the laboratory for 3 species of herbivorous kelp forest gastropods (Tegula). The preference hierarchies of the 3 Tegula for 6 common algal species are the same: giant kelp (Macrocystis) is the most preferred food and brown algae are consumed at higher rates than red algae. Despite their strong preference for Macrocystis, the 3 species had significantly greater growth and/or reproductive development on a mixed-algae diet than on either brown or red algae alone. Laboratory preferences of the snails did not correspond closely with caloric content, estimated availability or quality of the algal species used in this study. However, the 3 Tegula are subject to strong benthic predation and Macrocystis provides an important spatial refuge in nature. The potential role of non-nutritional factors such as predator avoidance on the formation of food preferences is discussed.

  11. Effects of elevated pCO2 on reproductive properties of the benthic copepod Tigriopus japonicus and gastropod Babylonia japonica.


    Kita, Jun; Kikkawa, Takashi; Asai, Takamasa; Ishimatsu, Atsushi


    We investigated the effects of elevated pCO2 in seawater both on the acute mortality and the reproductive properties of the benthic copepod Tigriopus japonicus and gastropod Babylonia japonica with the purpose of accumulating basic data for assessing potential environmental impacts of sub-sea geological storage of anthropogenic CO2 in Japan. Acute tests showed that nauplii of T. japonicus have a high tolerance to elevated pCO2 environments. Full life cycle tests on T. japonicus indicated NOEC=5800μatm and LOEC=37,000μatm. Adult B. japonica showed remarkable resistance to elevated pCO2 in the acute tests. Embryonic development of B. japonica showed a NOEC=1500μatm and LOEC=5400μatm. T. japonicus showed high resistance to elevated pCO2 throughout the life cycle and B. japonica are rather sensitive during the veliger stage when they started to form their shells.

  12. Evolutionary dynamics in the southwest Indian ocean marine biodiversity hotspot: a perspective from the rocky shore gastropod genus Nerita.


    Postaire, Bautisse; Bruggemann, J Henrich; Magalon, Hélène; Faure, Baptiste


    The Southwest Indian Ocean (SWIO) is a striking marine biodiversity hotspot. Coral reefs in this region host a high proportion of endemics compared to total species richness and they are particularly threatened by human activities. The island archipelagos with their diverse marine habitats constitute a natural laboratory for studying diversification processes. Rocky shores in the SWIO region have remained understudied. This habitat presents a high diversity of molluscs, in particular gastropods. To explore the role of climatic and geological factors in lineage diversification within the genus Nerita, we constructed a new phylogeny with an associated chronogram from two mitochondrial genes [cytochrome oxidase sub-unit 1 and 16S rRNA], combining previously published and new data from eight species sampled throughout the region. All species from the SWIO originated less than 20 Ma ago, their closest extant relatives living in the Indo-Australian Archipelago (IAA). Furthermore, the SWIO clades within species with Indo-Pacific distribution ranges are quite recent, less than 5 Ma. These results suggest that the regional diversification of Nerita is closely linked to tectonic events in the SWIO region. The Reunion mantle plume head reached Earth's surface 67 Ma and has been stable and active since then, generating island archipelagos, some of which are partly below sea level today. Since the Miocene, sea-level fluctuations have intermittently created new rocky shore habitats. These represent ephemeral stepping-stones, which have likely facilitated repeated colonization by intertidal gastropods, like Nerita populations from the IAA, leading to allopatric speciation. This highlights the importance of taking into account past climatic and geological factors when studying diversification of highly dispersive tropical marine species. It also underlines the unique history of the marine biodiversity of the SWIO region.

