Sample records for lambda cii gene

  1. Host regulation of lysogenic decision in bacteriophage lambda: transmembrane modulation of FtsH (HflB), the cII degrading protease, by HflKC (HflA).

    PubMed

    Kihara, A; Akiyama, Y; Ito, K

    1997-05-27

    The cII gene product of bacteriophage lambda is unstable and required for the establishment of lysogenization. Its intracellular amount is important for the decision between lytic growth and lysogenization. Two genetic loci of Escherichia coli are crucial for these commitments of infecting lambda genome. One of them, hflA encodes the HflKC membrane protein complex, which has been believed to be a protease degrading the cII protein. However, both its absence and overproduction stabilized cII in vivo and the proposed serine protease-like sequence motif in HflC was dispensable for the lysogenization control. Moreover, the HflKC protein was found to reside on the periplasmic side of the plasma membrane. In contrast, the other host gene, ftsH (hflB) encoding an integral membrane ATPase/protease, is positively required for degradation of cII, since loss of its function stabilized cII and its overexpression accelerated the cII degradation. In vitro, purified FtsH catalyzed ATP-dependent proteolysis of cII and HflKC antagonized the FtsH action. These results, together with our previous finding that FtsH and HflKC form a complex, suggest that FtsH is the cII degrading protease and HflKC is a modulator of the FtsH function. We propose that this transmembrane modulation differentiates the FtsH actions to different substrate proteins such as the membrane-bound SecY protein and the cytosolic cII protein. This study necessitates a revision of the prevailing view about the host control over lambda lysogenic decision.

  2. The Lambda Select cII Mutation Detection System.

    PubMed

    Besaratinia, Ahmad; Tommasi, Stella

    2018-04-26

    A number of transgenic animal models and mutation detection systems have been developed for mutagenicity testing of carcinogens in mammalian cells. Of these, transgenic mice and the Lambda (λ) Select cII Mutation Detection System have been employed for mutagenicity experiments by many research groups worldwide. Here, we describe a detailed protocol for the Lambda Select cII mutation assay, which can be applied to cultured cells of transgenic mice/rats or the corresponding animals treated with a chemical/physical agent of interest. The protocol consists of the following steps: (1) isolation of genomic DNA from the cells or organs/tissues of transgenic animals treated in vitro or in vivo, respectively, with a test compound; (2) recovery of the lambda shuttle vector carrying a mutational reporter gene (i.e., cII transgene) from the genomic DNA; (3) packaging of the rescued vectors into infectious bacteriophages; (4) infecting a host bacteria and culturing under selective conditions to allow propagation of the induced cII mutations; and (5) scoring the cII-mutants and DNA sequence analysis to determine the cII mutant frequency and mutation spectrum, respectively.

  3. Mutations That Affect the Efficiency of Translation of mRNA for the cII Gene of Coliphage Lambda

    PubMed Central

    Dul, Ed; Mahoney, Michael E.; Wulff, Daniel L.

    1987-01-01

    Starting with the λ pRE- strain λctr1 cy3008, which forms clear plaques, we have isolated two mutant strains, λdya2 ctr1 cy3008 and λ dya3 ctr1 cy3008, that form plaques with very slightly turbid centers. The dya2 and dya3 mutations lie in the region of overlap between the PRE promoter and the ribosome recognition region of the cII gene, and have nucleotide alterations at positions -1 and +5 of pRE, and alterations of cII mRNA at -16 and -21 nucleotides before the initial AUG codon of the gene. Both mutations destabilize a stem structure that may be formed by cII mRNA, and dya2 also changes the sequence on cII mRNA that is complementary to the 3'-end of 16 S rRNA from 5'-UAAGGA-3' to 5'-UGAGGA-3'.—The dya2 and dya3 mutations, along with the ctr1 mutation, which destabilizes either of two alternate stem structures which may be formed by cII mRNA (these being more stable stem structures than the one affected by dya2 and dya3), were tested for their ability to reverse two cII- mutations that are characterized by inefficient translation of cII mRNA. These are cII3088, an A → G mutation four bases before the initial AUG codon, and cII3059 , a GUU → GAU (Val2 → Asp) second codon mutation. It was found that ctr1 completely reverses the translation defects of these two mutations, while dya2 partially reverses these translation defects. The dya3 mutation has no effect on translation efficiency under any condition tested. However neither the ctr1 mutation nor the dya2 mutation has much effect on translation efficiency in an otherwise cII+ background, indicating that other factors must limit the rate of translation of cII mRNA under these conditions. PMID:2953647

  4. Role of C-terminal residues in oligomerization and stability of lambda CII: implications for lysis-lysogeny decision of the phage.

    PubMed

    Datta, Ajit Bikram; Roy, Siddhartha; Parrack, Pradeep

    2005-01-14

    A crucial element in the lysis-lysogeny decision of the temperate coliphage lambda is the phage protein CII, which has several interesting properties. It promotes lysogeny through activation of three phage promoters p(E), p(I) and p(aQ), recognizing a direct repeat sequence TTGCN6TTGC at each. The three-dimensional structure of CII, a homo-tetramer of 97 residue subunits, is unknown. It is an unstable protein in vivo, being rapidly degraded by the host protease HflB (FtsH). This instability is essential for the function of CII in the lysis-lysogeny switch. From NMR and limited proteolysis we show that about 15 C-terminal residues of CII are highly flexible, and may act as a target for proteolysis in vivo. From in vitro transcription, isothermal calorimetry and gel chromatography of CII (1-97) and its truncated fragments CIIA (4-81/82) and CIIB (4-69), we find that residues 70-81/82 are essential for (a) tetramer formation, (b) operator binding and (c) transcription activation. Presumably, tetramerization is necessary for the latter functions. Based on these results, we propose a model for CII structure, in which protein-protein contacts for dimer and tetramer formation are different. The implications of tetrameric organization, essential for CII activity, on the recognition of the direct repeat sequence is discussed.

  5. Recombinant human type II collagen hydrogel provides a xeno-free 3D micro-environment for chondrogenesis of human bone marrow-derived mesenchymal stromal cells.

    PubMed

    Muhonen, Virpi; Narcisi, Roberto; Nystedt, Johanna; Korhonen, Matti; van Osch, Gerjo J V M; Kiviranta, Ilkka

    2017-03-01

    Recombinant human type II collagen (rhCII) hydrogel was tested as a xeno-free micro-environment for the chondrogenesis of human bone marrow-derived mesenchymal stromal cells (BM-MSCs). The rhCII hydrogels were seeded with BM-MSCs and cultured in a xeno-free chondro-inductive medium for 14, 28 and 84 days. High-density pellet cultures served as controls. The samples were subjected to biochemical, histological and gene expression analyses. Although the cells deposited glycosaminoglycans into the extracellular space significantly more slowly in the rhCII hydrogels compared to the high-density pellets, a similar potential of matrix deposition was reached by the end of the 84-day culture. At day 28 of culture, the gene expression level for cartilage marker genes (i.e. genes encoding for Sox9 transcription factor, Collagen type II and Aggrecan) were considerably lower in the rhCII hydrogels than in the high-density pellets, but at the end of the 84-day culture period, all the cartilage marker genes analysed were expressed at a similar level. Interestingly, the expression of the matrix metallopeptidases (MMP)-13, MMP-14 and MMP-8, i.e. extracellular collagen network-degrading enzymes, were transiently upregulated in the rhCII hydrogel, indicating active matrix reorganization. This study demonstrated that the rhCII hydrogel functions as a xeno-free platform for BM-MSC chondrogenesis, although the process is delayed. The reversible catabolic reaction evoked by the rhCII hydrogel might be beneficial in graft integration in vivo and pinpoints the need to further explore the use of hydrogels containing recombinant extracellular matrix (ECM) proteins to induce the chondrogenesis of MSCs. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.

  6. A novel APOC2 gene mutation identified in a Chinese patient with severe hypertriglyceridemia and recurrent pancreatitis.

    PubMed

    Jiang, Jingjing; Wang, Yuhui; Ling, Yan; Kayoumu, Abudurexiti; Liu, George; Gao, Xin

    2016-01-16

    The severe forms of hypertriglyceridemia are usually caused by genetic defects. In this study, we described a Chinese female with severe hypertriglyceridemia caused by a novel homozygous mutation in the APOC2 gene. Lipid profiles of the pedigree were studied in detail. LPL and HL activity were also measured. The coding regions of 5 candidate genes (namely LPL, APOC2, APOA5, LMF1, and GPIHBP1) were sequenced using genomic DNA from peripheral leucocytes. The ApoE gene was also genotyped. Serum triglyceride level was extremely high in the proband, compared with other family members. Plasma LPL activity was also significantly reduced in the proband. Serum ApoCII was very low in the proband as well as in the heterozygous mutation carriers. A novel mutation (c.86A > CC) was identified on exon 3 [corrected] of the APOC2 gene, which converted the Asp [corrected] codon at position 29 into Ala, followed by a termination codon (TGA). This study presented the first case of ApoCII deficiency in the Chinese population, with a novel mutation c.86A > CC in the APOC2 gene identified. Serum ApoCII protein might be a useful screening test for identifying mutation carriers.

  7. Nature of KaiB-KaiC binding in the cyanobacterial circadian oscillator

    PubMed Central

    Pattanayek, Rekha; Yadagiri, Kirthi Kiran; Ohi, Melanie D.; Egli, Martin

    2013-01-01

    In the cyanobacteria Synechococcus elongatus and Thermosynechococcus elongatus, the KaiA, KaiB and KaiC proteins in the presence of ATP generate a post-translational oscillator (PTO) that can be reconstituted in vitro. KaiC is the result of a gene duplication and resembles a double doughnut with N-terminal CI and C-terminal CII hexameric rings. Six ATPs are bound between subunits in both the CI and CII ring. CI harbors ATPase activity, and CII catalyzes phosphorylation and dephosphorylation at T432 and S431 with a ca. 24-h period. KaiA stimulates KaiC phosphorylation, and KaiB promotes KaiC subunit exchange and sequesters KaiA on the KaiB-KaiC interface in the final stage of the clock cycle. Studies of the PTO protein-protein interactions are convergent in terms of KaiA binding to CII but have led to two opposing models of the KaiB-KaiC interaction. Electron microscopy (EM) and small angle X-ray scattering (SAXS), together with native PAGE using full-length proteins and separate CI and CII rings, are consistent with binding of KaiB to CII. Conversely, NMR together with gel filtration chromatography and denatured PAGE using monomeric CI and CII domains support KaiB binding to CI. To resolve the existing controversy, we studied complexes between KaiB and gold-labeled, full-length KaiC with negative stain EM. The EM data clearly demonstrate that KaiB contacts the CII ring. Together with the outcomes of previous analyses, our work establishes that only CII participates in interactions with KaiA and KaiB as well as with the His kinase SasA involved in the clock output pathway. PMID:23388462

  8. Rearrangement and expression of the human {Psi}C{lambda}6 gene segment results in a surface Ig receptor with a truncated light chain constant region

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Stiernholm, N.B.J.; Verkoczy, L.K.; Berinstein, N.L.

    1995-05-01

    The constant region of the human Ig{lambda} locus consists of seven tandemly organized J-C gene segments. Although it has been established that the J-C{lambda}1, J-C{lambda}2, J-C{lambda}3, and J-C{lambda}7 gene segments are functional, and code for the four distinct Ig{lambda} isotypes found in human serum, the J-C{lambda}4, J-C{lambda}5, and J-C{lambda}6 gene segments are generally considered to be pseudogenes. Although one example of a functional J-C{lambda}6 gene segment has been documented, in the majority of cases, J-C{lambda}6 is rendered nonfunctional by virtue of a single duplication of four nucleotides, creating a premature translational arrest. We show here that rearrangements to the J-C{lambda}6more » gene segment do occur, and that such a rearrangement encodes an Ig{lambda} protein that lacks the terminal end of the constant region. We also show that this truncated protein is expressed on the surface with the IgH chain, creating an unusual surface Ig (sIg) receptor (sIg{triangle}CL). Cells that express this receptor on the surface do so at significantly reduced levels compared with clonally related variants, which express sIg receptors with conventional Ig{lambda} L chains. However, the effects of sIg cross-linking on tyrosine phosphorylation and surface expression of the CD25 and CD71 Ags are similar in cells that express conventional sIg receptors and in those that express sIg{triangle}CL receptors, suggesting that the latter could possibly function as an Ag receptor. 35 refs., 7 figs.« less

  9. Somatic diversification of chicken immunoglobulin light chains by point mutations.

    PubMed

    Parvari, R; Ziv, E; Lantner, F; Heller, D; Schechter, I

    1990-04-01

    The light-chain locus of chicken has 1 functional V lambda 1 gene, 1 J gene, and 25 pseudo-V lambda-genes (where V = variable and J = joining). A major problem is which somatic mechanisms expand this extremely limited germ-line information to generate many different antibodies. Weill's group [Reynaud, C. A., Anquez, V., Grimal, H. & Weill, J. C. (1987) Cell 48, 379-388] has shown that the pseudo-V lambda-genes diversify the rearranged V lambda 1 by gene conversion. Here we demonstrate that chicken light chains are further diversified by somatic point mutations and by V lambda 1-J flexible joining. Somatic point mutations were identified in the J and 3' noncoding DNA of rearranged light-chain genes of chicken. These regions were analyzed because point mutations in V lambda 1 are obscured by gene conversion; the J and 3' noncoding DNA are presented in one copy per haploid genome and are not subject to gene conversion. In rodents point mutations occur as frequently in the V-J coding regions as in the adjacent flanking DNA. Therefore, we conclude that somatic point mutations diversify the V lambda 1 of chicken. The frequency (0-1%) and distribution of the mutations (decreasing in number with increased distance from the V lambda 1 segment) in chicken were as observed in rodents. Sequence variability at the V lambda 1-J junctions could be attributed to imprecise joining of the V lambda 1 and J genes. The modification by gene conversion of rearranged V lambda 1 genes in the bursa was similar in chicken aged 3 months (9.5%) or 3 weeks (9.1%)--i.e., gene conversion that generates the preimmune repertoire in the bursa seems to level off around 3 weeks of age. This preimmune repertoire can be further diversified by somatic point mutations that presumably lead to the formation of antibodies with increased affinity. A segment with structural features of a matrix association region [(A + T)-rich and four topoisomerase II binding sites] was identified in the middle of the J-C lambda intron (where C = constant).

  10. Overexpression of the DNA mismatch repair factor, PMS2, confers hypermutability and DNA damage tolerance.

    PubMed

    Gibson, Shannon L; Narayanan, Latha; Hegan, Denise Campisi; Buermeyer, Andrew B; Liskay, R Michael; Glazer, Peter M

    2006-12-08

    Inherited defects in genes associated with DNA mismatch repair (MMR) have been linked to familial colorectal cancer. Cells deficient in MMR are genetically unstable and demonstrate a tolerance phenotype in response to certain classes of DNA damage. Some sporadic human cancers also show abnormalities in MMR gene function, typically due to diminished expression of one of the MutL homologs, MLH1. Here, we report that overexpression of the MutL homolog, human PMS2, can also cause a disruption of the MMR pathway in mammalian cells, resulting in hypermutability and DNA damage tolerance. A mouse fibroblast cell line carrying a recoverable lambda phage shuttle vector for mutation detection was transfected with either a vector designed to express hPMS2 or with an empty vector control. Cells overexpressing hPMS2 were found to have elevated spontaneous mutation frequencies at the cII reporter gene locus. They also showed an increase in the level of mutations induced by the alkylating agent, methynitrosourea (MNU). Clonogenic survival assays demonstrated increased survival of the PMS2-overexpressing cells following exposure to MNU, consistent with the induction of a damage tolerance phenotype. Similar results were seen in cells expressing a mutant PMS2 gene, containing a premature stop codon at position 134 and representing a variant found in an individual with familial colon cancer. These results show that dysregulation of PMS2 gene expression can disrupt MMR function in mammalian cells and establish an additional carcinogenic mechanism by which cells can develop genetic instability and acquire resistance to cytotoxic cancer therapies.

  11. Novel Type of Renal Amyloidosis Derived from Apolipoprotein-CII.

    PubMed

    Nasr, Samih H; Dasari, Surendra; Hasadsri, Linda; Theis, Jason D; Vrana, Julie A; Gertz, Morie A; Muppa, Prasuna; Zimmermann, Michael T; Grogg, Karen L; Dispenzieri, Angela; Sethi, Sanjeev; Highsmith, W Edward; Merlini, Giampaolo; Leung, Nelson; Kurtin, Paul J

    2017-02-01

    Amyloidosis is characterized by extracellular deposition of misfolded proteins as insoluble fibrils. Most renal amyloidosis cases are Ig light chain, AA, or leukocyte chemotactic factor 2 amyloidosis, but rare hereditary forms can also involve the kidneys. Here, we describe the case of a 61-year-old woman who presented with nephrotic syndrome and renal impairment. Examination of the renal biopsy specimen revealed amyloidosis with predominant involvement of glomeruli and medullary interstitium. Proteomic analysis of Congo red-positive deposits detected large amounts of the Apo-CII protein. DNA sequencing of the APOC2 gene in the patient and one of her children detected a heterozygous c.206A→T transition, causing an E69V missense mutation. We also detected the mutant peptide in the proband's renal amyloid deposits. Using proteomics, we identified seven additional elderly patients with Apo-CII-rich amyloid deposits, all of whom had kidney involvement and histologically exhibited nodular glomerular involvement. Although prior in vitro studies have shown that Apo-CII can form amyloid fibrils and that certain mutations in this protein promote amyloid fibrillogenesis, there are no reports of this type of amyloidosis in humans. We propose that this study reveals a new form of hereditary amyloidosis (AApoCII) that is derived from the Apo-CII protein and appears to manifest in the elderly and preferentially affect the kidneys. Copyright © 2017 by the American Society of Nephrology.

  12. Rocket-borne observation of singly ionized carbon 158 micron emission from the diffuse interstellar medium

    NASA Astrophysics Data System (ADS)

    Bock, James Joseph

    1994-01-01

    We report an observation of 158 micron line emission from singly ionized carbon from the diffuse interstellar medium at high galactic latitude. The integrated line intensity is measured in a 36 arcmin field-of-view along a triangular scan path in a 5 deg x 20 deg region in Ursa Major using a rocket-borne, liquid helium cooled spectrophotometer. The scan includes high latitude infrared cirrus, molecular clouds, a bright external galaxy, M82, and the HI Hole, which is a region of uniquely low neutral hydrogen column density. Emission from (CII) is observed in all regions and, in the absence of appreciable CO emission, is well correlated with neutral hydrogen column density. We observe a (CII) gas cooling rate which varies from (3.25 +/- 0.8 to 1.18 +/- 0.4) x 10-26 ergs-1 H-atom-1, in good agreement with recent observations of UV absorption lines at high galactic latitude. Regions with CO emission have enhanced (CII) line emission over that expected from the correlation with neutral hydrogen column density. The line-to-continuum ratio varies from I(CII)/lambda Ilambda = 0.002 to 0.008 in comparison with the all sky average of 0.0082 reported by FIRAS, which is heavily weighted towards the Galactic plane. The far-infrared continuum intensity, measured at 134 microns, 154 microns, and 186 microns, correlates with the 100 micron brightness measured by IRAS, and in regions excluding molecular clouds, with HI column density. The far-infrared brightness correlated with HI column density is fit by a thermal spectrum with a temperature T = 16.4 (+2.3/-1.8) K assuming an index of emissivity n = 2. The residual brightness after subtracting the emission correlated with neutral hydrogen column density yields an upper limit to the far-infrared extra-galactic background radiation of lambda Ilambda (154 microns) less than 2.6 x 10-12 W cm-2 sr-1. The observation of M82 confirms the laboratory calibration of the instrument. Unique instrumentation was developed to realize the instrument. A high sensitivity detection system consisting of stressed Ge:Ga photoconductors coupled to charge integrating amplifiers is described. We developed a compact, miniature He-4 refrigerator suitable for spaceborne operation. A silicon-gap Fabry-Perot filter, designed for use in high-throughput, compact optical systems, was developed. The performance of a far-infrared low-pass filter stack with high out-of-band rejection is reported. We tested the performance of a telescope baffle system with high-off axis rejection in a combination of ground-based and rocket-borne experiments. A submillimeter-black coating suitable for use in spaceborne telescopes is described. We report the laboratory testing of the instrument and the performance during the flight, and discuss the scientific implications of the observations.