  13. Evolutionary Dynamics in the Southwest Indian Ocean Marine Biodiversity Hotspot: A Perspective from the Rocky Shore Gastropod Genus Nerita

    PubMed Central

    Postaire, Bautisse; Bruggemann, J. Henrich; Magalon, Hélène; Faure, Baptiste


    The Southwest Indian Ocean (SWIO) is a striking marine biodiversity hotspot. Coral reefs in this region host a high proportion of endemics compared to total species richness and they are particularly threatened by human activities. The island archipelagos with their diverse marine habitats constitute a natural laboratory for studying diversification processes. Rocky shores in the SWIO region have remained understudied. This habitat presents a high diversity of molluscs, in particular gastropods. To explore the role of climatic and geological factors in lineage diversification within the genus Nerita, we constructed a new phylogeny with an associated chronogram from two mitochondrial genes [cytochrome oxidase sub-unit 1 and 16S rRNA], combining previously published and new data from eight species sampled throughout the region. All species from the SWIO originated less than 20 Ma ago, their closest extant relatives living in the Indo-Australian Archipelago (IAA). Furthermore, the SWIO clades within species with Indo-Pacific distribution ranges are quite recent, less than 5 Ma. These results suggest that the regional diversification of Nerita is closely linked to tectonic events in the SWIO region. The Reunion mantle plume head reached Earth’s surface 67 Ma and has been stable and active since then, generating island archipelagos, some of which are partly below sea level today. Since the Miocene, sea-level fluctuations have intermittently created new rocky shore habitats. These represent ephemeral stepping-stones, which have likely facilitated repeated colonization by intertidal gastropods, like Nerita populations from the IAA, leading to allopatric speciation. This highlights the importance of taking into account past climatic and geological factors when studying diversification of highly dispersive tropical marine species. It also underlines the unique history of the marine biodiversity of the SWIO region. PMID:24736639

  14. The role of vermetid gastropods in the development of the Florida Middle Ground, northeast Gulf of Mexico

    USGS Publications Warehouse

    Reich, Christopher D.; Poore, Richard Z.; Hickey, Todd D.


    The Florida Middle Ground is a complex of north to northwest trending ridges that lie approximately 180 km northwest of Tampa Bay, Florida. The irregular ridges appear on the otherwise gently sloping West Florida shelf and exhibit between 10-15 m of relief. Modern studies interpret the ridges as remnants of a Holocene coral-reef buildup that today provide a hard substrate for growth of a variety of benthic organisms including hydrocorals, scleractinians, alcyonarians, and algae. Recent rotary coring reveals that the core of the eastern ridge of the Florida Middle Ground complex consists of unconsolidated marine calcareous muddy sand that is capped by a boundstone composed primarily of the sessile vermetid gastropod Petaloconchus sp., and overlays a weathered, fossiliferous limestone. Accelerator Mass Spectrometry radiocarbon ages (uncalibrated) on the 3.6-m thick vermetid worm rock indicate that it developed during a sea-level stillstand in the early Holocene (8,225 ±30-8,910 ± 25 yr B.P.). Our observations suggest that the Florida Middle Ground is a remnant of a series of shore parallel bars that formed in the early Holocene and were capped by a 3.6-m thick unit of vermetid gastropods. During a rapid sea-level rise that began ~8,000 yr B.P. the vermetids growth ceased and the worm rock preserved the ridges structure. Diver observations document that the edges of the ridges are currently being eroded and undermined by biological activity and current action, leading to calving of large capstone blocks.

  15. Ecosystem Alterations and Species Range Shifts: An Atlantic-Mediterranean Cephalaspidean Gastropod in an Inland Egyptian Lake

    PubMed Central

    Malaquias, Manuel António E.