  13. Use of lambda pMu bacteriophages to isolate lambda specialized transducing bacteriophages carrying genes for bacterial chemotaxis.

    PubMed

    Kondoh, H; Paul, B R; Howe, M M

    1980-09-01

    A general method for constructing lambda specialized transducing phages is described. The method, which is potentially applicable to any gene of Escherichia coli, is based on using Mu DNA homology to direct the integration of a lambda pMu phage near the genes whose transduction is desired. With this method we isolated a lambda transducing phage carrying all 10 genes in the che gene cluster (map location, 41.5 to 42.5 min). The products of the cheA and tar genes were identified by using transducing phages with amber mutations in these genes. It was established that tar codes for methyl-accepting chemotaxis protein II (molecular weight, 62,000) and that cheA codes for two polypeptides (molecular weights, 76,000 and 66,000). Possible origins of the two cheA polypeptides are discussed.

  14. The apolipoprotein E/CI/CII gene cluster and late-onset Alzheimer disease

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Yu, Chang-En; Nemens, E.; Olson, J.M.

    1994-04-01

    The chromosome 19 apolipoprotein E/CI/CII gene cluster was examined for evidence of linkage to a familial Alzheimer disease (FAD) locus. The family groups studied were Volga German (VG), early-onset non-VG (ENVG; mean age at onset <60 years), and late-onset families. A genetic association was observed between apolipoprotein E (ApoE) allele E4 and FAD in late-onset families; the E4 allele frequency was .51 in affected subjects, .37 in at-risk subjects, .11 in spouses, and .19 in unrelated controls. The differences between the E4 frequencies in affected subjects versus controls and in at-risk subjects versus controls were highly significant. No association betweenmore » the E4 allele and FAD was observed in the ENVG or VG groups. A statistically significant allelic association between E4 and AD was also observed in a group of unrelated subjects; the E4 frequency was .26 in affected subjects, versus .19 in controls (Z[sub SND] = 2.20, P < .03). Evidence of linkage of ApoE and ApoCII to FAD was examined by maximum-likelihood methods, using three models and assuming autosomal dominant inheritance: (1) age-dependent penetrance, (2) extremely low (1%) penetrance, and (3) age-dependent penetrance corrected for sporadic Alzheimer disease (AD). For ApoCII in late-onset families, results for close linkage were negative, and only small positive lod-score-statistic (Z) values were obtained. For ApoE in late-onset kindreds, positive Z values were obtained when either allele frequencies from controls or allele frequencies from the families were used. When linkage disequilibrium was incorporated into the analysis, the Z values increased. For the ENVG group, results for ApoE and ApoCII were uniformly negative. Affected-pedigree-member analysis gave significant results for the late-onset kindreds, for ApoE, when control allele frequencies were used but not when allele frequencies were derived from the families. 58 refs., 6 tabs.« less

  15. Expression of three sHSP genes involved in heat pretreatment-induced chilling tolerance in banana fruit.

    PubMed

    He, Li-hong; Chen, Jian-ye; Kuang, Jian-fei; Lu, Wang-jin

    2012-07-01

    Banana fruit is highly susceptible to chilling injury. In previous research it was shown that heat pretreatment of banana fruit at 38 °C for 3 days before storage at a chilling temperature of 8 °C for 12 days prevented increases in visible chilling injury index, electrolyte leakage and malondialdehyde content and also decreases in lightness and chroma, indicating that heat pretreatment could effectively alleviate chilling injury of banana fruit. However, little is known about the role of small heat shock proteins (sHSPs) in postharvest chilling tolerance of banana fruit. In the present study, three cytosolic sHSP expression profiles in peel and pulp tissues of banana fruit during heat pretreatment and subsequent chilled storage (8 °C) were investigated in relation to heat pretreatment-induced chilling tolerance. Three full-length cDNAs of cytosolic sHSP genes, including two class I sHSP (CI sHSP) and one class II sHSP (CII sHSP) cDNAs, named Ma-CI sHSP1, Ma-CI sHSP2 and Ma-CII sHSP3 respectively, were isolated and characterised from harvested banana fruit. Accumulation of Ma-CI sHSP1 mRNA transcripts in peel and pulp tissues and Ma-CII sHSP3 mRNA transcripts in peel tissue increased during heat pretreatment. Expression of all three Ma-sHSP genes in peel and pulp tissues was induced during subsequent chilled storage. Furthermore, Ma-CI sHSP1 and Ma-CII sHSP3 mRNA transcripts in pulp tissue and Ma-CI sHSP2 mRNA transcripts in peel and pulp tissues were obviously enhanced by heat pretreatment at days 6 and 9 of subsequent chilled storage. These results suggested that heat pretreatment enhanced the expression of Ma-sHSPs, which might be involved in heat pretreatment-induced chilling tolerance of banana fruit. Copyright © 2012 Society of Chemical Industry.

  16. Direct Cloning of Yeast Genes from an Ordered Set of Lambda Clones in Saccharomyces Cerevisiae by Recombination in Vivo

    PubMed Central

    Erickson, J. R.; Johnston, M.

    1993-01-01

    We describe a technique that facilitates the isolation of yeast genes that are difficult to clone. This technique utilizes a plasmid vector that rescues lambda clones as yeast centromere plasmids. The source of these lambda clones is a set of clones whose location in the yeast genome has been determined by L. Riles et al. in 1993. The Esherichia coli-yeast shuttle plasmid carries URA3, ARS4 and CEN6, and contains DNA fragments from the lambda vector that flank the cloned yeast insert. When yeast is cotransformed with linearized plasmid and lambda clone DNA, Ura(+) transformants are obtained by a recombination event between the lambda clone and the plasmid vector that generates an autonomously replicating plasmid containing the cloned yeast DNA sequences. Genes whose genetic map positions are known can easily be identified and recovered in this plasmid by testing only those lambda clones that map to the relevant region of the yeast genome for their ability to complement the mutant phenotype. This technique facilitates the isolation of yeast genes that resist cloning either because (1) they are underrepresented in yeast genomic libraries amplified in E. coli, (2) they provide phenotypes that are too marginal to allow selection of the gene by genetic complementation or (3) they provide phenotypes that are laborious to score. We demonstrate the utility of this technique by isolating three genes, GAL83, SSN2 and MAK7, each of which presents one of these problems for cloning. PMID:8514124

  17. Diversity of immunoglobulin lambda light chain gene usage over developmental stages in the horse.

    PubMed

    Tallmadge, Rebecca L; Tseng, Chia T; Felippe, M Julia B

    2014-10-01

    To further studies of neonatal immune responses to pathogens and vaccination, we investigated the dynamics of B lymphocyte development and immunoglobulin (Ig) gene diversity. Previously we demonstrated that equine fetal Ig VDJ sequences exhibit combinatorial and junctional diversity levels comparable to those of adult Ig VDJ sequences. Herein, RACE clones from fetal, neonatal, foal, and adult lymphoid tissue were assessed for Ig lambda light chain combinatorial, junctional, and sequence diversity. Remarkably, more lambda variable genes (IGLV) were used during fetal life than later stages and IGLV gene usage differed significantly with time, in contrast to the Ig heavy chain. Junctional diversity measured by CDR3L length was constant over time. Comparison of Ig lambda transcripts to germline revealed significant increases in nucleotide diversity over time, even during fetal life. These results suggest that the Ig lambda light chain provides an additional dimension of diversity to the equine Ig repertoire. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Adoptive Cellular Gene Therapy for the Treatment of Experimental Autoimmune Polychondritis Ear Disease.

    PubMed

    Zhou, Bin; Liao, Yonggan; Guo, Yunkai; Tarner, Ingo H; Liao, Chunfen; Chen, Sisi; Kermany, Mohammad Habiby; Tu, Hanjun; Zhong, Sen; Chen, Peijie

    2017-01-01

    In the past, the clinical therapy for autoimmune diseases, such as autoimmune polychondritis ear disease, was mostly limited to nonspecific immunosuppressive agents, which could lead to variable responses. Currently, gene therapy aims at achieving higher specificity and less adverse effects. This concept utilizes the adoptive transfer of autologous T cells that have been retrovirally transduced ex vivo to express and deliver immunoregulatory gene products to sites of autoimmune inflammation. In the animal model of collagen-induced autoimmune polychondritis ear disease (CIAPED), the adoptive transfer of IL-12p40-expressing collagen type II (CII)-specific CD4+ T-cell hybridomas resulted in a significantly lower disease incidence and severity compared with untreated or vector-only-treated animals. In vivo cell detection using bioluminescent labels showed that transferred CII-reactive T-cell hybridomas accumulated in the inflamed earlobes of the mice with CIAPED. In vitro analysis demonstrated that IL-12p40-transduced T cells did not affect antigen-specific T-cell activation or systemic anti-CII Ab responses. However, IL-12p40-transduced T cells suppressed IFN-γ and augmented IL-4 production, indicating their potential to act therapeutically by interrupting Th1-mediated inflammatory responses via augmenting Th2 responses. These results indicate that the local delivery of IL-12p40 by T cells could inhibit CIAPED by suppressing autoimmune responses at the site of inflammation. © 2017 S. Karger AG, Basel.

  19. Organization of genes for transcription and translation in the rif region of the Escherichia coli chromosome. [uv radiation

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Yamamoto, M.; Nomura, M.

    1979-01-01

    The lambda rif/sup d/18 transducing phage is known to carry several genes for components of transcriptional and translational machineries; these genes are clustered in the rif region at 88 min on the Escherichia coli genetic map. They include a set of genes for rRNA's (rrnB), a gene for spacer tRNA, tRNA/sub 2//sup Glu/(tgtB), one of the two genes for EF-TU (tufB), genes for four ribosomal proteins (rplK, A, J, and L), genes for the ..beta.. and ..beta..' subunits of RNA polymerase (rpoB and rpoC), and genes for three tRNA's (tyrU, gluT, and thrT). An additional tRNA gene (subsequently identified asmore » thrU by Landy and his co-workers) and a gene for a protein (protein U) with unknown functions were found to be carried by lambda rif/sup d/18. We analyzed the organization of these genes by using various deletion and hybrid phages derived from lambda rif/sup d/18 and lambda rif/sup d/12, a phage related to lambda rif/sup d/18. The expression of various genes was examined in uv-irradiated cells infected with these transducing phages. Two main conclusions were obtained. First, the four tRNA genes are not cotranscribed with the genes in rrnB, even though these tRNA genes are located close to the distal end of rrnB. Second, the four ribosomal protein genes are organized into two separate transcriptional units; rplK and A are in one unit and rplJ and L are in the second unit.« less

  20. Decreased severity of experimental autoimmune arthritis in peptidylarginine deiminase type 4 knockout mice.

    PubMed

    Suzuki, Akari; Kochi, Yuta; Shoda, Hirofumi; Seri, Yu; Fujio, Keishi; Sawada, Tetsuji; Yamada, Ryo; Yamamoto, Kazuhiko

    2016-05-05

    Peptidylarginine deiminase type 4 (PADI4) has been identified as a susceptibility gene for rheumatoid arthritis (RA) by genome-wide association studies. PADI4 is highly expressed in the bone marrow, macrophages, neutrophils, and monocytes. Peptidyl citrulline is an interesting molecule in RA because it is a target antigen for anti-citrullinated peptide antibodies, and only PADs (translated proteins from PADI genes) can provide peptidyl citrulline via the modification of protein substrates. The aim of this study was to evaluate the importance of the PADI4 gene in the progression of RA. We generated Padi4 knockout (Padi4(-/-)) DBA1J mice. The Padi4(-/-) DBA1J and wild-type mice were immunized with bovine type II collagen (CII) to develop collagen-induced arthritis (CIA). The expression of various inflammatory cytokines and Padi genes in immune cells was detected by the real-time TaqMan assay. Cytokine concentrations in sera were measured by enzyme-linked immunosorbent assays. Localization of the PAD4 and PAD2 proteins was indicated by immunohistochemistry. We demonstrated that the clinical disease score was significantly decreased in the Padi4(-/-) mice and Padi4 expression was induced by CII immunization. In the Padi4(-/-) mice, serum anti-type II collagen (CII) immunoglobulin M (IgM), IgG, and inflammatory cytokine levels were significantly decreased compared with those in the wild-type mice. Padi2 expression was induced in the immune cells of the Padi4(-/-) mice as a compensation for the defect in Padi4. Padi4 affected disease severity in the CIA mice and was involved in the enhancement of the collagen-initiated inflammatory responses.

  1. Multiple factors and processes involved in host cell killing by bacteriophage Mu: characterization and mapping.

    PubMed

    Waggoner, B T; Marrs, C F; Howe, M M; Pato, M L

    1984-07-15

    The regions of bacteriophage Mu involved in host cell killing were determined by infection of a lambda-immune host with 12 lambda pMu-transducing phages carrying different amounts of Mu DNA beginning at the left end. Infecting lambda pMu phages containing 5.0 (+/- 0.2) kb or less of the left end of Mu DNA did not kill the lambda-immune host, whereas lambda pMu containing 5.1 kb did kill, thus locating the right end of the kil gene between approximately 5.0 and 5.1 kb. For the Kil+ phages the extent of killing increased as the multiplicity of infection (m.o.i.) increased. In addition, killing was also affected by the presence of at least two other regions of Mu DNA: one, located between 5.1 and 5.8 kb, decreased the extent of killing; the other, located between 6.3 and 7.9 kb, greatly increased host cell killing. Killing was also assayed after lambda pMu infection of a lambda-immune host carrying a mini-Mu deleted for most of the B gene and the middle region of Mu DNA. Complementation of mini-Mu replication by infecting B+ lambda pMu phages resulted in killing of the lambda-immune, mini-Mu-containing host, regardless of the presence or absence of the Mu kil gene. The extent of host cell killing increased as the m.o.i. of the infecting lambda pMu increased, and was further enhanced by both the presence of the kil gene and the region located between 6.3 and 7.9 kb. These distinct processes of kil-mediated killing in the absence of replication and non-kil-mediated killing in the presence of replication were also observed after induction of replication-deficient and kil mutant prophages, respectively.

  2. The [CII] 158 μm line emission in high-redshift galaxies

    NASA Astrophysics Data System (ADS)

    Lagache, G.; Cousin, M.; Chatzikos, M.

    2018-02-01

    Gas is a crucial component of galaxies, providing the fuel to form stars, and it is impossible to understand the evolution of galaxies without knowing their gas properties. The [CII] fine structure transition at 158 μm is the dominant cooling line of cool interstellar gas, and is the brightest of emission lines from star forming galaxies from FIR through metre wavelengths, almost unaffected by attenuation. With the advent of ALMA and NOEMA, capable of detecting [CII]-line emission in high-redshift galaxies, there has been a growing interest in using the [CII] line as a probe of the physical conditions of the gas in galaxies, and as a star formation rate (SFR) indicator at z ≥ 4. In this paper, we have used a semi-analytical model of galaxy evolution (G.A.S.) combined with the photoionisation code CLOUDY to predict the [CII] luminosity of a large number of galaxies (25 000 at z ≃ 5) at 4 ≤ z ≤ 8. We assumed that the [CII]-line emission originates from photo-dominated regions. At such high redshift, the CMB represents a strong background and we discuss its effects on the luminosity of the [CII] line. We studied the L[CII ]-SFR and L[ CII ]-Zg relations and show that they do not strongly evolve with redshift from z = 4 and to z = 8. Galaxies with higher [CII] luminosities tend to have higher metallicities and higher SFRs but the correlations are very broad, with a scatter of about 0.5 and 0.8 dex for L[ CII ]-SFR and L[ CII ]-Zg, respectively. Our model reproduces the L[ CII ]-SFR relations observed in high-redshift star-forming galaxies, with [CII] luminosities lower than expected from local L[ CII ]-SFR relations. Accordingly, the local observed L[ CII ]-SFR relation does not apply at high-z (z ≳ 5), even when CMB effects are ignored. Our model naturally produces the [CII] deficit (i.e. the decrease of L[ CII ]/LIR with LIR), which appears to be strongly correlated with the intensity of the radiation field in our simulated galaxies. We then predict the [CII] luminosity function, and show that it has a power law form in the range of L[ CII] probed by the model (1 × 107-2 × 109 L⊙ at z = 6) with a slope α = -1. The slope is not evolving from z = 4 to z = 8 but the number density of [CII]-emitters decreases by a factor of 20×. We discuss our predictions in the context of current observational estimates on both the differential and cumulative luminosity functions. The FITS files of the data used in this paper (e.g., M⋆, SFR, ISRF, Zg, L[CII], LIR) are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/609/A130

  3. Hybrid-Lambda: simulation of multiple merger and Kingman gene genealogies in species networks and species trees.

    PubMed

    Zhu, Sha; Degnan, James H; Goldstien, Sharyn J; Eldon, Bjarki

    2015-09-15

    There has been increasing interest in coalescent models which admit multiple mergers of ancestral lineages; and to model hybridization and coalescence simultaneously. Hybrid-Lambda is a software package that simulates gene genealogies under multiple merger and Kingman's coalescent processes within species networks or species trees. Hybrid-Lambda allows different coalescent processes to be specified for different populations, and allows for time to be converted between generations and coalescent units, by specifying a population size for each population. In addition, Hybrid-Lambda can generate simulated datasets, assuming the infinitely many sites mutation model, and compute the F ST statistic. As an illustration, we apply Hybrid-Lambda to infer the time of subdivision of certain marine invertebrates under different coalescent processes. Hybrid-Lambda makes it possible to investigate biogeographic concordance among high fecundity species exhibiting skewed offspring distribution.

  4. Intensity Mapping of the [CII] Fine Structure Line during the Epoch of Reionization

    NASA Astrophysics Data System (ADS)

    Gong, Yan; Cooray, A.; Silva, M.; Santos, M. G.; Bock, J.; Bradford, M.; Zemcov, M.

    2012-01-01

    The atomic CII fine-structure line is one of the brightest lines in a typical star-forming galaxy spectrum with a luminosity 0.1% to 1% of the bolometric luminosity. It is otentially a reliable tracer of the dense gas distribution at high edshifts and could provide an additional probe to the era of reionization. By taking into account of the spontaneous, stimulated and collisional emission of the CII line, we calculate the spin temperature and the mean intensity as a function of the redshift. When averaged over a cosmologically large volume, we find that the CII emission from ionized carbon in individual galaxies is larger than the signal generated by carbon in the intergalactic medium (IGM). Assuming that the CII luminosity is proportional to the carbon mass in dark matter halos, we also compute the power spectrum of the CII line intensity at various redshifts. In order to avoid the contamination from CO rotational lines at low redshift when targeting a CII survey at high redshifts, we propose the cross-correlation of CII and 21-cm line emission from high redshifts. To explore the detectability of the CII signal from reionization, we also evaluate the expected errors on the CII power spectrum and CII-21 cm cross power spectrum based on the design of the future milimeter surveys. We note that the CII-21 cm cross power spectrum contains interesting features that captures physics during reionization, including the ionized bubble sizes and the mean ionization fraction, which are challenging to measure from 21-cm data alone. We propose an instrumental concept for the reionization CII experiment targeting the frequency range of 200 to 300 GHz with 1, 3 and 10 meter apertures and a bolometric spectrometer array with 64 independent spectral pixels with about 20,000 bolometers.

  5. Autoimmune severe hypertriglyceridemia induced by anti-apolipoprotein C-II antibody.

    PubMed

    Yamamoto, Hiroyasu; Tanaka, Minoru; Yoshiga, Satomi; Funahashi, Tohru; Shimomura, Iichiro; Kihara, Shinji

    2014-05-01

    Among type V hyperlipoproteinemias, only one-fourth of the patients have genetic defects in lipoprotein lipase (LPL) or in its associated molecules; the exact mechanism in other patients is usually unknown. The aim of the study was to report a case of severe hypertriglyceridemia induced by anti-apolipoprotein (apo) C-II autoantibody and to clarify its pathogenesis. A 29-year-old Japanese woman presented with severe persistent hypertriglyceridemia since the age of 20 years. The past history was negative for acute pancreatitis, eruptive xanthomas, or lipemia retinalis. LPL mass and activities were normal. Plasma apo C-II levels were extremely low, but no mutation was observed in APOC2. Apo C-II protein was detected in the serum by immunoprecipitation and Western blotting. Large amounts of IgG and IgM were incorporated with apo C-II protein coimmunoprecipitated by anti-apo C-II antibody. IgG, but not IgM, purified from the serum prevented interaction of apo C-II with lipid substrate and diminished LPL hydrolysis activity. We identified anti-apo C-II antibody in a myeloma-unrelated severe hypertriglyceridemic patient. In vitro analysis confirmed that the autoantibody disrupted the interaction between apo C-II and lipid substrate, suggesting the etiological role of anti-apo C-II antibody in severe hypertriglyceridemia in this patient.

  6. Incest indices from microsatellite genotypes of mother-child pairs.

    PubMed

    Wenk, Robert E

    2008-02-01

    Suspected incestuous paternity is encountered infrequently and investigation may be complicated by absence of the suspected father. Incest indices (IIs) can be calculated from microsatellite (STR) types of only a mother and child, but could be misleading. Therefore, the method was evaluated. Combined incest indices (CIIs) of 50 randomly mated (RM) mothers and their children were compared with those of 50 simulated incestuous (SI) mothers and their children. Each CII was calculated from 18 individual locus IIs. Combined indices were categorized as "diagnostic" (<0.010 and >100 for RM and SI cases, respectively), "indicative" (CII was directionally correct but not erroneously diagnostic), and "misleading" (>1.0 in RM and <0.01 in SI). The relative importance was determined of each of the three variables contributing to the CII. In 41 cases (41%), CIIs attained diagnostic values. Fifty-two CIIs were indicative. CIIs were misleading in 3 RM cases and 4 SI cases. The number of mother-child (M-C) STR genotype similarities was the most important determinant of CIIs. Infrequent alleles in M-C similarities were important in raising CIIs in SI. The kind of M-C genotype similarity was the least important variable. Study of 18 STR loci produces diagnostic CIIs in only two of five suspected incest cases. Study of approximately 33 independent STRs would assure that greater than 97.5 percent of cases will have diagnostic CIIs if incest occurred. Study of loci that are more informative than typical STRs would be advantageous.

  7. The Protein Interaction Network of Bacteriophage Lambda with Its Host, Escherichia coli

    PubMed Central

    Blasche, Sonja; Wuchty, Stefan; Rajagopala, Seesandra V.

    2013-01-01

    Although most of the 73 open reading frames (ORFs) in bacteriophage λ have been investigated intensively, the function of many genes in host-phage interactions remains poorly understood. Using yeast two-hybrid screens of all lambda ORFs for interactions with its host Escherichia coli, we determined a raw data set of 631 host-phage interactions resulting in a set of 62 high-confidence interactions after multiple rounds of retesting. These links suggest novel regulatory interactions between the E. coli transcriptional network and lambda proteins. Targeted host proteins and genes required for lambda infection are enriched among highly connected proteins, suggesting that bacteriophages resemble interaction patterns of human viruses. Lambda tail proteins interact with both bacterial fimbrial proteins and E. coli proteins homologous to other phage proteins. Lambda appears to dramatically differ from other phages, such as T7, because of its unusually large number of modified and processed proteins, which reduces the number of host-virus interactions detectable by yeast two-hybrid screens. PMID:24049175

  8. Endogenous estrogen status, but not genistein supplementation, modulates 7,12-dimethylbenz[a]anthracene-induced mutation in the liver cII gene of transgenic big blue rats.

    PubMed

    Chen, Tao; Hutts, Robert C; Mei, Nan; Liu, Xiaoli; Bishop, Michelle E; Shelton, Sharon; Manjanatha, Mugimane G; Aidoo, Anane

    2005-06-01

    A growing number of studies suggest that isoflavones found in soybeans have estrogenic activity and may safely alleviate the symptoms of menopause. One of these isoflavones, genistein, is commonly used by postmenopausal women as an alternative to hormone replacement therapy. Although sex hormones have been implicated as an important risk factor for the development of hepatocellular carcinoma, there are limited data on the potential effects of the estrogens, including phytoestrogens, on chemical mutagenesis in liver. Because of the association between mutation induction and the carcinogenesis process, we investigated whether endogenous estrogen and supplemental genistein affect 7,12-dimethylbenz[a]anthracene (DMBA)-induced mutagenesis in rat liver. Intact and ovariectomized female Big Blue rats were treated with 80 mg DMBA/kg body weight. Some of the rats also received a supplement of 1,000 ppm genistein. Sixteen weeks after the carcinogen treatment, the rats were sacrificed, their livers were removed, and mutant frequencies (MFs) and types of mutations were determined in the liver cII gene. DMBA significantly increased the MFs in liver for both the intact and ovariectomized rats. While there was no significant difference in MF between the ovariectomized and intact control animals, the mutation induction by DMBA in the ovariectomized groups was significantly higher than that in the intact groups. Dietary genistein did not alter these responses. Molecular analysis of the mutants showed that DMBA induced chemical-specific types of mutations in the liver cII gene. These results suggest that endogenous ovarian hormones have an inhibitory effect on liver mutagenesis by DMBA, whereas dietary genistein does not modulate spontaneous or DMBA-induced mutagenesis in either intact or ovariectomized rats.

  9. The Cerebellar Dysplasia of Chiari II Malformation as Revealed by Eye Movements

    PubMed Central

    Salman, Michael S.; Dennis, Maureen; Sharpe, James A.

    2011-01-01

    Introduction Chiari type II malformation (CII) is a developmental deformity of the hindbrain. We have previously reported that many patients with CII have impaired smooth pursuit, while few make inaccurate saccades or have an abnormal vestibulo-ocular reflex. In contrast, saccadic adaptation and visual fixation are normal. In this report, we correlate results from several eye movement studies with neuroimaging in CII. We present a model for structural changes within the cerebellum in CII. Methods Saccades, smooth pursuit, the vestibulo-ocular reflex, and visual fixation were recorded in 21 patients with CII, aged 8–19 years and 39 age-matched controls, using an infrared eye tracker. Qualitative and quantitative MRI data were correlated with eye movements in 19 CII patients and 28 controls. Results Nine patients with CII had abnormal eye movements. Smooth pursuit gain was subnormal in eight, saccadic accuracy abnormal in four, and vestibulo-ocular reflex gain abnormal in three. None had fixation instability. Patients with CII had a significantly smaller cerebellar volume than controls, and those with normal eye motion had an expanded midsagittal vermis compared to controls. However, patients with abnormal eye movements had a smaller (non-expanded) midsagittal vermis area, posterior fossa area and medial cerebellar volumes than CII patients with normal eye movements. Conclusions The deformity of CII affects the structure and function of the cerebellum selectively and differently in those with abnormal eye movements. We propose that the vermis can expand when compressed within a small posterior fossa in some CII patients, thus sparing its ocular motor functions. PMID:19960749

  10. Pyrethroid insecticide lambda-cyhalothrin induces hepatic cytochrome P450 enzymes, oxidative stress and apoptosis in rats.

    PubMed

    Martínez, María-Aránzazu; Ares, Irma; Rodríguez, José-Luis; Martínez, Marta; Roura-Martínez, David; Castellano, Victor; Lopez-Torres, Bernardo; Martínez-Larrañaga, María-Rosa; Anadón, Arturo

    2018-08-01

    This study aimed to examine in rats the effects of the Type II pyrethroid lambda-cyhalothrin on hepatic microsomal cytochrome P450 (CYP) isoform activities, oxidative stress markers, gene expression of proinflammatory, oxidative stress and apoptosis mediators, and CYP isoform gene expression and metabolism phase I enzyme PCR array analysis. Lambda-cyhalothrin, at oral doses of 1, 2, 4 and 8mg/kg bw for 6days, increased, in a dose-dependent manner, hepatic activities of ethoxyresorufin O-deethylase (CYP1A1), methoxyresorufin O-demethylase (CYP1A2), pentoxyresorufin O-depentylase (CYP2B1/2), testosterone 7α- (CYP2A1), 16β- (CYP2B1), and 6β-hydroxylase (CYP3A1/2), and lauric acid 11- and 12-hydroxylase (CYP4A1/2). Similarly, lambda-cyhalothrin (4 and 8mg/kg bw, for 6days), in a dose-dependent manner, increased significantly hepatic CYP1A1, 1A2, 2A1, 2B1, 2B2, 2E1, 3A1, 3A2 and 4A1 mRNA levels and IL-1β, NFκB, Nrf2, p53, caspase-3 and Bax gene expressions. PCR array analysis showed from 84 genes examined (P<0.05; fold change>1.5), changes in mRNA levels in 18 genes: 13 up-regulated and 5 down-regulated. A greater fold change reversion than 3-fold was observed on the up-regulated ALDH1A1, CYP2B2, CYP2C80 and CYP2D4 genes. Ingenuity Pathway Analysis (IPA) groups the expressed genes into biological mechanisms that are mainly related to drug metabolism. In the top canonical pathways, Oxidative ethanol degradation III together with Fatty Acid α-oxidation may be significant pathways for lambda-cyhalothrin. Our results may provide further understanding of molecular aspects involved in lambda-cyhalothrin-induced liver injury. Copyright © 2018. Published by Elsevier B.V.

  11. Effect of (3,5,6-trimethylpyrazin-2-yl)methyl 2-[4-(2-methylpropyl)phenyl]propanoate (ITE), a newly developed anti-inflammatory drug, on type II collagen-induced arthritis in mice.

    PubMed

    Ma, Tao; Cao, Ying-Lin; Xu, Bei-Bei; Zhou, Xiao-Mian

    2004-06-01

    The effect of (3,5,6-trimethylpyrazin-2-yl)methyl 2-[4-(2-methylpropyl)phenyl]propanoate (ITE) on type II collagen (CII)-induced arthritis in mice was studied. Mice were immunized twice with CII, ITE being given orally once a day for 40 d after the 1st immunization. Clinical assessment showed that ITE had no effect on the day of onset of arthritis but did lowered the incidence rate of arthritis and the arthritis score. And ITE had a marked suppressive effect on the mouse hind paw edema induced by CII. ITE suppressed the delayed-type mouse ear skin reaction to CII but had no effect on the level of serum anti-CII antibodies. These results suggest that ITE inhibits the development of CII-induced arthritis in mice by suppressing delayed-type hypersensitivity to CII.

  12. Pegylated interferons Lambda-1a and alfa-2a display different gene induction and cytokine and chemokine release profiles in whole blood, human hepatocytes and peripheral blood mononuclear cells.

    PubMed

    Freeman, J; Baglino, S; Friborg, J; Kraft, Z; Gray, T; Hill, M; McPhee, F; Hillson, J; Lopez-Talavera, J C; Wind-Rotolo, M

    2014-06-01

    Pegylated interferon-lambda-1a (Lambda), a type III interferon (IFN) in clinical development for the treatment of chronic HCV infection, has shown comparable efficacy and an improved safety profile to a regimen based on pegylated IFN alfa-2a (alfa). To establish a mechanistic context for this improved profile, we investigated the ex vivo effects of Lambda and alfa on cytokine and chemokine release, and on expression of IFN-stimulated genes (ISGs) in primary human hepatocytes and peripheral blood mononuclear cells (PBMCs) from healthy subjects. Our findings were further compared with changes observed in blood analysed from HCV-infected patients treated with Lambda or alfa in clinical studies. mRNA transcript and protein expression of the IFN-λ-limiting receptor subunit was lower compared with IFN-α receptor subunits in all cell types. Upon stimulation, alfa and Lambda induced ISG expression in hepatocytes and PBMCs, although in PBMCs Lambda-induced ISG expression was modest. Furthermore, alfa and Lambda induced release of cytokines and chemokines from hepatocytes and PBMCs, although differences in their kinetics of induction were observed. In HCV-infected patients, alfa treatment induced ISG expression in whole blood after single and repeat dosing. Lambda treatment induced modest ISG expression after single dosing and showed no induction after repeat dosing. Alfa and Lambda treatment increased IP-10, iTAC, IL-6, MCP-1 and MIP-1β levels in serum, with alfa inducing higher levels of all mediators compared with Lambda. Overall, ex vivo and in vivo induction profiles reported in this analysis strongly correlate with clinical observations of fewer related adverse events for Lambda vs those typically associated with alfa. © 2014 John Wiley & Sons Ltd.

  13. Kiloparsec-scale gaseous clumps and star formation at z = 5-7

    NASA Astrophysics Data System (ADS)

    Carniani, S.; Maiolino, R.; Amorin, R.; Pentericci, L.; Pallottini, A.; Ferrara, A.; Willott, C. J.; Smit, R.; Matthee, J.; Sobral, D.; Santini, P.; Castellano, M.; De Barros, S.; Fontana, A.; Grazian, A.; Guaita, L.

    2018-05-01

    We investigate the morphology of the [CII] emission in a sample of "normal" star-forming galaxies at 5 < z < 7.2 in relation to their UV (rest-frame) counterpart. We use new ALMA observations of galaxies at z ˜ 6 - 7, as well as a careful re-analysis of archival ALMA data. In total 29 galaxies were analysed, 21 of which are detected in [CII]. For several of the latter the [CII] emission breaks into multiple components. Only a fraction of these [CII] components, if any, is associated with the primary UV systems, while the bulk of the [CII] emission is associated either with fainter UV components, or not associated with any UV counterpart at the current limits. By taking into account the presence of all these components, we find that the L[CII]-SFR relation at early epochs is fully consistent with the local relation, but it has a dispersion of 0.48±0.07 dex, which is about two times larger than observed locally. We also find that the deviation from the local L[CII]-SFR relation has a weak anti-correlation with the EW(Lyα). The morphological analysis also reveals that [CII] emission is generally much more extended than the UV emission. As a consequence, these primordial galaxies are characterised by a [CII] surface brightness generally much lower than expected from the local Σ _{[CII]}-Σ _{SFR} relation. These properties are likely a consequence of a combination of different effects, namely: gas metallicity, [CII] emission from obscured star-forming regions, strong variations of the ionisation parameter, and circumgalactic gas in accretion or ejected by these primeval galaxies.

  14. The biocompatible polysaccharide chitosan enhances the oral tolerance to type II collagen

    PubMed Central

    Porporatto, C; Canali, M M; Bianco, I D; Correa, S G

    2009-01-01

    Chitosan is a mucoadhesive polysaccharide that promotes the transmucosal absorption of peptides and proteins. At mucosal sites chitosan exhibits immunomodulatory activities and stimulates the release of regulatory cytokines. Herein we evaluated the effect of the co-administration of chitosan in the tolerance to type II collagen (CII) using an experimental model of arthritis. Rats were fed diluent (acetic acid), 1 mg CII, 1 mg chitosan or 1 mg CII + 1 mg chitosan during 5 days before immunization with CII in Freund's complete adjuvant. Systemic effects were evaluated in draining lymph nodes after antigenic challenge or during the clinical evolution of arthritis. Specific antibodies, proliferation against CII and the production of interferon (IFN)-γ and interleukin-10 were assessed. Clinical signs were observed 13–15 days after primary immunization. The CII : chitosan group presented the lowest incidence and developed moderate arthritis, with reduced levels of immunoglobulin (Ig)G2a anti-CII, a limited proliferation in draining lymph nodes and a lower release of IFN-γ after restimulation with CII. Our results demonstrate that chitosan enhances the tolerance to an articular antigen with a decrease in the inflammatory responses and, as a consequence, an improvement in clinical signs. PMID:19076832

  15. [Allelic variants of apolipoproteins B and CII genes in patients with ischemic heart disease and in healthy persons from the Moscow population].

    PubMed

    Pogoda, T V; Nikonova, A L; Kolosova, T V; Liudvikova, E K; Perova, N V; Limborskaia, S A

    1995-07-01

    Allelic frequencies of a microsatellite of the apolipoprotein CII gene (APOCII) and a minisatellite of the apolipoprotein B gene (APOB) were studied using polymerase chain reaction (PCR). The study was conducted on a random sample of male Moscow inhabitants and a sample of patients with coronary heart disease (CHD) from the same population. Fourteen variants of the APOB minisatellite (the 82% heterozygosity level) and 13 alleles of the APOCII microsatellite (the 85% heterozygosity level) were found. CHD patients significantly differed from the control group in the distributions of alleles in these loci: APOB 32, APOB 46, APOB 48, and APOB 50 as well as APOCII 17 and APOCII 29 were found more frequently. A relationship was found between the distributions of APOB and APOCII in the CHD patients. The CHD patients with alleles APOCII 21 and APOCII 30 very often had the allele APOB 32; and patients with the genotype APOB 34, 36 had the allele APOCII 29 even more often than affected individuals in general. Individuals of the control group with the allele APOCII 30 exhibited hypertriglyceridemia without increased levels of total cholesterol and apolipoprotein B in plasma.