    The eastern Atlantic and Mediterranean marine Cephalaspidea gastropod Haminoea orbignyana was collected from Lake Qarun (Fayoum, Egypt), a landlocked lake that has undergone a shift from freshwater to estuarine conditions in the past 100 years. Species identity was confirmed by both morphological (anatomical dissection and scanning electron microscopy) and molecular methods (COI gene phylogeny). Observations suggested a robust population of H. orbignyana in the lake with a density of ca. 64 individuals/m2 and ca. 105 egg masses/m2 during surveys conducted in the summer of 2013. The vast majority of snails and egg masses were found under rocks. Observations of egg masses in the lab showed a gradual change from whitish to yellow-green as the eggs matured and the release of veliger larvae alone after about a week. Although adult cephalaspideans readily consumed filamentous red and green algae, and cyanobacteria, laboratory trials showed that they consumed significantly more of the red alga Ceramium sp., than of the green alga Cladophora glomerata, with consumption of Oscillatoria margaritifera being similar to those on the two algae. When grown on these resources for 16 days, H. orbignyana maintained their mass on the rhodophyte and cyanobacterium, but not in starvation controls. No cephalaspideans grew over the course of this experiment. Lake Qarun has been periodically restocked with Mediterranean fishes and prawns since the 1920s to maintain local fisheries, which represents a possible route of colonization for H. orbignyana. Yet, based on literature records, it seems more likely that invasion of the lake by this gastropod species has occurred only within the last 20 years. As human activities redistribute species through direct and indirect means, the structure of the community of this inland lake has become unpredictable and the long-term effects of these recent introductions are unknown. PMID:27248835

  16. Assembly processes of gastropod community change with horizontal and vertical zonation in ancient Lake Ohrid: a metacommunity speciation perspective

    NASA Astrophysics Data System (ADS)

    Hauffe, Torsten; Albrecht, Christian; Wilke, Thomas


    The Balkan Lake Ohrid is the oldest and most diverse freshwater lacustrine system in Europe. However, it remains unclear whether species community composition, as well as the diversification of its endemic taxa, is mainly driven by dispersal limitation, environmental filtering, or species interaction. This calls for a holistic perspective involving both evolutionary processes and ecological dynamics, as provided by the unifying framework of the "metacommunity speciation model".The current study used the species-rich model taxon Gastropoda to assess how extant communities in Lake Ohrid are structured by performing process-based metacommunity analyses. Specifically, the study aimed (1) to identifying the relative importance of the three community assembly processes and (2) to test whether the importance of these individual processes changes gradually with lake depth or discontinuously with eco-zone shifts.Based on automated eco-zone detection and process-specific simulation steps, we demonstrated that dispersal limitation had the strongest influence on gastropod community composition. However, it was not the exclusive assembly process, but acted together with the other two processes - environmental filtering and species interaction. The relative importance of the community assembly processes varied both with lake depth and eco-zones, though the processes were better predicted by the latter.This suggests that environmental characteristics have a pronounced effect on shaping gastropod communities via assembly processes. Moreover, the study corroborated the high importance of dispersal limitation for both maintaining species richness in Lake Ohrid (through its impact on community composition) and generating endemic biodiversity (via its influence on diversification processes). However, according to the metacommunity speciation model, the inferred importance of environmental filtering and biotic interaction also suggests a small but significant influence of ecological

  17. Differential toxic effects of Ulva lactuca (Chlorophyta) on the herbivorous gastropods, Littorina littorea and L. obtusata (Mollusca).


    Peckol, Paulette; Putnam, Alysha B


    Members of the genus Ulva are widespread and abundant in intertidal and shallow subtidal areas but there are conflicting data regarding susceptibility to herbivory. While some studies have documented that Ulva spp. were favored by a diversity of marine herbivores, other work has revealed herbivore deterrence. We investigated grazing and growth rates of the littorinid species, Littorina littorea and L. obtusata, when offered Fucus vesiculosus, Ascophyllum nodosum, Ulva lactuca, and Chondrus crispus, highlighting distinctive vulnerabilities to toxic effects of U. lactuca. Ulva lactuca was the preferred food of L. littorea, while L. obtusata showed no grazing on this ephemeral algal species. In contrast, F. vesiculosus was highly preferred by L. obtusata. Although L. littorea demonstrated a grazing preference for U. lactuca, growth rate of this gastropod species was nearly 3× greater when fed F. vesiculosus, suggesting a non-lethal, negative effect of U. lactuca on L. littorea with long-term exposure. Mortality of L. obtusata ranged from 0% to 100% when held in the presence of various Ulva densities for 1 week, and Ulva exudate depressed herbivory of this gastropod. We conclude that the water-soluble, toxic exudate produced by U. lactuca in response to herbivory had allelochemical properties, and may contain a cleavage product (acrylic acid) of dimethylsulfoniopropionate or reactive oxygen species (i.e., H2 O2 ). Observed differences in susceptibility to Ulva toxicity by the littorinid species may be related to generalist versus specialist feeding and habitat strategies. © 2016 Phycological Society of America.