  16. Activation of catalase activity by a peroxisome-localized small heat shock protein Hsp17.6CII.

    PubMed

    Li, Guannan; Li, Jing; Hao, Rong; Guo, Yan

    2017-08-20

    Plant catalases are important antioxidant enzymes and are indispensable for plant to cope with adverse environmental stresses. However, little is known how catalase activity is regulated especially at an organelle level. In this study, we identified that small heat shock protein Hsp17.6CII (AT5G12020) interacts with and activates catalases in the peroxisome of Arabidopsis thaliana. Although Hsp17.6CII is classified into the cytosol-located small heat shock protein subfamily, we found that Hsp17.6CII is located in the peroxisome. Moreover, Hsp17.6CII contains a novel non-canonical peroxisome targeting signal 1 (PTS1), QKL, 16 amino acids upstream from the C-terminus. The QKL signal peptide can partially locate GFP to peroxisome, and mutations in the tripeptide lead to the abolishment of this activity. In vitro catalase activity assay and holdase activity assay showed that Hsp17.6CII increases CAT2 activity and prevents it from thermal aggregation. These results indicate that Hsp17.6CII is a peroxisome-localized catalase chaperone. Overexpression of Hsp17.6CII conferred enhanced catalase activity and tolerance to abiotic stresses in Arabidopsis. Interestingly, overexpression of Hsp17.6CII in catalase-deficient mutants, nca1-3 and cat2 cat3, failed to rescue their stress-sensitive phenotypes and catalase activity, suggesting that Hsp17.6CII-mediated stress response is dependent on NCA1 and catalase activity. Overall, we identified a novel peroxisome-located catalase chaperone that is involved in plant abiotic stress resistance by activating catalase activity. Copyright © 2017 Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, and Genetics Society of China. Published by Elsevier Ltd. All rights reserved.

  17. Search for C II Emission on Cosmological Scales at Redshift Z ˜ 2.6

    NASA Astrophysics Data System (ADS)

    Pullen, Anthony R.; Serra, Paolo; Chang, Tzu-Ching; Doré, Olivier; Ho, Shirley

    2018-05-01

    We present a search for Cii emission over cosmological scales at high-redshifts. The Cii line is a prime candidate to be a tracer of star formation over large-scale structure since it is one of the brightest emission lines from galaxies. Redshifted Cii emission appears in the submillimeter regime, meaning it could potentially be present in the higher frequency intensity data from the Planck satellite used to measure the cosmic infrared background (CIB). We search for Cii emission over redshifts z = 2 - 3.2 in the Planck 545 GHz intensity map by cross-correlating the 3 highest frequency Planck maps with spectroscopic quasars and CMASS galaxies from the Sloan Digital Sky Survey III (SDSS-III), which we then use to jointly fit for Cii intensity, CIB parameters, and thermal Sunyaev-Zeldovich (SZ) emission. We report a measurement of an anomalous emission I_ν =6.6^{+5.0}_{-4.8}× 10^4Jy/sr at 95% confidence, which could be explained by Cii emission, favoring collisional excitation models of Cii emission that tend to be more optimistic than models based on Cii luminosity scaling relations from local measurements; however, a comparison of Bayesian information criteria reveal that this model and the CIB & SZ only model are equally plausible. Thus, more sensitive measurements will be needed to confirm the existence of large-scale Cii emission at high redshifts. Finally, we forecast that intensity maps from Planck cross-correlated with quasars from the Dark Energy Spectroscopic Instrument (DESI) would increase our sensitivity to Cii emission by a factor of 5, while the proposed Primordial Inflation Explorer (PIXIE) could increase the sensitivity further.

  18. Characterizing the Multi-Phase Origin of the [CII] Emission in M101 and NGC 6946

    NASA Astrophysics Data System (ADS)

    Tarantino, Elizabeth; Bolatto, Alberto; Herrera-Camus, Rodrigo

    2018-01-01

    The bright far-infrared line [CII] is a dominant cooling channel of the neutral interstellar medium (ISM) and is a tracer of star formation. However, [CII] can be excited in different environments of the ISM, such as in dense photodissociation regions (PDRs), the cold/warm neutral medium (CNM/WNM), and the warm ionized medium (WIM). Separating the [CII] emission into its multiple components is vital for understanding star formation and for using [CII] as a star formation tracer. We present spectrally resolved SOFIA/GREAT data of the 158 μm [CII] emission, as well as ancillary HI and CO 2-1 data, to disentangle the multiple phases of the ISM. We use 18 pointings that sample the range of different environments present in these galaxies, including star formation activity, metallicity, radiation field strength, and gas content. We find that on average the [CII] is more associated with the dense CO gas coming from PDRs than the neutral medium, consistent with other results in the literature. Additionally, the [CII] observations allow us to access the “CO-faint” molecular gas in regions that have too low of a metallicty to produce CO. This adds to the small number of studies that have explored this “CO-faint” regime.

  19. Basic aminopeptidase activity is an emerging biomarker in collagen-induced rheumatoid arthritis.

    PubMed

    Mendes, Mariana Trivilin; Murari-do-Nascimento, Stephanie; Torrigo, Isis Rossetti; Alponti, Rafaela Fadoni; Yamasaki, Simone Cristina; Silveira, Paulo Flavio

    2011-04-11

    The objective of this study was to investigate the catalytic activity of basic aminopeptidase (APB) and its association with periarticular edema and circulating tumor necrosis factor (TNF)-alpha and type II collagen (CII) antibodies (AACII) in a rat model of rheumatoid arthritis (RA) induced by CII (CIA). Edema does not occur in part of CII-treated, even when AACII is higher than in control. TNF-alpha is detectable only in edematous CII-treated. APB in synovial membrane is predominantly a membrane-bound activity also present in soluble form and with higher activity in edematous than in non-edematous CII-treated or control. Synovial fluid and blood plasma have lower APB in non-edematous than in edematous CII-treated or control. In peripheral blood mononuclear cells (PBMCs) the highest levels of APB are found in soluble form in control and in membrane-bound form in non-edematous CII-treated. CII treatment distinguishes two categories of rats: one with arthritic edema, high AACII, detectable TNF-alpha, high soluble and membrane-bound APB in synovial membrane and low APB in the soluble fraction of PBMCs, and another without edema and with high AACII, undetectable TNF-alpha, low APB in the synovial fluid and blood plasma and high APB in the membrane-bound fraction of PBMCs. Data suggest that APB and CIA are strongly related. 2011 Elsevier B.V. All rights reserved.

  20. OT1_tvelusam_2: HIFI studies of the small-scale structures in the Galactic diffuse clouds with [CII] and [CI

    NASA Astrophysics Data System (ADS)

    Velusamy, T.

    2010-07-01

    The 1.9 THz [CII] observations provide a powerful probe of warm diffuse clouds, because they can observe them in emission and are useful as a tracer of their molecular H2 not directly traced by CO or other means. HIFI observations of [CII] provide a high resolution of 12 arcsec, better than that for single dish CO (> 30 arcsec) maps, and much better than HI (>30 arcsec). Thus with HIFI we have an opportunity probe the small scale structures in diffuse clouds in the inner Galaxy at distances > 3 kpc. To study the structure of diffuse ISM gas at small scales we propose HIFI maps of 1.9 THz (158 micron) [CII] line emission in a selection of 16 lines of sight (LOSs) towards the inner Galaxy, which are also being observed as part of the GOT C+ survey of [CII] in the Galactic plane. GOT C+ provides mainly single point spectra without any spatial data. Maps of [CII] will constrain better the cloud properties and models when combining [CII] and HI data. The proposed OTF X map will be along the longitude and latitude centered on 18 selected GOT C+ LOS over a length of 3 arcmin in each direction, which is adequate enough to provide sufficient spatial information on the small scale structures at larger distances (>3 kpc) and to characterize the CII filling factor in the larger beams of the ancillary (HI, CO, and CI data). The [CI] 609 & 370micron and the 12CO(7-6) (which lies within the CI band) are excellent diagnostics of the physical conditions of transition clouds and PDRs. We will use the ratio of the [CI] lines to constrain the kinetic temperature and volume density of the CII/CI/CO transition zones in molecular clouds using radiative transfer codes. We also propose OTF X maps in both the [CI] lines for all CII target LOSs. We anticipate fully resolved structural data in [CII] on at least 300 velocity resolved clouds along with their [CI] emissions. We request a total of 33.2 hrs of HIFI observing time.

  1. Observations of O VI Emission from the Diffuse Interstellar Medium

    NASA Technical Reports Server (NTRS)

    Shelton, R. L.; Kruk, J. W.; Murphy, E. M.; Andersson, B. G.; Blair, W. P.; Dixon, W. V.; Edelstein, J.; Fullerton, A. W.; Gry, C.; Howk, J. C.; hide

    2001-01-01

    We report the first Far Ultraviolet Spectroscopic Explorer (FUSE) measurements of diffuse O(VI) (lambda lambda 1032,1038) emission from the general diffuse interstellar medium outside of supernova remnants or superbubbles. We observed a 30 arcsec x 30 arcsec region of the sky centered at l = 315.0 deg and b = -41.3 deg. From the observed intensities (2930 +/- 290 (random) +/- 410 (systematic) and 1790 +/- 260 (random) +/- 250 (systematic) photons/sq cm/s/sr in the 1032 and 1038 angstrom emission lines, respectively), derived equations, and assumptions about the source location, we calculate the intrinsic intensity, electron density, thermal pressure, and emitting depth. The intensities are too large for the emission to originate solely in the Local Bubble. Thus, we conclude that the Galactic thick disk and lower halo also contribute. High velocity clouds are ruled out because there are none near the pointing direction. The calculated emitting depth is small, indicating that the O(VI)-bearing gas fills a small volume. The observations can also be used to estimate the cooling rate of the hot interstellar medium and constrain models. The data also yield the first intensity measurement of the C(II) 3s 2S(1/2) to 2p 2P(3/2) emission line at 1037 angstrom and place upper limits on the intensities of ultraviolet line emission from C(I), C(III), Si(II), S(III), S(IV), S(VI), and Fe(III).

  2. Quadriceps exercise intolerance in patients with chronic obstructive pulmonary disease: the potential role of altered skeletal muscle mitochondrial respiration.

    PubMed

    Gifford, Jayson R; Trinity, Joel D; Layec, Gwenael; Garten, Ryan S; Park, Song-Young; Rossman, Matthew J; Larsen, Steen; Dela, Flemming; Richardson, Russell S

    2015-10-15

    This study sought to determine if qualitative alterations in skeletal muscle mitochondrial respiration, associated with decreased mitochondrial efficiency, contribute to exercise intolerance in patients with chronic obstructive pulmonary disease (COPD). Using permeabilized muscle fibers from the vastus lateralis of 13 patients with COPD and 12 healthy controls, complex I (CI) and complex II (CII)-driven State 3 mitochondrial respiration were measured separately (State 3:CI and State 3:CII) and in combination (State 3:CI+CII). State 2 respiration was also measured. Exercise tolerance was assessed by knee extensor exercise (KE) time to fatigue. Per milligram of muscle, State 3:CI+CII and State 3:CI were reduced in COPD (P < 0.05), while State 3:CII and State 2 were not different between groups. To determine if this altered pattern of respiration represented qualitative changes in mitochondrial function, respiration states were examined as percentages of peak respiration (State 3:CI+CII), which revealed altered contributions from State 3:CI (Con 83.7 ± 3.4, COPD 72.1 ± 2.4%Peak, P < 0.05) and State 3:CII (Con 64.9 ± 3.2, COPD 79.5 ± 3.0%Peak, P < 0.05) respiration, but not State 2 respiration in COPD. Importantly, a diminished contribution of CI-driven respiration relative to the metabolically less-efficient CII-driven respiration (CI/CII) was also observed in COPD (Con 1.28 ± 0.09, COPD 0.81 ± 0.05, P < 0.05), which was related to exercise tolerance of the patients (r = 0.64, P < 0.05). Overall, this study indicates that COPD is associated with qualitative alterations in skeletal muscle mitochondria that affect the contribution of CI and CII-driven respiration, which potentially contributes to the exercise intolerance associated with this disease.

  3. Seasonal forecasts of impact-relevant climate information indices developed as part of the EUPORIAS project

    NASA Astrophysics Data System (ADS)

    Spirig, Christoph; Bhend, Jonas

    2015-04-01

    Climate information indices (CIIs) represent a way to communicate climate conditions to specific sectors and the public. As such, CIIs provide actionable information to stakeholders in an efficient way. Due to their non-linear nature, such CIIs can behave differently than the underlying variables, such as temperature. At the same time, CIIs do not involve impact models with different sources of uncertainties. As part of the EU project EUPORIAS (EUropean Provision Of Regional Impact Assessment on a Seasonal-to-decadal timescale) we have developed examples of seasonal forecasts of CIIs. We present forecasts and analyses of the skill of seasonal forecasts for CIIs that are relevant to a variety of economic sectors and a range of stakeholders: heating and cooling degree days as proxies for energy demand, various precipitation and drought-related measures relevant to agriculture and hydrology, a wild fire index, a climate-driven mortality index and wind-related indices tailored to renewable energy producers. Common to all examples is the finding of limited forecast skill over Europe, highlighting the challenge for providing added-value services to stakeholders operating in Europe. The reasons for the lack of forecast skill vary: often we find little skill in the underlying variable(s) precisely in those areas that are relevant for the CII, in other cases the nature of the CII is particularly demanding for predictions, as seen in the case of counting measures such as frost days or cool nights. On the other hand, several results suggest there may be some predictability in sub-regions for certain indices. Several of the exemplary analyses show potential for skillful forecasts and prospect for improvements by investing in post-processing. Furthermore, those cases for which CII forecasts showed similar skill values as those of the underlying meteorological variables, forecasts of CIIs provide added value from a user perspective.

  4. In vivo gene delivery and expression by bacteriophage lambda vectors.

    PubMed

    Lankes, H A; Zanghi, C N; Santos, K; Capella, C; Duke, C M P; Dewhurst, S

    2007-05-01

    Bacteriophage vectors have potential as gene transfer and vaccine delivery vectors because of their low cost, safety and physical stability. However, little is known concerning phage-mediated gene transfer in mammalian hosts. We therefore performed experiments to examine phage-mediated gene transfer in vivo. Mice were inoculated with recombinant lambda phage containing a mammalian expression cassette encoding firefly luciferase (luc). Efficient, dose-dependent in vivo luc expression was detected, which peaked within 24 h of delivery and declined to undetectable levels within a week. Display of an integrin-binding peptide increased cellular internalization of phage in vitro and enhanced phage-mediated gene transfer in vivo. Finally, in vivo depletion of phagocytic cells using clodronate liposomes had only a minor effect on the efficiency of phage-mediated gene transfer. Unmodified lambda phage particles are capable of transducing mammalian cells in vivo, and may be taken up -- at least in part -- by nonphagocytic mechanisms. Surface modifications that enhance phage uptake result in more efficient in vivo gene transfer. These experiments shed light on the mechanisms involved in phage-mediated gene transfer in vivo, and suggest new approaches that may enhance the efficiency of this process.

  5. Limited mutagenicity of electronic cigarettes in mouse or human cells in vitro.

    PubMed

    Tommasi, Stella; Bates, Steven E; Behar, Rachel Z; Talbot, Prue; Besaratinia, Ahmad

    2017-10-01

    Electronic cigarettes (e-cig), which are promoted as safe alternatives to tobacco cigarettes or as aides to smoking cessation, are becoming increasingly popular among adult chronic smokers and adolescents experimenting with tobacco products. Despite the known presence of toxicants and carcinogens in e-cig liquid and vapor, the possible carcinogenic effects of e-cig use in humans are unknown. We have utilized two validated in vitro model systems to investigate whether e-cig vapor induces mutation in mouse or human cells. We have exposed transgenic mouse fibroblasts in vitro to e-cig vapor extracts prepared from three popular brands, and determined the induction of mutagenesis in a reporter gene, the cII transgene. Furthermore, we have treated the pSP189 plasmid with e-cig vapor extract, transfected human fibroblast cells with the e-cig-treated plasmid, and screened for the induced mutations in the supF gene. We observed no statistically significant increases in relative mutant frequency in the cII transgene or supF gene in the e-cig treated mouse or human cells, respectively. Our data indicate that e-cig vapor extracts from the selected brands and at concentrations tested in this study have limited mutagenicity in both mouse and human cells in vitro. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. The Amazing COS FUV (1320 - 1460 A) Spectrum of (lambda) Vel (K4Ib-II)

    NASA Technical Reports Server (NTRS)

    Carpenter, Kenneth

    2010-01-01

    The FUV spectrum (1320-1460 A) of the K4 lb-11 supergiant (lambda) Vel was observed with the Cosmic Origins Spectrograph (COS) on HST, as part of the Ayres and Redfield Cycle 17 SNAP program "SNAPing Coronal Iron". This spectrum covers a region not previously recorded in (lambda) Vel at high resolution and, in a mere 20 minutes of exposure, reveals a treasure trove of information. It shows a wide variety of strong emission lines, superposed on a bright continuum, with contributions from both atomic and molecular species. Multiple absorptions, including numerous Ni II and Fe II lines, are visible over this continuum, which is likely generated in the chromosphere of the star. Evidence of the stellar wind is seen in the P Cygni profiles of the CII lines near 1335 A and the results of fluorescence processes are visible throughout the region. The spectrum has remarkable similarities to that of (alpha) Boo (K1.5 III), but significant differences as well, including substantial FUV continuum emission, reminiscent of the M2 Iab supergiant (alpha) Ori, but minus the CO fundamental absorption bands seen in the spectrum of the latter star. However, fluoresced CO emission is present, as in the K-giant stars (alpha) Boo and (alpha) Tau (K5 III). The presence of hot plasma in the atmosphere of the star, indicated by previous GHRS observations of Si III] and C III] lines near 1900 A and FUSE observations of O VI 1032 A, is further confirmed by the detection in this COS spectrum of the Si IV UV 1 lines near 1400 A, though both lines are contaminated by overlying fluorescent H2 emission. We present the details of this spectrum, in comparison with stars of similar temperature or luminosity and discuss the implications for the structure of, and the radiative processes active in, the outer atmospheres of these stars.

  7. Hydroxyl Radical Modification of Collagen Type II Increases Its Arthritogenicity and Immunogenicity

    PubMed Central

    Shahab, Uzma; Ahmad, Saheem; Moinuddin; Dixit, Kiran; Habib, Safia; Alam, Khursheed; Ali, Asif

    2012-01-01

    Background The oxidation of proteins by endogenously generated free radicals causes structural modifications in the molecules that lead to generation of neo-antigenic epitopes that have implications in various autoimmune disorders, including rheumatoid arthritis (RA). Collagen induced arthritis (CIA) in rodents (rats and mice) is an accepted experimental model for RA. Methodology/Principal Findings Hydroxyl radicals were generated by the Fenton reaction. Collagen type II (CII) was modified by •OH radical (CII-OH) and analysed by ultraviolet-visible (UV-VIS), fluorescence and circular dichroism (CD) spectroscopy. The immunogenicity of native and modified CII was checked in female Lewis rats and specificity of the induced antibodies was ascertained by enzyme linked immunosorbent assay (ELISA). The extent of CIA was evaluated by visual inspection. We also estimated the oxidative and inflammatory markers in the sera of immunized rats. A slight change in the triple helical structure of CII as well as fragmentation was observed after hydroxyl radical modification. The modified CII was found to be highly arthritogenic and immunogenic as compared to the native form. The CII-OH immunized rats exhibited increased oxidative stress and inflammation as compared to the CII immunized rats in the control group. Conclusions/Significance Neo-antigenic epitopes were generated on •OH modified CII which rendered it highly immunogenic and arthritogenic as compared to the unmodified form. Since the rodent CIA model shares many features with human RA, these results illuminate the role of free radicals in human RA. PMID:22319617

  8. Suppression of collagen induced arthritis by idiotype coupled lymphoid cells

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Nagler-Anderson, C.; Gurish, M.F.; Robinson, M.E.

    1986-03-01

    Studies were initiated to evaluate the regulatory influence of idiotype (Id) networks in an experimental auto-immune disease. Collagen induced arthritis is an animal model of polyarthritis induced in susceptible mice by immunization with collagen II (CII). A humoral immune response to CII appears to be critical for the development of diseases. If subpopulations of the anti-CII abs, important for the induction of arthritis, could be identified and manipulated through the presence of a major Id, it should be possible to decrease arthritis incidence by suppressing the production of these Ids. Specifically purified anti-CII abs from arthritic DBA/1 mice were coupledmore » to syngeneic spleen cells and administered IV prior to intradermal immunization with CII. By day 34 after 1/sup 0/ immunization, 100% of control mice and 50% of treated mice had developed arthritis. Suppression of the Id population administered to the treated group was confirmed by RIA. Sera from individual mice were tested as inhibitors of binding of /sup 125/I-labelled polyclonal DBA/1 anti-CII to a rabbit anti-Id directed against polyclonal anti-CII isolated from the sera of arthritic mice. Mean percentage of inhibition of binding of /sup 125/I-Id to rabbit anti-Id by sera from non-arthritic treated mice was found to be significantly lower than that observed in the arthritic control group (p = .045), but did not correlate with total anti-CII ab titers.« less

  9. Apolipoprotein gene polymorphisms and plasma levels in healthy Tunisians and patients with coronary artery disease

    PubMed Central

    Bahri, Raoudha; Esteban, Esther; Moral, Pedro; Hassine, Mohsen; Hamda, Khaldoun Ben; Chaabani, Hassen

    2008-01-01

    Aim To analyze apolipoprotein gene polymorphisms in the Tunisian population and to check the relation of these polymorphisms and homocysteine, lipid and apolipoprotein levels to the coronary artery disease (CAD). Methods In healthy blood donors and in patients with CAD complicated by myocardial infarction (MI) four apolipoprotein gene polymorphisms [APO (a) PNR, APO E, APO CI and APO CII] were determined and plasma levels of total homocysteine, total cholesterol (TC), triglycerides (TG), HDL-cholesterol (HLD-C) and apolipoproteins (apo A-I, Apo B, Apo E) were measured. Results Analysis of the four apolipoprotein gene polymorphisms shows a relative genetic homogeneity between Tunisian population and those on the other side of Mediterranean basin. Compared to controls, CAD patients have significantly higher main concentrations of TC, TG, LDL-C, apo B and homocysteine, and significantly lower ones of HDL-C, apo A-I and apo E. The four apolipoprotein gene polymorphisms have not showed any significant differences between patients and controls. However, the APO E4 allele appears to be associated to the severity of CAD and to high levels of atherogenic parameters and low level of apo E, which has very likely an anti-atherogenic role. Conclusion Although APO (a) PNR, APO CI and APO CII genes are analyzed in only few populations, they show a frequency distribution, which is not at variance with that of APO E gene and other widely studied genetic markers. In the Tunisian population the APO E 4 appears to be only indirectly involved in the severity of CAD. In the routine practice, in addition of classic parameters, it will be useful to measure the concentration of apo E and that of Homocysteine and if possible to determine the APO E gene polymorphism. PMID:19014618

  10. Construction of heat-inducible expression vector of Corynebacterium glutamicum and C. ammoniagenes: fusion of lambda operator with promoters isolated from C. ammoniagenes.

    PubMed

    Park, Jong-Uk; Jo, Jae-Hyung; Kim, Young-Ji; Chung, So-Sun; Lee, Jin-Ho; Lee, Hyune Hwan

    2008-04-01

    The heat-inducible expression vectors for Corynebacterium glutamicum and C. ammoniagenes were constructed by using the lambdaOL1 and the cryptic promoters, CJ1 and CJ4 that express genes constitutively in C. ammoniagenes.. Although the promoters were isolated from C. ammoniagenes, CJ1 and CJ4 were also active in C. glutamicum. To construct vectors, the OL1 from the lambdaPL promoter was isolated and fused to the CJ1 and CJ4 promoters by recombinant PCR. The resulting artificial promoters, CJ1O and CJ4O, which have one lambdaOL1, and CJ1OX2, which has two successive lambdaOL1, were fused to the green fluorescent protein (GFP) gene followed by subcloning into pCES208. The expression of GFP in the corynebacteria harboring the vectors was regulated successfully by the temperature sensitive cI857 repressor. Among them, C. ammoniagenes harboring plasmid pCJ1OX2G containing GFP fused to CJ1OX2 showed more GFP than the other ones and the expression was tightly regulated by the repressor. To construct the generally applicable expression vector using the plasmid pCJ1OX2G, the His-tag, enterokinase (EK) moiety, and the MCS were inserted in front of the GFP gene. Using the vector, the expression of pyrR from C. glutamicum was tried by temperature shift-up. The results indicated that the constructed vectors (pCeHEMG) can be successfully used in the expression and regulation of foreign genes in corynebacteria.

  11. Dynamics Determine Signaling in a Multicomponent System Associated with Rheumatoid Arthritis.

    PubMed

    Lindgren, Cecilia; Tyagi, Mohit; Viljanen, Johan; Toms, Johannes; Ge, Changrong; Zhang, Naru; Holmdahl, Rikard; Kihlberg, Jan; Linusson, Anna

    2018-05-24

    Strategies that target multiple components are usually required for treatment of diseases originating from complex biological systems. The multicomponent system consisting of the DR4 major histocompatibility complex type II molecule, the glycopeptide CII259-273 from type II collagen, and a T-cell receptor is associated with development of rheumatoid arthritis (RA). We introduced non-native amino acids and amide bond isosteres into CII259-273 and investigated the effect on binding to DR4 and the subsequent T-cell response. Molecular dynamics simulations revealed that complexes between DR4 and derivatives of CII259-273 were highly dynamic. Signaling in the overall multicomponent system was found to depend on formation of an appropriate number of dynamic intramolecular hydrogen bonds between DR4 and CII259-273, together with the positioning of the galactose moiety of CII259-273 in the DR4 binding groove. Interestingly, the system tolerated modifications at several positions in CII259-273, indicating opportunities to use analogues to increase our understanding of how rheumatoid arthritis develops and for evaluation as vaccines to treat RA.

  12. Bacteriophage lambda: early pioneer and still relevant

    PubMed Central

    Casjens, Sherwood R.; Hendrix, Roger W.

    2015-01-01

    Molecular genetic research on bacteriophage lambda carried out during its golden age from the mid 1950's to mid 1980's was critically important in the attainment of our current understanding of the sophisticated and complex mechanisms by which the expression of genes is controlled, of DNA virus assembly and of the molecular nature of lysogeny. The development of molecular cloning techniques, ironically instigated largely by phage lambda researchers, allowed many phage workers to switch their efforts to other biological systems. Nonetheless, since that time the ongoing study of lambda and its relatives have continued to give important new insights. In this review we give some relevant early history and describe recent developments in understanding the molecular biology of lambda's life cycle. PMID:25742714

  13. A gene cassette for adapting Escherichia coli strains as hosts for att-Int-mediated rearrangement and pL expression vectors.

    PubMed

    Balakrishnan, R; Bolten, B; Backman, K C

    1994-01-28

    A cassette of genes from bacteriophage lambda, when carried on a derivative of bacteriophage Mu, renders strains of Escherichia coli (and in principle other Mu-sensitive bacteria) capable of supporting lambda-based expression vectors, such as rearrangement vectors and pL vectors. The gene cassette contains a temperature-sensitive allele of the repressor gene, cIts857, and a shortened leftward operon comprising, oLpL, N, xis and int. Transfection and lysogenization of this cassette into various host bacteria is mediated by phage Mu functions. Examples of regulated expression of the gene encoding T4 DNA ligase are presented.

  14. An Empirically Calibrated Model of Cell Fate Decision Following Viral Infection

    NASA Astrophysics Data System (ADS)

    Coleman, Seth; Igoshin, Oleg; Golding, Ido

    The life cycle of the virus (phage) lambda is an established paradigm for the way genetic networks drive cell fate decisions. But despite decades of interrogation, we are still unable to theoretically predict whether the infection of a given cell will result in cell death or viral dormancy. The poor predictive power of current models reflects the absence of quantitative experimental data describing the regulatory interactions between different lambda genes. To address this gap, we are constructing a theoretical model that captures the known interactions in the lambda network. Model assumptions and parameters are calibrated using new single-cell data from our lab, describing the activity of lambda genes at single-molecule resolution. We began with a mean-field model, aimed at exploring the population averaged gene-expression trajectories under different initial conditions. Next, we will develop a stochastic formulation, to capture the differences between individual cells within the population. The eventual goal is to identify how the post-infection decision is driven by the interplay between network topology, initial conditions, and stochastic effects. The insights gained here will inform our understanding of cell fate choices in more complex cellular systems.

  15. Gene expression analysis and enzyme assay reveal a potential role of the carboxylesterase gene CpCE-1 from Cydia pomonella in detoxification of insecticides.

    PubMed

    Yang, Xue-Qing

    2016-05-01

    Carboxylesterases (CarEs) are responsible for metabolism of xenobiotics including insecticides in insects. Understanding the expression patterns of a such detoxifying gene and effect of insecticides on its enzyme activity are important to clarify the function of this gene relevant to insecticides-detoxifying process, but little information is available in the codling moth Cydia pomonella (L.). In this study, we investigated the expression profiles of CarE gene CpCE-1 at different developmental stages and in different tissues of C. pomonella, as well as the larvae exposed to chlorpyrifos-ethyl and lambda-cyhalothrin by using absolute real-time quantitative PCR (absolute RT-qPCR). Results indicated that CpCE-1 expression was significantly altered during C. pomonella development stages, and this expression differed between sexes, with a higher transcript in females than males. Meanwhile, CpCE-1 is overexpressed in cuticle, midgut and head than silk gland, fat body and Malpighian tubules. Exposure of third instar larvae to a non-lethal dosage of chlorpyrifos-ethyl and lambda-cyhalothrin resulted in induction of CpCE-1 transcript. The total carboxylesterase enzyme activity was inhibited by chlorpyrifos-ethyl in vivo; in contrast, the activity of Escherichia coli produced recombinant CpCE-1 was significantly inhibited by both lambda-cyhalothrin and chlorpyrifos-ethyl in vitro. These results suggested that CpCE-1 in C. pomonella is potentially involved in the development and in detoxification of chlorpyrifos-ethyl and lambda-cyhalothrin.

  16. GOT C+: Galactic Plane Survey of the 1.9 THz [CII] Line

    NASA Astrophysics Data System (ADS)

    Langer, William

    2012-01-01

    The ionized carbon [CII] 1.9 THz fine structure line is a major gas coolant in the interstellar medium (ISM) and controls the thermal conditions in diffuse gas clouds and Photodissociation Regions (PDRs). The [CII] line is also an important tracer of the atomic gas and atomic to molecular transition in diffuse clouds throughout the Galaxy. I will review some of the results from the recently completed Galactic Observations of Terahertz C+ (GOT C+) survey. This Herschel Open Time Key Project is a sparse, but uniform volume sample survey of [CII] line emission throughout the Galactic disk using the HIFI heterodyne receiver. HIFI observations, with their high spectral resolution, isolate and locate individual clouds in the Galaxy and provide excitation information on the gas. I will present [CII] position-velocity maps that reveal the distribution and motion of the clouds in the inner Galaxy and discuss results on the physical properties of the gas using spectral observations of [CII] and ancillary HI and 12CO, 13CO, and C18O J=1-0 data. The [CII] emission is also a useful tracer of the "Dark H2 Gas", and I will discuss its distribution in a sample of interstellar clouds. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration.

  17. Interaction between the phage HK022 Nun protein and the nut RNA of phage lambda.

    PubMed

    Chattopadhyay, S; Hung, S C; Stuart, A C; Palmer, A G; Garcia-Mena, J; Das, A; Gottesman, M E

    1995-12-19

    The nun gene product of prophage HK022 excludes phage lambda infection by blocking the expression of genes downstream from the lambda nut sequence. The Nun protein functions both by competing with lambda N transcription-antitermination protein and by actively inducing transcription termination on the lambda chromosome. We demonstrate that Nun binds directly to a stem-loop structure within nut RNA, boxB, which is also the target for the N antiterminator. The two proteins show comparable affinities for boxB and they compete with each other. Their interactions with boxB are similar, as shown by RNase protection experiments, NMR spectroscopy, and analysis of boxB mutants. Each protein binds the 5' strand of the boxB stem and the adjacent loop. The stem does not melt upon the binding of Nun or N, as the 3' strand remains sensitive to a double-strand-specific RNase. The binding of RNA partially protects Nun from proteolysis and changes its NMR spectra. Evidently, although Nun and N bind to the same surface of boxB RNA, their respective complexes interact differently with RNA polymerase, inducing transcription termination or antitermination, respectively.

  18. Cross-Specificities between cII-like Proteins and pRE-like Promoters of Lambdoid Bacteriophages

    PubMed Central

    Wulff, Daniel L.; Mahoney, Michael E.

    1987-01-01

    We have investigated the activation of transcription from the pRE promoters of phages λ, 21 and P22 by the λ and 21 cII proteins and the P22 c1 (cII-like) protein, using an in vivo system in which cII protein from a derepressed prophage activates transcription from a pRE DNA fragment on a multicopy plasmid. We find that each protein is highly specific for its own cognate pRE promoter, although measureable cross-reactions are observed. The primary recognition sequence for cII protein on λ pRE is a pair of TTGC repeat sequences in the sequence 5'-TTGCN 6TTGC-3' at the -35 region of the promoter. This same sequence is found in 21 pRE, while P22 pRE has the sequence 5'-TTGCN6TTGT-3', which is the same as that of λctr1, a pRE+ variant of λ. λctr1 pRE is half as active as λ + pRE when assayed with either the λ cII or the P22 c1 proteins. Therefore, the single base change in the P22 repeat sequence cannot explain why the P22 c1 protein is much more active with P22 pRE than λ p RE. The dya5 mutation, a G→A change at position -43 of pRE, makes pRE a stronger promoter when assayed with either the λ or 21 cII proteins or the P22 c1 protein. We conclude that efficient activation of a cII-dependent promoter by a cII protein requires sequence information in addition to the TTGC repeat sequences. We do not know the characteristics of the proteins which are responsible for the specificity of each protein for its own cognate promoter. However, λdya8, which has a Glu27→Lys alteration in the λ cII protein and a cII+ phenotype, results in a mutant cII protein that is much more highly specific than wild-type cII protein for its own cognate λ p RE promoter. This is especially remarkable because the dya8 amino acid alteration makes the helix-2 region (the region of the protein predicted to make contact with the phosphodiester backbone of the DNA) of λ cII protein conform exactly with the helix-2 region of the P22 c1 protein in both charge and charge distribution. PMID:2953649

  19. Homologous recombination between overlapping thymidine kinase gene fragments stably inserted into a mouse cell genome.

    PubMed

    Lin, F L; Sternberg, N

    1984-05-01

    We have constructed a substrate to study homologous recombination between adjacent segments of chromosomal DNA. This substrate, designated lambda tk2 , consists of one completely defective and one partially defective herpes simplex virus thymidine kinase (tk) gene cloned in bacteriophage lambda DNA. The two genes have homologous 984-base-pair sequences and are separated by 3 kilobases of largely vector DNA. When lambda tk2 DNA was transferred into mouse LMtk- cells by the calcium phosphate method, rare TK+ transformants were obtained that contained many (greater than 40) copies of the unrecombined DNA. Tk- revertants, which had lost most of the copies of unrecombined DNA, were isolated from these TK+-transformed lines. Two of these Tk- lines were further studied by analysis of their reversion back to the Tk+ phenotype. They generated ca. 200 Tk+ revertants per 10(8) cells after growth in nonselecting medium for 5 days. All of these Tk+ revertants have an intact tk gene reconstructed by homologous recombination; they also retain various amounts of unrecombined lambda tk2 DNA. Southern blot analysis suggested that at least some of the recombination events involve unequal sister chromatid exchanges. We also tested three agents, mitomycin C, 12-O-tetradecanoyl-phorbol-13-acetate, and mezerein, that are thought to stimulate recombination to determine whether they affect the reversion from Tk- to Tk+. Only mitomycin C increased the number of Tk+ revertants.

  20. Clinically isolated enterovirus A71 subgenogroup C4 strain with lethal pathogenicity in 14-day-old mice and the application as an EV-A71 mouse infection model.

    PubMed

    Xu, Yi; Ma, Shuzhi; Zhu, Limeng; Huang, Zhiqiu; Chen, Liyun; Xu, Yuhua; Yin, Haibin; Peng, Tao; Wang, Yi

    2017-01-01

    The Enterovirus A71 (EV-A71) subgenogroup C4 is prevalent in China. EV-A71 causes hand, foot and mouth disease (HFMD) in children and may lead to severe neurological diseases. The development of antiviral and protective vaccines against EV-A71 is significantly hindered by the lack of suitable animal models to recapitulate human neurological symptoms. In this study, GZ-CII, a highly virulent EV-A71 subgenogroup C4 strain, was isolated from hospitalized children with HFMD. Intraperitoneal infections of GZ-CII resulted in progressive neurological disease in mice as old as 14 days. Administration of an inactivated EV-A71 vaccine or an anti-EV-A71 immune serum protected the mice against the GZ-CII infection. This demonstrated that a mouse model with EV-A71 GZ-CII could be used to evaluate potential vaccine candidates and therapeutics for subgenogroup C4. Comparing the genome sequence of GZ-CII with that of the avirulent EV-A71 subgenogroup C4 strain revealed unique mutations in GZ-CII. When mutation VP2-K149I was introduced into the nonpathogenic EV-A71 subgenogroup C4 strain, the variant similar to GZ-CII significantly increased viral replication and virulence in mice. These results indicated that the VP2-K149I mutation played an important role in enhancing the virulence of the EV-A71 subgenogroup C4 strain in mice, and that mice infected with the GZ-CII strain are a promising model for evaluating vaccines and therapeutics against the EV-A71 subgenogroup C4. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. [CII] observations of H2 molecular layers in transition clouds

    NASA Astrophysics Data System (ADS)

    Velusamy, T.; Langer, W. D.; Pineda, J. L.; Goldsmith, P. F.; Li, D.; Yorke, H. W.