  18. Interactions between cyanobacteria and gastropods II. Impact of toxic Planktothrix agardhii on the life-history traits of Lymnaea stagnalis.


    Lance, Emilie; Paty, Chrystelle; Bormans, Myriam; Brient, Luc; Gérard, Claudia


    Hepatotoxins are frequently produced by many cyanobacterial species. Microcystins (MCs) are the most frequent and widely studied hepatotoxins, with potentially hazardous repercussions on aquatic organisms. As a ubiquitous herbivore living in eutrophic freshwaters, the snail Lymnaea stagnalis (Gastropoda: Pulmonata) is particularly exposed to cyanobacteria. The toxic filamentous Planktothrix agardhii is common in temperate lakes and is therefore, a potential food resource for gastropods. In the first part of this study, we demonstrated the ingestion of toxic P. agardhii by L. stagnalis during a 5 weeks exposure, with concomitant accumulation of, on average, 60% of total MCs ingested. After 3 weeks of non-toxic food (lettuce), approximately 90% of MCs were eliminated from tissues. Here, we investigate the impact of toxic P. agardhii consumption on the life-history traits (survival, growth and fecundity), locomotion and the structure of digestive and genital glands of juvenile and adult L. stagnalis. We observed a decrease of growth regardless of age, although this was more marked in juveniles, and a reduction of fecundity in adults. Survival and locomotion were not affected. Reduction of growth and fecundity continued to be observed even after feeding of non-toxic food for 3 weeks. The structure of the digestive gland was altered during the intoxication period but not irreversibly as cells tended to recover a normal status after the 3-week detoxification period. No histopathological changes occurred in the genital gland and oocytes, and spermatozoids were present in the gonadic acini. The density of cyanobacterial suspensions used in this study was comparable to those regularly observed in lakes, particularly in eutrophic waters. These results are discussed in terms of the negative impact of toxic cyanobacteria on natural communities of freshwater gastropods, and potential cascading effects on the equilibrium and functioning of the ecosystem.

  19. Self-interstitials and the 935 cm sup minus 1 band in silicon

    SciTech Connect

    Stein, H.J. )


    Substitutional carbon in Czochralski Si is found to decrease the formation rate for a 935 cm{sup {minus}1} infrared absorption band under neutron irradiation while that for a 965 cm{sup {minus}1} band (interstitial carbon trapped at interstitial oxygen) increases. The observations support a controversial previous assignment of the 935 cm{sup {minus}1} band to a center with interstitial Si trapped by interstitial oxygen.

  20. Evaluation of anelastic evidence for interstitial solute binding in bcc metals

    SciTech Connect

    Cost, J.R.; Stanley, J.T.


    A Direct Spectrum Analysis (DSA) technique has been applied to key internal friction and elastic after-effect data which are involved in the controversy over the existance of interstitial clustering in the refractory metals. It is found that at relatively high interstitial solute concentrations some of the Snoek peak broadening is due to relaxations that are distinct from the main relaxation. This finding supports the view that interstitial solutes have an interaction that produces clusters of interstitials.

  1. Phase estimation for a phased array therapeutic interstitial ultrasound probe.


    Yang, Zhenya; Dillenseger, Jean-Louis


    This paper deals about high intensity ultrasound interstitial therapy simulation. The simulated phased array ultrasound probe allows a dynamic electronic focusing of the therapeutic beam. In order to maximize the power deposit at the focal point we propose a method which allows to optimally defining the phase shift of the electrical control signal for each individual element.

  2. [Lung transplantation in pulmonary fibrosis and other interstitial lung diseases].