    2010-10-01

    We present the first results on the diffuse transition clouds observed in [CII] line emission at 158 μm (1.9 THz) towards Galactic longitudes near 340° (5 LOSs) & 20° (11 LOSs) as part of the HIFI tests and GOT C+ survey. Out of the total 146 [CII] velocity components detected by profile fitting we identify 53 as diffuse molecular clouds with associated 12CO emission but without 13CO emission and characterized by AV < 5 mag. We estimate the fraction of the [CII] emission in the diffuse HI layer in each cloud and then determine the [CII] emitted from the molecular layers in the cloud. We show that the excess [CII] intensities detected in a few clouds is indicative of a thick H2 layer around the CO core. The wide range of clouds in our sample with thin to thick H2 layers suggests that these are at various evolutionary states characterized by the formation of H2 and CO layers from HI and C+, respectively. In about 30% of the clouds the H2 column densities (“dark gas”) traced by the [CII] is 50% or more than that traced by 12CO emission. On the average ~25% of the total H2 in these clouds is in an H2 layer which is not traced by CO. We use the HI, [CII], and 12CO intensities in each cloud along with simple chemical models to obtain constraints on the FUV fields and cosmic ray ionization rates. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  2. Incorporation of a lambda phage recombination system and EGFP detection to simplify mutagenesis of Herpes simplex virus bacterial artificial chromosomes

    PubMed Central

    Schmeisser, Falko; Weir, Jerry P

    2007-01-01

    Background Targeted mutagenesis of the herpesvirus genomes has been facilitated by the use of bacterial artificial chromosome (BAC) technology. Such modified genomes have potential uses in understanding viral pathogenesis, gene identification and characterization, and the development of new viral vectors and vaccines. We have previously described the construction of a herpes simplex virus 2 (HSV-2) BAC and the use of an allele replacement strategy to construct HSV-2 recombinants. While the BAC mutagenesis procedure is a powerful method to generate HSV-2 recombinants, particularly in the absence of selective marker in eukaryotic culture, the mutagenesis procedure is still difficult and cumbersome. Results Here we describe the incorporation of a phage lambda recombination system into an allele replacement vector. This strategy enables any DNA fragment containing the phage attL recombination sites to be efficiently inserted into the attR sites of the allele replacement vector using phage lambda clonase. We also describe how the incorporation of EGFP into the allele replacement vector can facilitate the selection of the desired cross-over recombinant BACs when the allele replacement reaction is a viral gene deletion. Finally, we incorporate the lambda phage recombination sites directly into an HSV-2 BAC vector for direct recombination of gene cassettes using the phage lambda clonase-driven recombination reaction. Conclusion Together, these improvements to the techniques of HSV BAC mutagenesis will facilitate the construction of recombinant herpes simplex viruses and viral vectors. PMID:17501993

  3. GOT C+ Survey of [CII] 158 Micrometer Emission: Atomic to Molecular Cloud Transitions in the Inner Galaxy

    NASA Technical Reports Server (NTRS)

    Velusamy, T.; Langer, W. D.; Willacy, K.; Pineda, J. L.; Goldsmith, P. F.

    2012-01-01

    We present the results of the distribution of CO-dark H2 gas in a sample of 2200 interstellar clouds in the inner Galaxy (l = 90 deg to +57 deg) detected in the velocity resolved [CII] spectra observed in the GOT C+ survey using the Herschel HIFI. We analyze the [CII] intensities along with the ancillary HI, (12)CO and (13)CO data for each cloud to determine their evolutionary state and to derive the H2 column densities in the C(+) and C(+)/CO transition layers in the cloud. We discuss the overall Galactic distribution of the [CII] clouds and their properties as a function Galactic radius. GOT C+ results on the global distribution of [CII] clouds and CO-dark H2 gas traces the FUV and star formation rates in the Galactic disk.

  4. GOT C+ Survey of [CII] 158 μm Emission: Atomic to Molecular Cloud Transitions in the Inner Galaxy

    NASA Astrophysics Data System (ADS)

    Velusamy, T.; Langer, W. D.; Willacy, K.; Pineda, J. L.; Goldsmith, P. F.

    2013-03-01

    We present the results of the distribution of CO-dark H2 gas in a sample of 2223 interstellar clouds in the inner Galaxy (l=-90° to +57°) detected in the velocity resolved [CII] spectra observed in the GOT C+ survey using the Herschel HIFI. We analyze the [CII] intensities along with the ancillary HI, 12CO and 13CO data for each cloud to determine their evolutionary state and to derive the H2 column densities in the C+ and C+/CO transition layers in the cloud. We discuss the overall Galactic distribution of the [CII] clouds and their properties as a function Galactic radius. GOT C+ results on the global distribution of [CII] clouds and CO-dark H2 gas traces the FUV intensity and star formation rate in the Galactic disk.

  5. Short-Term Exposure to Lambda-Cyhalothrin Negatively Affects the Survival and Memory-Related Characteristics of Worker Bees Apis mellifera.

    PubMed

    Liao, Chun-Hua; He, Xu-Jiang; Wang, Zi-Long; Barron, Andrew B; Zhang, Bo; Zeng, Zhi-Jiang; Wu, Xiao-Bo

    2018-07-01

    Pesticides are considered one of the major contemporary stressors of honey bee health. In this study, the effects of short-term exposure to lambda-cyhalothrin on lifespan, learning, and memory-related characteristics of Apis mellifera were systematically examined. Short-term exposure to lambda-cyhalothrin in worker bees reduced lifespan, affected learning and memory performance, reduced the homing ability, and influenced the expression levels of two learning and memory-related genes of A. mellifera. This research identifies the nature of the sublethal effects of lambda-cyhalothrin on bees and the level of exposure that can be harmful to bee health. This new information will assist in establishing guidelines for the safe use of lambda-cyhalothrin in the field.

  6. Spatially Resolved Analysis of the Interstellar Medium in the Cosmic Eye, a Lensed Lyman Break Galaxy at z=3.074

    NASA Astrophysics Data System (ADS)

    Ball, Catherine; Riechers, Dominik A.; Pavesi, Riccardo

    2018-01-01

    The [CII]/[NII] ratio combines the [CII] line, a tracer of photodissociation and HII regions emerging from the neutral and ionized phases of the interstellar medium (ISM), with [NII] emission, which only originates from the ionized ISM. In this, the [CII]/[NII] ratio can be used to separate the fractions of [CII] emission emerging from the different phases of the ISM. We present Atacama Large sub-Millimeter Array (ALMA) observations of the Cosmic Eye, a gravitationally lensed Lyman Break Galaxy (LBG). As an LBG, the Cosmic Eye represents a "normal" star forming galaxy in the z>2 universe. LBGs were host to the bulk of star formation during the peak epoch of star formation. Diagnosing star formation in these galaxies provides insight into the evolution of “normal” galaxies in a cosmic sense. The high magnification (30x) allows us to resolve the [CII] 158μm and the [NII] 205μm lines in detail, allowing for a position-resolved analysis of their ratio. We find variations of the line ratio across the galaxy, suggesting the galaxy’s internal structure affects this ratio. We consider the Cosmic Eye in the context of both higher redshift LBGs and local luminous and ultraluminous infrared galaxies, finding that the Cosmic Eye’s line ratio is similar to those of both higher- and lower- redshift galaxies. The Cosmic Eye’s global [CII]/[NII] ratio sits between two previous measurements of z>5 LBGs at low resolution, suggesting that the ratio may correlate more significantly with LFIR than with redshift in this epoch. Furthermore, the Cosmic Eye’s [CII]/[NII] ratio is similar to those of the nearby LIRG/ULIRGs, though we expect local [CII]/[NII] values to be lower due to their different metallicities and dust content. High-resolution studies like this one probe the evolution of [CII]/[NII] over cosmic time by examining the evolution of the ISM’s structure. With a better understanding of the [CII]/[NII] line ratio, we can more effectively use it as a probe of the nature of star formation in high-redshift galaxies. CJB participated in the summer 2017 REU program in the Center for Astrophysics and Planetary Science at Cornell University under NSF award AST-1659264.

  7. [Cii] emission from L1630 in the Orion B molecular cloud.

    PubMed

    Pabst, C H M; Goicoechea, J R; Teyssier, D; Berné, O; Ochsendorf, B B; Wolfire, M G; Higgins, R D; Riquelme, D; Risacher, C; Pety, J; Le Petit, F; Roueff, E; Bron, E; Tielens, A G G M

    2017-10-01

    L1630 in the Orion B molecular cloud, which includes the iconic Horsehead Nebula, illuminated by the star system σ Ori, is an example of a photodissociation region (PDR). In PDRs, stellar radiation impinges on the surface of dense material, often a molecular cloud, thereby inducing a complex network of chemical reactions and physical processes. Observations toward L1630 allow us to study the interplay between stellar radiation and a molecular cloud under relatively benign conditions, that is, intermediate densities and an intermediate UV radiation field. Contrary to the well-studied Orion Molecular Cloud 1 (OMC1), which hosts much harsher conditions, L1630 has little star formation. Our goal is to relate the [Cii] fine-structure line emission to the physical conditions predominant in L1630 and compare it to studies of OMC1. The [Cii] 158 μ m line emission of L1630 around the Horsehead Nebula, an area of 12' × 17', was observed using the upgraded German Receiver for Astronomy at Terahertz Frequencies (upGREAT) onboard the Stratospheric Observatory for Infrared Astronomy (SOFIA). Of the [Cii] emission from the mapped area 95%, 13 L ⊙ , originates from the molecular cloud; the adjacent Hii region contributes only 5%, that is, 1 L ⊙ . From comparison with other data (CO(1-0)-line emission, far-infrared (FIR) continuum studies, emission from polycyclic aromatic hydrocarbons (PAHs)), we infer a gas density of the molecular cloud of n H ∼ 3 · 10 3 cm -3 , with surface layers, including the Horsehead Nebula, having a density of up to n H ∼ 4 · 10 4 cm -3 . The temperature of the surface gas is T ∼ 100 K. The average [Cii] cooling efficiency within the molecular cloud is 1.3 · 10 -2 . The fraction of the mass of the molecular cloud within the studied area that is traced by [Cii] is only 8%. Our PDR models are able to reproduce the FIR-[Cii] correlations and also the CO(1-0)-[Cii] correlations. Finally, we compare our results on the heating efficiency of the gas with theoretical studies of photoelectric heating by PAHs, clusters of PAHs, and very small grains, and find the heating efficiency to be lower than theoretically predicted, a continuation of the trend set by other observations. In L1630 only a small fraction of the gas mass is traced by [Cii]. Most of the [Cii] emission in the mapped area stems from PDR surfaces. The layered edge-on structure of the molecular cloud and limitations in spatial resolution put constraints on our ability to relate different tracers to each other and to the physical conditions. From our study, we conclude that the relation between [Cii] emission and physical conditions is likely to be more complicated than often assumed. The theoretical heating efficiency is higher than the one we calculate from the observed [Cii] emission in the L1630 molecular cloud.

  8. [Cii] emission from L1630 in the Orion B molecular cloud

    PubMed Central

    Pabst, C. H. M.; Goicoechea, J. R.; Teyssier, D.; Berné, O.; Ochsendorf, B. B.; Wolfire, M. G.; Higgins, R. D.; Riquelme, D.; Risacher, C.; Pety, J.; Le Petit, F.; Roueff, E.; Bron, E.; Tielens, A. G. G. M.

    2017-01-01

    Context L1630 in the Orion B molecular cloud, which includes the iconic Horsehead Nebula, illuminated by the star system σ Ori, is an example of a photodissociation region (PDR). In PDRs, stellar radiation impinges on the surface of dense material, often a molecular cloud, thereby inducing a complex network of chemical reactions and physical processes. Aims Observations toward L1630 allow us to study the interplay between stellar radiation and a molecular cloud under relatively benign conditions, that is, intermediate densities and an intermediate UV radiation field. Contrary to the well-studied Orion Molecular Cloud 1 (OMC1), which hosts much harsher conditions, L1630 has little star formation. Our goal is to relate the [Cii] fine-structure line emission to the physical conditions predominant in L1630 and compare it to studies of OMC1. Methods The [Cii] 158 μm line emission of L1630 around the Horsehead Nebula, an area of 12′ × 17′, was observed using the upgraded German Receiver for Astronomy at Terahertz Frequencies (upGREAT) onboard the Stratospheric Observatory for Infrared Astronomy (SOFIA). Results Of the [Cii] emission from the mapped area 95%, 13 L⊙, originates from the molecular cloud; the adjacent Hii region contributes only 5%, that is, 1 L⊙. From comparison with other data (CO(1-0)-line emission, far-infrared (FIR) continuum studies, emission from polycyclic aromatic hydrocarbons (PAHs)), we infer a gas density of the molecular cloud of nH ∼ 3 · 103 cm−3, with surface layers, including the Horsehead Nebula, having a density of up to nH ∼ 4 · 104 cm−3. The temperature of the surface gas is T ∼ 100 K. The average [Cii] cooling efficiency within the molecular cloud is 1.3 · 10−2. The fraction of the mass of the molecular cloud within the studied area that is traced by [Cii] is only 8%. Our PDR models are able to reproduce the FIR-[Cii] correlations and also the CO(1-0)-[Cii] correlations. Finally, we compare our results on the heating efficiency of the gas with theoretical studies of photoelectric heating by PAHs, clusters of PAHs, and very small grains, and find the heating efficiency to be lower than theoretically predicted, a continuation of the trend set by other observations. Conclusions In L1630 only a small fraction of the gas mass is traced by [Cii]. Most of the [Cii] emission in the mapped area stems from PDR surfaces. The layered edge-on structure of the molecular cloud and limitations in spatial resolution put constraints on our ability to relate different tracers to each other and to the physical conditions. From our study, we conclude that the relation between [Cii] emission and physical conditions is likely to be more complicated than often assumed. The theoretical heating efficiency is higher than the one we calculate from the observed [Cii] emission in the L1630 molecular cloud. PMID:28989177

  9. Rapid construction of capsid-modified adenoviral vectors through bacteriophage lambda Red recombination.

    PubMed

    Campos, Samuel K; Barry, Michael A

    2004-11-01

    There are extensive efforts to develop cell-targeting adenoviral vectors for gene therapy wherein endogenous cell-binding ligands are ablated and exogenous ligands are introduced by genetic means. Although current approaches can genetically manipulate the capsid genes of adenoviral vectors, these approaches can be time-consuming and require multiple steps to produce a modified viral genome. We present here the use of the bacteriophage lambda Red recombination system as a valuable tool for the easy and rapid construction of capsid-modified adenoviral genomes.

  10. Gene doctoring: a method for recombineering in laboratory and pathogenic Escherichia coli strains.

    PubMed

    Lee, David J; Bingle, Lewis E H; Heurlier, Karin; Pallen, Mark J; Penn, Charles W; Busby, Stephen J W; Hobman, Jon L

    2009-12-09

    Homologous recombination mediated by the lambda-Red genes is a common method for making chromosomal modifications in Escherichia coli. Several protocols have been developed that differ in the mechanisms by which DNA, carrying regions homologous to the chromosome, are delivered into the cell. A common technique is to electroporate linear DNA fragments into cells. Alternatively, DNA fragments are generated in vivo by digestion of a donor plasmid with a nuclease that does not cleave the host genome. In both cases the lambda-Red gene products recombine homologous regions carried on the linear DNA fragments with the chromosome. We have successfully used both techniques to generate chromosomal mutations in E. coli K-12 strains. However, we have had limited success with these lambda-Red based recombination techniques in pathogenic E. coli strains, which has led us to develop an enhanced protocol for recombineering in such strains. Our goal was to develop a high-throughput recombineering system, primarily for the coupling of genes to epitope tags, which could also be used for deletion of genes in both pathogenic and K-12 E. coli strains. To that end we have designed a series of donor plasmids for use with the lambda-Red recombination system, which when cleaved in vivo by the I-SceI meganuclease generate a discrete linear DNA fragment, allowing for C-terminal tagging of chromosomal genes with a 6xHis, 3xFLAG, 4xProteinA or GFP tag or for the deletion of chromosomal regions. We have enhanced existing protocols and technologies by inclusion of a cassette conferring kanamycin resistance and, crucially, by including the sacB gene on the donor plasmid, so that all but true recombinants are counter-selected on kanamycin and sucrose containing media, thus eliminating the need for extensive screening. This method has the added advantage of limiting the exposure of cells to the potential damaging effects of the lambda-Red system, which can lead to unwanted secondary alterations to the chromosome. We have developed a counter-selective recombineering technique for epitope tagging or for deleting genes in E. coli. We have demonstrated the versatility of the technique by modifying the chromosome of the enterohaemorrhagic O157:H7 (EHEC), uropathogenic CFT073 (UPEC), enteroaggregative O42 (EAEC) and enterotoxigenic H10407 (ETEC) E. coli strains as well as in K-12 laboratory strains.

  11. Site-specificity of abnormal excision: the mechanism of formation of a specialized transducing bacteriophage lambda plac5.

    PubMed Central

    Shpakovski, G V; Berlin, Y A

    1984-01-01

    Molecular mechanism of the specialized transducing bacteriophage lambda plac5 formation has been studied. Phage-bacterial DNA junctions in lambda plac5 DNA are localized and primary structure of regions of the abnormal excisional recombination leading to the phage formation is elucidated; the crossover region proved to be comparable with the central part of attP and attB sites (the core and the adjacent tetranucleotide) in length and degree of homology. Bacterial insert in lambda plac5 DNA is shown to end immediately after Z-Y spacer, the DNA not containing lacY gene segments. The data obtained led to the conclusion of site-specific (homologous) character of abnormal excision upon formation of lambda transducing bacteriophages. Possible mechanisms of the excision are discussed. Images PMID:6091038

  12. Selected issues of the universal communication environment implementation for CII standard

    NASA Astrophysics Data System (ADS)

    Zagoździńska, Agnieszka; Poźniak, Krzysztof T.; Drabik, Paweł K.

    2011-10-01

    In the contemporary FPGA market there is the wide assortment of structures, integrated development environments, and boards of different producers. The variety allows to fit resources to requirements of the individual designer. There is the need of standardization of the projects to make it useful in research laboratories equipped with different producers tools. Proposed solution is CII standardization of VHDL components. This paper contains specification of the universal communication environment for CII standard. The link can be used in different FPGA structures. Implementation of the link enables object oriented VHDL programming with the use of CII standardization. The whole environment contains FPGA environment and PC software. The paper contains description of the selected issues of FPGA environment. There is description of some specific solutions that enables environment usage in structures of different producers. The flexibility of different size data transmissions with the use of CII is presented. The specified tool gives the opportunity to use FPGA structures variety fully and design faster and more effectively.

  13. Homologous recombination between overlapping thymidine kinase gene fragments stably inserted into a mouse cell genome.