    Berastegui, Cristina; Monforte, Victor; Bravo, Carlos; Sole, Joan; Gavalda, Joan; Tenório, Luis; Villar, Ana; Rochera, M Isabel; Canela, Mercè; Morell, Ferran; Roman, Antonio


    Interstitial lung disease (ILD) is the second indication for lung transplantation (LT) after emphysema. The aim of this study is to review the results of LT for ILD in Hospital Vall d'Hebron (Barcelona, Spain). We retrospectively studied 150 patients, 87 (58%) men, mean age 48 (r: 20-67) years between August 1990 and January 2010. One hundred and four (69%) were single lung transplants (SLT) and 46 (31%) bilateral-lung transplants (BLT). The postoperative diagnoses were: 94 (63%) usual interstitial pneumonia, 23 (15%) nonspecific interstitial pneumonia, 11 (7%) unclassifiable interstitial pneumonia and 15% miscellaneous. We describe the functional results, complications and survival. The actuarial survival was 87, 70 and 53% at one, 3 and 5 years respectively. The most frequent causes of death included early graft dysfunction and development of chronic rejection in the form of bronchiolitis obliterans (BOS). The mean postoperative increase in forced vital capacity and forced expiratory volume in the first second (FEV1) was similar in SLT and BLT. The best FEV1 was reached after 10 (r: 1-36) months. Sixteen percent of patients returned to work. At some point during the evolution, proven acute rejection was diagnosed histologically in 53 (35%) patients. The prevalence of BOS among survivors was 20% per year, 45% at 3 years and 63% at 5 years. LT is the best treatment option currently available for ILD, in which medical treatment has failed. Copyright © 2013 Elsevier España, S.L.U. All rights reserved.

  3. [Trisomy 21 syndrome associated interstitial lung disease: a case report].


    Chen, Jiehua; Ma, Hongling; Zheng, Yuejie; Cao, Juan; Zeng, Hongwu; Zhang, Qing


    To study the pathology, imaging and clinical features of a child with trisomy 21 syndrome associated interstitial lung disease. Data of a case with trisomy 21 syndrome associated interstitial lung disease confirmed by lung imaging and pathology were collected, analyzed and the related reports in literature were reviewed. The patient was a one year and 7 months old boy who suffered from severe pneumonia and recurrent infection during his hospital stay. When his disease was stable, he did not have shortness of breath and cyanosis, but a chest computed tomography (CT) showed ground-glass opacity, regional emphysema, band-like change in lung parenchyma, which indicated interstitial lung diseases. Unequal air inflation in bilateral lungs and diffuse over-distension of peripheral air spaces in lung surface were seen through thoracoscope. Pathological examination indicated that alveolar, alveolar ducts and alveolar sac were enlarged, alveolar septa was expanded. There were two reports in lung pathology of trisomy 21 syndrome, alveolar growth abnormalities was seen in 86%-88% cases. The multiple subpleural cysts in chest CT was characteristic. Clinically, trisomy 21 syndrome had high morbidity of respiratory tract infection and progress to respiratory failure frequently. Prolonged postoperative desaturation was constant which required long duration of respiratory support. Trisomy 21 syndrome associated alveolar growth abnormalities were confirmed, which manifest as alveolar simplification in pathology and interstitial lung diseases in imaging. The risk of respiratory failure in these cases caused by infection and surgery should be considered.

  4. Near-infrared fiber delivery systems for interstitial photothermal therapy

    NASA Astrophysics Data System (ADS)

    Slatkine, Michael; Mead, Douglass S.; Konwitz, Eli; Rosenberg, Zvi


    Interstitial photothermal coagulation has long been recognized as a potential important, minimally invasive modality for treating a variety of pathologic conditions. We present two different technologies for interstitial photothermal coagulation of tissue with infrared lasers: An optical fiber with a radially symmetric diffusing tip for deep coagulation, and a flat bare fiber for the coagulation of thin and long lesions by longitudinally moving the fiber while lasing in concert. Urology and Gynecology Fibers: The fibers are 600 microns diameter with 20 - 40 mm frosted distal tips protected by a smooth transparent cover. When used with a Neodymium:YAG (Nd:YAG) laser, the active fiber surface diffuses optical radiation in a radial pattern, delivering up to 40 W power, and thus providing consistent and uniform interstitial photothermal therapy. Coagulation depth ranges from 4 to 15 mm. Animal studies in the United States and clinical studies in Europe have demonstrated the feasibility of using these fibers to treat benign prostatic hyperplasia and endometrial coagulation. Rhinology Fiber: The fiber is an 800 micron diameter flat fiber operated at 8 W power level while being interstitially pushed and pulled along its axis. A long and thin coagulated zone is produced. The fiber is routinely used for the shrinking of hypertrophic turbinates without surrounding and bone mucusal damage in ambulatory environments.

  5. Rheumatoid interstitial lung disease presenting as cor pulmonale.


    Acharya, Sourya; Mahajan, S N; Shukla, Samarth; Diwan, S K; Banode, Pankaj; Kothari, Nirmesh


    Rheumatiod arthritis (RA) is a multisystem connective tissue disorder. The predominant presentation is polyarticular, symmetric peripheral arthritis with relative sparing of axial skeleton. Inflammatory synovitis is the pathologic hallmark. Extra-articular manifestations of RA can involve several other organ systems and amongst them pulmonary manifestations occur commonly. We report a case of rheumatoid interstitial lung disease presenting as cor pulmonale.

  6. Localized interstitial granuloma annulare induced by subcutaneous injections for desensitization.


    Spring, Philipp; Vernez, Maxime; Maniu, Christa-Maria; Hohl, Daniel


    We describe a patient with interstitial granuloma annulare associated with subcutaneous injection therapy (SIT) for desensitization to a type I allergy. Asymptomatic, erythematous, violaceous annular patches were located at the injection sites on both her arms. Medical history revealed perennial rhinoconjonctivitis treated with SIT (Phostal Stallergen® cat 100% and D. pteronyssinus/D.farinae 50%:50%).

  7. Myocardial microvascular permeability, interstitial oedema, and compromised cardiac function

    PubMed Central

    Dongaonkar, Ranjeet M.; Stewart, Randolph H.; Geissler, Hans J.; Laine, Glen A.


    The heart, perhaps more than any other organ, is exquisitely sensitive to increases in microvascular permeability and the accumulation of myocardial interstitial oedema fluid. Whereas some organs can cope with profound increases in the interstitial fluid volume or oedema formation without a compromise in function, heart function is significantly compromised with only a few percent increase in the interstitial fluid volume. This would be of little consequence if myocardial oedema were an uncommon pathology. On the contrary, myocardial oedema forms in response to many disease states as well as clinical interventions such as cardiopulmonary bypass and cardioplegic arrest common to many cardiothoracic surgical procedures. The heart's inability to function effectively in the presence of myocardial oedema is further confounded by the perplexing fact that the resolution of myocardial oedema does not restore normal cardiac function. We will attempt to provide some insight as to how microvascular permeability and myocardial oedema formation compromise cardiac function and discuss the acute changes that might take place in the myocardium to perpetuate compromised cardiac function following oedema resolution. We will also discuss compensatory changes in the interstitial matrix of the heart in response to chronic myocardial oedema and the role they play to optimize myocardial function during chronic oedemagenic disease. PMID:20472566