    PubMed Central

    Lin, F L; Sternberg, N

    1984-01-01

    We have constructed a substrate to study homologous recombination between adjacent segments of chromosomal DNA. This substrate, designated lambda tk2 , consists of one completely defective and one partially defective herpes simplex virus thymidine kinase (tk) gene cloned in bacteriophage lambda DNA. The two genes have homologous 984-base-pair sequences and are separated by 3 kilobases of largely vector DNA. When lambda tk2 DNA was transferred into mouse LMtk- cells by the calcium phosphate method, rare TK+ transformants were obtained that contained many (greater than 40) copies of the unrecombined DNA. Tk- revertants, which had lost most of the copies of unrecombined DNA, were isolated from these TK+-transformed lines. Two of these Tk- lines were further studied by analysis of their reversion back to the Tk+ phenotype. They generated ca. 200 Tk+ revertants per 10(8) cells after growth in nonselecting medium for 5 days. All of these Tk+ revertants have an intact tk gene reconstructed by homologous recombination; they also retain various amounts of unrecombined lambda tk2 DNA. Southern blot analysis suggested that at least some of the recombination events involve unequal sister chromatid exchanges. We also tested three agents, mitomycin C, 12-O-tetradecanoyl-phorbol-13-acetate, and mezerein, that are thought to stimulate recombination to determine whether they affect the reversion from Tk- to Tk+. Only mitomycin C increased the number of Tk+ revertants. Images PMID:6328272

  14. OT2_pgolds01_6: Herschel [NII] Observations to Define the Source of [CII] Emission

    NASA Astrophysics Data System (ADS)

    Goldsmith, P.

    2011-09-01

    The 158 micron line of ionized carbon is the strongest single long-wavelength emission feature from the interstellar medium and is the most important coolant of gas in which hydrogen is in atomic form. It is a key determinant of the evolution of these largely atomic regions into denser, cooler molecular clouds in which new stars are formed, and is widely used as a tracer of star formation in the Milky Way and other galaxies. There is, however, an ongoing, serious controversy about the origin of the [CII] emission, which has been asserted to come from the extended low-density warm interstellar medium, but has more generally been associated with the primarily molecular photon dominated regions (PDRs) intimately associated with massive, young stars. We propose a combined HIFI and PACS study of the two far-infrared [NII] fine structure lines in order to resolve the important question of the fraction of CII emission that arises in ionized gas. Specifically, we will (1) utilize the fact that due to its ionization potential NII is found only in HII regions, and with PACS 122 and 205 micron observations, determine electron densities in a sample of such regions in the Galactic plane; (2) utilize available data on radio free-free and H-alpha emission to determine the NII column densities and from this the CII column densities in the HII regions; (3) use the electron densities to determine the fraction of CII emission arising in the ionized interstellar medium. These observations will be carried out at 150 of the positions in the Galactic plane observed in [CII] by the GOT-C+ project. We will also carry out HIFI observations of 10 selected positions in the 205 micron line to determine spectral characteristics of the NII emission line, which with CII, CI, and CO profiles already in hand will serve as a further discriminant among the proposed sources of CII emission.

  15. Anti-type II collagen antibodies, anti-CCP, IgA RF and IgM RF are associated with joint damage, assessed eight years after onset of juvenile idiopathic arthritis (JIA)

    PubMed Central

    2014-01-01

    Background Early appearance of antibodies specific for native human type II collagen (anti-CII) characterizes an early inflammatory and destructive phenotype in adults with rheumatoid arthritis (RA). The objective of this study was to investigate the occurrence of anti-CII, IgM RF, IgA RF and anti-CCP in serum samples obtained early after diagnosis, and to relate the occurrence of autoantibodies to outcome after eight years of disease in children with juvenile idiopathic arthritis (JIA). Methods The Nordic JIA database prospectively included JIA patients followed for eight years with data on remission and joint damage. From this database, serum samples collected from 192 patients, at a median of four months after disease onset, were analysed for IgG anti-CII, IgM RF, IgA RF and IgG anti-CCP. Joint damage was assessed based on Juvenile Arthritis Damage Index for Articular damage (JADI-A), a validated clinical instrument for joint damage. Results Elevated serum levels of anti-CII occurred in 3.1%, IgM RF in 3.6%, IgA RF in 3.1% and anti-CCP in 2.6% of the patients. Occurrence of RF and anti-CCP did to some extent overlap, but rarely with anti-CII. The polyarticular and oligoarticular extended categories were overrepresented in patients with two or more autoantibodies. Anti-CII occurred in younger children, usually without overlap with the other autoantibodies and was associated with high levels of C-reactive protein (CRP) early in the disease course. All four autoantibodies were significantly associated with joint damage, but not with active disease at the eight-year follow up. Conclusions Anti-CII, anti-CCP, IgA RF and IgM RF detected early in the disease course predicted joint damage when assessed after eight years of disease. The role of anti-CII in JIA should be further studied. PMID:24944545

  16. In silico characterization and expression analysis of the multigene family encoding the Bowman-Birk protease inhibitor in soybean.

    PubMed

    de Almeida Barros, Beatriz; da Silva, Wiliane Garcia; Moreira, Maurilio Alves; de Barros, Everaldo Gonçalves

    2012-01-01

    The Bowman-Birk (BBI) protease inhibitors can be used as source of sulfur amino acids, can regulate endogenous protease activity during seed germination and during the defense response of plants to pathogens. In soybean this family has not been fully described. The goal of this work was to characterize in silico and analyze the expression of the members of this family in soybean. We identified 11 potential BBI genes in the soybean genome. In each one of them at least a characteristic BBI conserved domain was detected in addition to a potential signal peptide. The sequences have been positioned in the soybean physical map and the promoter regions were analyzed with respect to known regulatory elements. Elements related to seed-specific expression and also to response to biotic and abiotic stresses have been identified. Based on the in silico analysis and also on quantitative RT-PCR data it was concluded that BBI-A, BBI-CII and BBI-DII are expressed specifically in the seed. The expression profiles of these three genes are similar along seed development. Their expressions reach a maximum in the intermediate stages and decrease as the seed matures. The BBI-DII transcripts are the most abundant ones followed by those of BBI-A and BBI-CII.

  17. H2-M polymorphism in mice susceptible to collagen-induced arthritis involves the peptide binding groove

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Walter, W.; Loos, M.; Maeurer, M.J.

    1996-12-31

    The ability to develop type II collagen (CII)-induced arthritis (CIA) in mice is associated with the major histocompatibility I-A gene and with as yet poorly defined regulatory molecules of the major histocompatibility complex (MHC) class II antigen processing and presentation pathway. H2-M molecules are thought to be involved in the loading of antigenic peptides into the MHC class II binding cleft. We sequenced H2-Ma, H2-Mb1, and H2-Mb2 genes from CIA-susceptible and -resistant mouse strains and identified four different Ma and Mb2 alleles, and three different Mb1 alleles defined by polymorphic residues within the predicted peptide binding groove. Most CIA-resistant mousemore » strains share common Ma, Mb1, and Mb2 alleles. In contrast, H2-M alleles designated Ma-III, Ma-IV, Mb1-III, and Mb2-IV could be exclusively identified in the CIA-susceptible H2{sup r} and H2{sup q} haplotypes, suggesting that allelic H2-M molecules may modulate the composition of different CII peptides loaded onto MHC class II molecules, presumably presenting {open_quotes}arthritogenic{close_quotes} epitopes to T lymphocytes. 42 refs., 4 figs., 3 tabs.« less

  18. Chromosomal locations of mouse immunoglobulin genes.

    PubMed Central

    Valbuena, O; Marcu, K B; Croce, C M; Huebner, K; Weigert, M; Perry, R P

    1978-01-01

    The chromosomal locations of the structural genes coding for the constant portions of mouse heavy (H) and light chain immunoglobulins were studied by molecular hybridization techniques. Complementary DNA probes containing the constant-region sequences of kappa and lambdaI light chain and alpha, gamma2b, and mu heavy chain mRNAs were annealed to a large excess of DNA from a series of eight mouse-human hybrid cell lines that are deficient for various mouse chromosomes. The lines were scored as positive when a high proportion of a probe annealed and negative when an insignificant proportion annealed. Some lines were clearly negative for H and lambda and clearly positive for kappa. Others were positive or intermediate for lambda, positive for kappa and negative for H. Still others, including a line that was selected for the absence of the mouse X chromosome, were positive for all immunoglobulin species. These results demonstrate that the Clambda, Ckappa, and CH genes are located on different autosomes in the mouse. In contrast, the three heavy-chain families exhibited consistently uniform hybridization results, suggesting that the genes for Calpha, Cgamma, and Cmu are located on the same chromosome. A comparison of karyotypic data with hybridization data has limited the possible locations of the Ig genes to only a few chromosomes. PMID:96442

  19. The chromospheric structure of the cool giant star g Herculis

    NASA Technical Reports Server (NTRS)

    Luttermoser, Donald G.; Johnson, Hollis R.; Eaton, Joel

    1994-01-01

    Non-Local Thermodynamic Equilibrium (LTE) calculations of semiempirical chromospheric models are presented for 30 g Her (M6 III). This star is one of the coolest (T(sub eff) = 3250 K) SRb (semiregular) variable stars and has a mass perhaps as great as 4 solar mass. Chromospheric features we have observed in its spectrum include Mg II h and k; C II) UV0.01, which is sensitive to electron density; Mg I lambda 2852; Ca II H, K, and IRT; Ca I lambda 4227 and lambda 6573; Al II) UV 1; and H alpha. We pay special attention to fitting the C II intersystem lines and the Mg II resonance lines but use all the other features as constraints to some extent. The equations of radiative transfer and statistical equilibrium are solved self-consistently for H I, H(-), H2, He I, C I, C II, Na I, Mg I, Mg II, Al I, Al II, Ca I, and Ca II with the equivalent two-level technique. To simplify these calculations, a one-dimensional hydrostatic, plane-parallel atmosphere is assumed. We investigate 10 separate 'classical' chromospheric models, differing most importantly in total mass column density above the temperature minimum. Synthetic spectra from these models fit some but not all of the observations. These comparisons are discussed in detail. However, we find that no single-component classical model in hydrostatic equilibrium is able to reproduce both the Mg II line profiles and the relative strengths of the CII) lines. In all these models, chromospheric emission features are formed relatively close to the star (approximately less than 0.05 R(sub *). The circumstellar environment has a thick, cool component overlying the Mg II emission region, which is relatively static and very turbulent. Finally, we find that thermalization in the Mg II h and k lines in the coolest giant stars is controlled by continuum absorption from Ca I 4p 4p3 P0 bound-free opacity and not collisional de-excitation as is the case for warmer K giants.

  20. Mitochondrial Targeting of Vitamin E Succinate Enhances Its Pro-apoptotic and Anti-cancer Activity via Mitochondrial Complex II*

    PubMed Central

    Dong, Lan-Feng; Jameson, Victoria J. A.; Tilly, David; Cerny, Jiri; Mahdavian, Elahe; Marín-Hernández, Alvaro; Hernández-Esquivel, Luz; Rodríguez-Enríquez, Sara; Stursa, Jan; Witting, Paul K.; Stantic, Bela; Rohlena, Jakub; Truksa, Jaroslav; Kluckova, Katarina; Dyason, Jeffrey C.; Ledvina, Miroslav; Salvatore, Brian A.; Moreno-Sánchez, Rafael; Coster, Mark J.; Ralph, Stephen J.; Smith, Robin A. J.; Neuzil, Jiri

    2011-01-01

    Mitochondrial complex II (CII) has been recently identified as a novel target for anti-cancer drugs. Mitochondrially targeted vitamin E succinate (MitoVES) is modified so that it is preferentially localized to mitochondria, greatly enhancing its pro-apoptotic and anti-cancer activity. Using genetically manipulated cells, MitoVES caused apoptosis and generation of reactive oxygen species (ROS) in CII-proficient malignant cells but not their CII-dysfunctional counterparts. MitoVES inhibited the succinate dehydrogenase (SDH) activity of CII with IC50 of 80 μm, whereas the electron transfer from CII to CIII was inhibited with IC50 of 1.5 μm. The agent had no effect either on the enzymatic activity of CI or on electron transfer from CI to CIII. Over 24 h, MitoVES caused stabilization of the oxygen-dependent destruction domain of HIF1α fused to GFP, indicating promotion of the state of pseudohypoxia. Molecular modeling predicted the succinyl group anchored into the proximal CII ubiquinone (UbQ)-binding site and successively reduced interaction energies for serially shorter phytyl chain homologs of MitoVES correlated with their lower effects on apoptosis induction, ROS generation, and SDH activity. Mutation of the UbQ-binding Ser68 within the proximal site of the CII SDHC subunit (S68A or S68L) suppressed both ROS generation and apoptosis induction by MitoVES. In vivo studies indicated that MitoVES also acts by causing pseudohypoxia in the context of tumor suppression. We propose that mitochondrial targeting of VES with an 11-carbon chain localizes the agent into an ideal position across the interface of the mitochondrial inner membrane and matrix, optimizing its biological effects as an anti-cancer drug. PMID:21059645

  1. Determining the Nature of [CII] 158 Micron Emission: an Improved Star Formation Rate Indicator

    NASA Astrophysics Data System (ADS)

    Sutter, Jessica; Dale, Daniel A.; KINGFISH Team

    2018-06-01

    The brightest observed emission line from most normal star-forming galaxies is the 158 micron line arising from singly-ionized carbon (also known as C+ or CII). In fact, astronomers have recently begun using the bright emission line to detect and characterize galaxies in the furthermost reaches of the universe. It is thus imperative that we have the tools to fully understand how this emission line could be utilized as an indicator of star formation rate, a primary parameter by which galaxies and their constituent star-forming regions are characterized. There are two main challenges to utilizing the [CII] 158 micron line as a star formation rate indicator. First, advances in long-wavelength astronomical instrumentation have only recently enabled its detection in statistically-significant samples of galaxies. Second, it is both a blessing and a curse that singly-ionized carbon can be created in both star-forming regions (ionized HII regions) and in non-star forming regions (neutral photo-dissociation regions). In order to better understand and quantify the [CII] emission as an indicator of star-formation rate, the relationship between the [NII] 205 micron emission, which can only arise from the ionized interstellar medium (ISM), and the [CII] 158 micron emission has been employed to determine the fraction of [CII] emission that originates from each phase of the ISM. Sub-kiloparsec measurements of the [NII] 205 micron line in nearby galaxies have recently become available as part of the KINGFISH program. We use these two far-infrared lines along with the full suite of KINGFISH panchromatic data to present an improved calibration of the [CII] emission line as a star formation rate indicator.

  2. Further Validation of the Conner's Adult Attention Deficit/Hyperactivity Rating Scale Infrequency Index (CII) for Detection of Non-Credible Report of Attention Deficit/Hyperactivity Disorder Symptoms.

    PubMed

    Cook, Carolyn M; Bolinger, Elizabeth; Suhr, Julie

    2016-06-01

    Attention deficit/hyperactivity disorder (ADHD) can be easily presented in a non-credible manner, through non-credible report of ADHD symptoms and/or by non-credible performance on neuropsychological tests. While most studies have focused on detection of non-credible performance using performance validity tests, there are few studies examining the ability to detect non-credible report of ADHD symptoms. We provide further validation data for a recently developed measure of non-credible ADHD symptom report, the Conner's Adult ADHD Rating Scales (CAARS) Infrequency Index (CII). Using archival data from 86 adults referred for concerns about ADHD, we examined the accuracy of the CII in detecting extreme scores on the CAARS and invalid reporting on validity indices of the Minnesota Multiphasic Personality Inventory-2 Restructured Format (MMPI-2-RF). We also examined the accuracy of the CII in detecting non-credible performance on standalone and embedded performance validity tests. The CII was 52% sensitive to extreme scores on CAARS DSM symptom subscales (with 97% specificity) and 20%-36% sensitive to invalid responding on MMPI-2-RF validity scales (with near 90% specificity), providing further evidence for the interpretation of the CII as an indicator of non-credible ADHD symptom report. However, the CII detected only 18% of individuals who failed a standalone performance validity test (Word Memory Test), with 87.8% specificity, and was not accurate in detecting non-credible performance using embedded digit span cutoffs. Future studies should continue to examine how best to assess for non-credible symptom report in ADHD referrals. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  3. Galactic Observations of Terahertz C+ (GOT C+): [CII] Detection of Warm "Dark Gas" in the ISM

    NASA Astrophysics Data System (ADS)

    Langer, W. D.; Velusamy, T.; Pineda, J.; Goldsmith, P.; Li, D.; Yorke, H. W.

    2011-11-01

    The Herschel HIFI Key Program, Galactic Observations of Terahertz C+ (GOT C+) is a survey of [CII] 1.9 THz emission throughout the Galaxy. Comparison of the first results of this survey with HI and CO isotopomer emission reveals excess [CII] emission beyond that expected from HI and CO layers alone, and is best explained as coming from a hidden layer of H2 gas, the so-called ISM "dark gas".

  4. Inhibitory effects of polyphenol punicalagin on type-II collagen degradation in vitro and inflammation in vivo.

    PubMed

    Jean-Gilles, Dinorah; Li, Liya; Vaidyanathan, V G; King, Roberta; Cho, Bongsup; Worthen, David R; Chichester, Clinton O; Seeram, Navindra P

    2013-09-25

    Cartilage destruction is a crucial process in arthritis and is characterized by the degradation of cartilage proteins, proteoglycans, and type II collagen (CII), which are embedded within the extracellular matrix. While proteoglycan loss can be reversed, the degradation of CII is irreversible and has been correlated with an over-expression and over-activation of matrix metalloproteinases (MMPs). Among the various MMPs, the collagenase MMP-13 possesses the greatest catalytic activity for CII degradation. Here we show that the pomegranate-derived polyphenols, punicalagin (PA) and ellagic acid (EA), inhibit MMP-13-mediated degradation of CII in vitro. Surface plasmon resonance studies and molecular docking simulations suggested multiple binding interactions of PA and EA with CII. The effects of PA on bovine cartilage degradation (stimulated with IL-1β) were investigated by assaying proteoglycan and CII release into cartilage culture media. PA inhibited the degradation of both proteins in a concentration-dependent manner. Finally, the anti-inflammatory effects of PA (daily IP delivery at 10 and 50mg/kg for 14days) were tested in an adjuvant-induced arthritis rat model. Disease development was assessed by daily measurements of body weight and paw volume (using the water displacement method). PA had no effect on disease development at the lower dose but inhibited paw volume (P<0.05) at the higher dose. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  5. Alpha-tocopheryl succinate induces apoptosis by targeting ubiquinone-binding sites in mitochondrial respiratory complex II.

    PubMed

    Dong, L-F; Low, P; Dyason, J C; Wang, X-F; Prochazka, L; Witting, P K; Freeman, R; Swettenham, E; Valis, K; Liu, J; Zobalova, R; Turanek, J; Spitz, D R; Domann, F E; Scheffler, I E; Ralph, S J; Neuzil, J

    2008-07-17

    Alpha-tocopheryl succinate (alpha-TOS) is a selective inducer of apoptosis in cancer cells, which involves the accumulation of reactive oxygen species (ROS). The molecular target of alpha-TOS has not been identified. Here, we show that alpha-TOS inhibits succinate dehydrogenase (SDH) activity of complex II (CII) by interacting with the proximal and distal ubiquinone (UbQ)-binding site (Q(P) and Q(D), respectively). This is based on biochemical analyses and molecular modelling, revealing similar or stronger interaction energy of alpha-TOS compared to that of UbQ for the Q(P) and Q(D) sites, respectively. CybL-mutant cells with dysfunctional CII failed to accumulate ROS and underwent apoptosis in the presence of alpha-TOS. Similar resistance was observed when CybL was knocked down with siRNA. Reconstitution of functional CII rendered CybL-mutant cells susceptible to alpha-TOS. We propose that alpha-TOS displaces UbQ in CII causing electrons generated by SDH to recombine with molecular oxygen to yield ROS. Our data highlight CII, a known tumour suppressor, as a novel target for cancer therapy.