  8. Bronchoalveolar lavage in HIV infected patients with interstitial pneumonitis.

    PubMed Central

    de Blic, J; Blanche, S; Danel, C; Le Bourgeois, M; Caniglia, M; Scheinmann, P


    The value of taking microbiological and cytological specimens by flexible bronchoscopy and bronchoalveolar lavage under local anaesthesia was assessed on 43 occasions in 35 HIV infected children, aged 3 months to 16 years, with interstitial pneumonitis. In acute interstitial pneumonitis (n = 22, 26 specimens from bronchoalveolar lavages) the microbiological yield was 73%, Pneumocystis carinii being the commonest infective agent (n = 14). P carinii pneumonia was found only in children with deficient antigen induced lymphocyte proliferative responses who had not been treated with long term prophylactic co-trimoxazole. In contrast, in 13 children with chronic interstitial pneumonitis that was consistent with a diagnosis of pulmonary lymphoid hyperplasia who underwent bronchoalveolar lavage on 17 occasions, there were two isolates of cytomegalovirus and one of adenovirus, but P carinii was not found. Ten of the 13 children had normal antigen induced lymphocyte proliferative responses. Useful cytological data were also gleaned from bronchoalveolar lavage specimens. Lymphocytosis was significantly higher in pulmonary lymphoid hyperplasia (36(SD 11)%) than in P carinii pneumonia (24(19)%) whereas the percentage of polymorphonuclear neutrophils was significantly lower (3(2)% compared with 12(13)%). Flexible bronchoscopy with bronchoalveolar lavage is safe even in young infants and should reduce the necessity for open lung biopsy in the management of HIV infected children with interstitial pneumonitis. PMID:2817943

  9. Renal failure due to granulomatous interstitial nephritis after pulmonary sarcoidosis.


    van Dorp, W T; Jie, K; Lobatto, S; Weening, J J; Valentijn, R M


    Two patients, who had had pulmonary sarcoidosis, developed renal failure due to sarcoid granulomatous interstitial nephritis after their original pulmonary symptoms had subsided. Treatment with prednisone resulted in almost complete recovery of renal function. Lysozyme and angiotensin-converting enzyme levels and gallium scintigraphy can be of diagnostic value.

  10. Connective Tissue Disease-associated Interstitial Lung Disease: A review

    PubMed Central

    Gutsche, Markus; Rosen, Glenn D.; Swigris, Jeffrey J.


    Interstitial lung disease (ILD) is commonly encountered in patients with connective tissue diseases (CTD). Besides the lung parenchyma, the airways, pulmonary vasculature and structures of the chest wall may all be involved, depending on the type of CTD. As a result of this so-called multi-compartment involvement, airflow limitation, pulmonary hypertension, vasculitis and extrapulmonary restriction can occur alongside fibro-inflammatory parenchymal abnormalities in CTD. Rheumatoid arthritis (RA), systemic sclerosis (SSc), poly-/dermatomyositis (PM/DM), Sjögren’s syndrome (SjS), systemic lupus erythematosus (SLE), and undifferentiated (UCTD) as well as mixed connective tissue disease (MCTD) can all be associated with the development of ILD. Non-specific interstitial pneumonia (NSIP) is the most commonly observed histopathological pattern in CTD-ILD, but other patterns including usual interstitial pneumonia (UIP), organizing pneumonia (OP), diffuse alveolar damage (DAD) and lymphocytic interstitial pneumonia (LIP) may occur. Although the majority of patients with CTD-ILD experience stable or slowly advancing ILD, a small yet significant group exhibits a more severe and progressive course. Randomized placebo-controlled trials evaluating the efficacy of immunomodulatory treatments have been conducted only in SSc-associated ILD. However, clinical experience suggests that a handful of immunosuppressive medications are potentially effective in a sizeable portion of patients with ILD caused by other CTDs. In this manuscript, we review the clinical characteristics and management of the most common CTD-ILDs. PMID:23125954

  11. Interstitial fluid flow: simulation of mechanical environment of cells in the interosseous membrane

    NASA Astrophysics Data System (ADS)

    Yao, Wei; Ding, Guang-Hong


    In vitro experiments have shown that subtle fluid flow environment plays a significant role in living biological tissues, while there is no in vivo practical dynamical measurement of the interstitial fluid flow velocity. On the basis of a new finding that capillaries and collagen fibrils in the interosseous membrane form a parallel array, we set up a porous media model simulating the flow field with FLUENT software, studied the shear stress on interstitial cells' surface due to the interstitial fluid flow, and analyzed the effect of flow on protein space distribution around the cells. The numerical simulation results show that the parallel nature of capillaries could lead to directional interstitial fluid flow in the direction of capillaries. Interstitial fluid flow would induce shear stress on the membrane of interstitial cells, up to 30 Pa or so, which reaches or exceeds the threshold values of cells' biological response observed in vitro. Interstitial fluid flow would induce nonuniform spacial distribution of secretion protein of mast cells. Shear tress on cells could be aff