  6. α-Tocopheryl succinate induces apoptosis by targeting ubiquinone-binding sites in mitochondrial respiratory complex II

    PubMed Central

    Dong, Lan-Feng; Low, Pauline; Dyason, Jeffrey C.; Wang, Xiu-Fang; Prochazka, Lubomir; Witting, Paul K.; Freeman, Ruth; Swettenham, Emma; Valis, Karel; Liu, Ji; Zobalova, Renata; Turanek, Jaroslav; Spitz, Doug R.; Domann, Frederick E.; Scheffler, Immo E.; Ralph, Stephen J.; Neuzil, Jiri

    2009-01-01

    α-Tocopheryl succinate (α-TOS) is a selective inducer of apoptosis in cancer cells, which involves the accumulation of reactive oxygen species (ROS). The molecular target of α-TOS has not been identified. Here we show that α-TOS inhibits succinate dehydrogenase (SDH) activity of complex II (CII) by interacting with the proximal and distal ubiquinone (UbQ) binding site (QP and QD, respectively). This is based on biochemical analyses and molecular modelling, revealing similar or stronger interaction energy of α-TOS compared to that of UbQ for the QP and QD sites, respectively. CybL-mutant cells with dysfunctional CII failed to accumulate ROS and undergo apoptosis in the presence of α-TOS. Similar resistance was observed when CybL was knocked down with siRNA. Reconstitution of functional CII rendered CybL-mutant cells susceptible to α-TOS. We propose that α-TOS displaces UbQ in CII causing electrons generated by SDH to recombine with molecular oxygen to yield ROS. Our data highlight CII, a known tumour suppressor, as a novel target for cancer therapy. PMID:18372923

  7. Interferon lambda 1-3 expression in infants hospitalized for RSV or HRV associated bronchiolitis.

    PubMed

    Selvaggi, Carla; Pierangeli, Alessandra; Fabiani, Marco; Spano, Lucia; Nicolai, Ambra; Papoff, Paola; Moretti, Corrado; Midulla, Fabio; Antonelli, Guido; Scagnolari, Carolina

    2014-05-01

    The airway expression of type III interferons (IFNs) was evaluated in infants hospitalized for respiratory syncytial virus (RSV) or rhinovirus (HRV) bronchiolitis. As an additional objective we sought to determine whether a different expression of IFN lambda 1-3 was associated with different harboring viruses, the clinical course of bronchiolitis or with the levels of well established IFN stimulated genes (ISGs), such as mixovirus resistance A (MxA) and ISG56. The analysis was undertaken in 118 infants with RSV or HRV bronchiolitis. Nasopharyngeal washes were collected for virological studies and molecular analysis of type III IFN responses. RSV elicited higher levels of IFN lambda subtypes when compared with HRV. A similar expression of type III IFN was found in RSVA or RSVB infected infants and in those infected with HRVA or HRVC viruses. Results also indicate that IFN lambda 1 and IFN lambda 2-3 levels were correlated with each other and with MxA and ISG56-mRNAs. In addition, a positive correlation exists between the IFN lambda1 levels and the clinical score index during RSV infection. In particular, higher IFN lambda 1 levels are associated to an increase of respiratory rate. These findings show that differences in the IFN lambda 1-3 levels in infants with RSV or HRV infections are present and that the expression of IFN lambda 1 correlates with the severity of RSV bronchiolitis. Copyright © 2014 The British Infection Association. Published by Elsevier Ltd. All rights reserved.

  8. Alternative assembly of respiratory complex II connects energy stress to metabolic checkpoints.

    PubMed

    Bezawork-Geleta, Ayenachew; Wen, He; Dong, LanFeng; Yan, Bing; Vider, Jelena; Boukalova, Stepana; Krobova, Linda; Vanova, Katerina; Zobalova, Renata; Sobol, Margarita; Hozak, Pavel; Novais, Silvia Magalhaes; Caisova, Veronika; Abaffy, Pavel; Naraine, Ravindra; Pang, Ying; Zaw, Thiri; Zhang, Ping; Sindelka, Radek; Kubista, Mikael; Zuryn, Steven; Molloy, Mark P; Berridge, Michael V; Pacak, Karel; Rohlena, Jakub; Park, Sunghyouk; Neuzil, Jiri

    2018-06-07

    Cell growth and survival depend on a delicate balance between energy production and synthesis of metabolites. Here, we provide evidence that an alternative mitochondrial complex II (CII) assembly, designated as CII low , serves as a checkpoint for metabolite biosynthesis under bioenergetic stress, with cells suppressing their energy utilization by modulating DNA synthesis and cell cycle progression. Depletion of CII low leads to an imbalance in energy utilization and metabolite synthesis, as evidenced by recovery of the de novo pyrimidine pathway and unlocking cell cycle arrest from the S-phase. In vitro experiments are further corroborated by analysis of paraganglioma tissues from patients with sporadic, SDHA and SDHB mutations. These findings suggest that CII low is a core complex inside mitochondria that provides homeostatic control of cellular metabolism depending on the availability of energy.

  9. Planning and Performance in Small Groups: Collective Implementation Intentions Enhance Group Goal Striving.

    PubMed

    Thürmer, J Lukas; Wieber, Frank; Gollwitzer, Peter M

    2017-01-01

    There are two key motivators to perform well in a group: making a contribution that (a) is crucial for the group (indispensability) and that (b) the other group members recognize (identifiability). We argue that indispensability promotes setting collective ("We") goals whereas identifiability induces individual ("I") goals. Although both goals may enhance performance, they should align with different strategies. Whereas pursuing collective goals should involve more cooperation, pursuing individual goals should involve less cooperation. Two experiments support this reasoning and show that planning out collective goals with collective implementation intentions (cIIs or "We-plans") relies on cooperation but planning out individual goals with individual implementation intentions (IIs or "I-plans") does not. In Experiment 1, three-member groups first formed a collective or an individual goal and then performed a first round of a physical persistence task. Groups then either formed a respective implementation intention (cII or II) or a control plan and then performed a second round of the task. Although groups with cIIs and IIs performed better on a physical persistence task than respective control groups, only cII groups interacted more cooperatively during task performance. To confirm the causal role of these interaction processes, Experiment 2 used the same persistence task and manipulated whether groups could communicate: When communication was hindered, groups with cIIs but not groups with IIs performed worse. Communication thus qualifies as a process making cIIs effective. The present research offers a psychology of action account to small group performance.

  10. Kinematics of [CII] Emission in Trumpler 14 & Carina I Probed with Stratospheric Terahertz Observatory

    NASA Astrophysics Data System (ADS)

    Seo, Youngmin; Goldsmith, Paul; Walker, Christopher; Kulesa, Craig; STO2 Team

    2018-01-01

    We present observations of the Trumpler 14 / Carina I regions carried out with the Stratospheric Terahertz Observatory 2 (STO2). The Trumpler 14 / Carina I region is in the west part of the Carina Nebula, which is one of the most active star-forming regions in the Milky Way. The Trumpler 14 / Carina I region is a promising place to study multiple, interacting phases of the ISM, including photon-dominated regions, HII regions, and dense molecular clouds. We observed Trumpler 14 / Carina I in the 158 μm transition of [CII] with a spatial resolution of 48 arcseconds and a velocity resolution of 0.17 km/s. The observations cover a 0.25°by 0.28°area with the center position at l= 297.33° b= -0.60°. We found that the [CII] emission is extended covering roughly 80% of the observed area with >5 K intensity. The peak intensity of [CII] is located four arcminutes southwest of Trumpler 14 and one arcminute east of the CO peak intensity of Carina I. The kinematics show that [CII] structures are spatially and spectrally correlated with the surfaces of CO clumps illuminated by Eta Carinae and Trumpler 14. The [CII] emission also shows a good correlation with dust continuum emission at 160 μm, which is typically originating from heated dust grains to ~20 K. Our results show layered structures of photon-dominated regions in the Trumpler 14 / Carina I region.

  11. On the interaction of the highly charged peptides casocidins with biomimetic membranes.

    PubMed

    Becucci, Lucia; Aloisi, Giovanni; Scaloni, Andrea; Caira, Simonetta; Guidelli, Rolando

    2018-04-19

    Casocidin I and II (CI and CII) are structurally related antimicrobial peptides made of 39 and 31 amino acids, respectively, which derive from natural proteolytic processing of α s2 -casein and adopt an ordered α-helical structure in biomimetic membranes. Their putative membrane-permeabilizing activity was investigated at Hg-supported self-assembled monolayers (SAMs) and at tethered bilayer lipid membranes (tBLMs); the latter consisted of a monolayer of 2,3,di-O-phytanyl-sn-glycerol-1-tetraethylene-glycol-d,l-α lipoic acid ester thiolipid (DPTL), with a dioleoylphosphatidylcholine (DOPC) or dioleoylphosphatidylserine (DOPS) monolayer on top of it. Interaction of CI and CII with these biomimetic membranes was studied by four electrochemical techniques at pH 3, 5.4 and 6.8. Peptide incorporation in tBLMs was attempted via scans of electrochemical impedance spectra. Experiments demonstrated that CI and CII penetrate SAMs as well as the distal DOPC monolayer of DPTL/DOPC tBLMs, but not the proximal phytanyl monolayer, with the only exception of CII at pH 5.4. Conversely, CII permeabilized DPTL/DOPS tBLMs to a moderate extent at all investigated pH values by forming holes across the membrane, but not ion channels. Structural distribution of charged residues seemed to prevent CII from having a hydrophobic side of the α-helix capable of stabilizing a regular ion channel in the lipid matrix. Copyright © 2018 Elsevier B.V. All rights reserved.

  12. Highly repressible expression system for cloning genes that specify potentially toxic proteins.

    PubMed Central

    O'Connor, C D; Timmis, K N

    1987-01-01

    A highly repressible expression vector system that allows the cloning of potentially deleterious genes has been constructed. Undesired expression of a cloned gene was prevented (i) at the level of initiation of transcription, by the presence of the strong but highly repressible leftward promoter of bacteriophage lambda, lambda pL, and (ii) at the level of transcript elongation or translation, through synthesis of antisense RNA complementary to the mRNA of the cloned gene. The system was tested by measuring the inhibition of expression of traT, the gene for the TraT major outer membrane lipoprotein. Direct detection and functional assays indicated that an essentially complete inhibition of traT expression was obtained. As a further test of the system, the gene encoding the EcoRI restriction endonuclease was cloned in the absence of the gene of the corresponding protective EcoRI modification methylase. Transformants harboring this construct were only viable when both repression controls were operational. Images PMID:2443481

  13. Identification of an alternative knockdown resistance (kdr)-like mutation, M918L, and a novel mutation, V1010A, in the Thrips tabaci voltage-gated sodium channel gene.

    PubMed

    Wu, Meixiang; Gotoh, Hiroki; Waters, Timothy; Walsh, Douglas B; Lavine, Laura Corley

    2014-06-01

    Knockdown resistance (kdr) has been identified as a main mechanism against pyrethroid insecticides in many arthropod pests including in the onion thrips, Thrips tabaci. To characterize and identify pyrethroid-resistance in onion thrips in Washington state, we conducted insecticide bioassays and sequenced a region of the voltage gated sodium channel gene from several different T. tabaci populations. Field collected Thrips tabaci were found to have large variations in resistance to the pyrethroid insecticide lambda-cyhalothrin. We identified two single nucleotide substitutions in our analysis of a partial sequence of the T. tabaci voltage-gated sodium channel gene. One mutation resulted in the non-synonymous substitution of methionine with leucine (M918L), which is well known to be responsible for super knockdown resistance in some pest species. Another non-synonymous substitution, a valine (GTT) to alanine (GCT) replacement at amino acid 1010 (V1010A) was identified in our study and was associated with lambda-cyhalothrin resistance. We have characterized a known kdr mutation and identified a novel mutation in the voltage-gated sodium channel gene of Thrips tabaci associated with resistance to lambda-cyhalothrin. This gene region and these mutations are expected to be useful in the development of a diagnostic test to detect kdr resistance in many onion thrips populations. © 2013 Society of Chemical Industry.

  14. Three-Dimensional Transgenic Cell Models to Quantify Space Genotoxic Effects

    NASA Technical Reports Server (NTRS)

    Gonda, S.; Wu, H.; Pingerelli, P.; Glickman, B.

    2000-01-01

    In this paper we describe a three-dimensional, multicellular tissue-equivalent model, produced in NASA-designed, rotating wall bioreactors using mammalian cells engineered for genomic containment of mUltiple copies of defined target genes for genotoxic assessment. The Rat 2(lambda) fibroblasts (Stratagene, Inc.) were genetically engineered to contain high-density target genes for mutagenesis. Stable three-dimensional, multicellular spheroids were formed when human mammary epithelial cells and Rat 2(lambda) fibroblasts were cocultured on Cytodex 3 Beads in a rotating wall bioreactor. The utility of this spheroidal model for genotoxic assessment was indicated by a linear dose response curve and by results of gene sequence analysis of mutant clones from 400micron diameter spheroids following low-dose, high-energy, neon radiation exposure

  15. Antitumor activity of type I and type III interferons in BNL hepatoma model.

    PubMed

    Abushahba, Walid; Balan, Murugabaskar; Castaneda, Ismael; Yuan, Yao; Reuhl, Kenneth; Raveche, Elizabeth; de la Torre, Andrew; Lasfar, Ahmed; Kotenko, Sergei V

    2010-07-01

    Hepatocellular carcinoma (HCC) occurs most commonly secondary to cirrhosis due to chronic hepatitis C or B virus (HCV/HBV) infections. Type I interferon (IFN-alpha) treatment of chronic HCV/HBV infections reduces the incidence of HCC in cirrhotic patients. However, IFN-alpha toxicity limits its tolerability and efficacy highlighting a need for better therapeutic treatments. A recently discovered type III IFN (IFN-lambda) has been shown to possess antiviral properties against HCV and HBV in vitro. In phase I clinical trials, IFN-lambda treatment did not cause significant adverse reactions. Using a gene therapy approach, we compared the antitumor properties of IFN-alpha and IFN-lambda in a transplantable hepatoma model of HCC. BALB/c mice were inoculated with syngeneic BNL hepatoma cells, or BNL cells expressing IFN-lambda (BNL.IFN-lambda cells) or IFN-alpha (BNL.IFN-alpha cells). Despite the lack of antiproliferative activity of IFNs on BNL cells, both BNL.IFN-lambda and BNL.IFN-alpha cells displayed retarded growth kinetics in vivo. Depletion of NK cells from splenocytes inhibited splenocyte-mediated cytotoxicity, demonstrating that NK cells play a role in IFN-induced antitumor responses. However, isolated NK cells did not respond directly to IFN-lambda. There was also a marked NK cell infiltration in IFN-lambda producing tumors. In addition, IFN-lambda and, to a lesser extent, IFN-alpha enhanced immunocytotoxicity of splenocytes primed with irradiated BNL cells. Splenocyte cytotoxicity against BNL cells was dependent on IL-12 and IFN-gamma, and mediated by dendritic cells. In contrast to NK cells, isolated from spleen CD11c+ and mPDCA+ dendritic cells responded directly to IFN-lambda. The antitumor activities of IFN-lambda against hepatoma, in combination with HCV and HBV antiviral activities warrant further investigation into the clinical use of IFN-lambda to prevent HCC in HCV/HBV-infected cirrhotic patients, as well as to treat liver cancer.

  16. Effect of carbon ion implantation on the tribology of metal-on-metal bearings for artificial joints.

    PubMed

    Koseki, Hironobu; Tomita, Masato; Yonekura, Akihiko; Higuchi, Takashi; Sunagawa, Sinya; Baba, Koumei; Osaki, Makoto

    2017-01-01

    Metal-on-metal (MoM) bearings have become popular due to a major advantage over metal-on-polymer bearings for total hip arthroplasty in that the larger femoral head and hydrodynamic lubrication of the former reduce the rate of wear. However, concerns remain regarding adverse reactions to metal debris including metallosis caused by metal wear generated at the taper-head interface and another modular junction. Our group has hypothesized that carbon ion implantation (CII) may improve metal wear properties. The purpose of this study was to investigate the wear properties and friction coefficients of CII surfaces with an aim to ultimately apply these surfaces to MoM bearings in artificial joints. CII was applied to cobalt-chromium-molybdenum (Co-Cr-Mo) alloy substrates by plasma source ion implantation. The substrates were characterized using scanning electron microscopy and a 3D measuring laser microscope. Sliding contact tests were performed with a simple geometry pin-on-plate wear tester at a load of 2.5 N, a calculated contact pressure of 38.5 MPa (max: 57.8 MPa), a reciprocating velocity of 30 mm/s, a stroke length of 60 mm, and a reciprocating cycle count of 172,800 cycles. The surfaces of the CII substrates were generally featureless with a smooth surface topography at the same level as untreated Co-Cr-Mo alloy. Compared to the untreated Co-Cr-Mo alloy, the CII-treated bearings had lower friction coefficients, higher resistance to catastrophic damage, and prevented the adhesion of wear debris. The results of this study suggest that the CII surface stabilizes the wear status due to the low friction coefficient and low infiltration of partner materials, and these properties also prevent the adhesion of wear debris and inhibit excessive wear. Carbon is considered to be biologically inert; therefore, CII is anticipated to be applicable to the bearing surfaces of MoM prostheses.

  17. The Compression Intensity Index: a practical anatomical estimate of the biomechanical risk for a deep tissue injury.

    PubMed

    Gefen, Amit

    2008-01-01

    Pressure-related deep tissue injury (DTI) is a severe form of pressure ulcer that initiates in compressed muscle tissues under bony prominences, and progresses superficially towards the skin. Patients with impaired motosensory capacities are at high risk of developing DTI. There is a critical medical need for developing risk assessment tools for DTI. A new anatomical index, the Compression Intensity Index: CII=(BW/Rt);[1/2], which depends on the body weight (BW), radius of curvature of the ischial tuberosities (R) and thickness of the underlying gluteus muscles (t), is suggested for approximating the loading intensity in muscle tissue during sitting in permanent wheelchair users, as part of a clinically-oriented risk assessment for DTI. Preliminary CII data were calculated for 6 healthy and 4 paraplegic subjects following MRI scans, and data were compared between the groups and with respect to a gold standard, being a previously developed subject-specific MRI-finite-element (MRI-FE) method of calculating muscle tissue stresses (Linder-Ganz et al., J. Biomech. 2007). Marked differences between the R and t parameters of the two groups caused the CII values of the paraplegics to be approximately 1.6-fold higher than for the healthy (p<0.001), thereby indicating on the sensitivity of this parameter to the pathoanatomical changes that occur in the buttocks with paraplegia. Data of CII correlated reasonably with the gold standard calculations of MRI-FE muscle stresses (correlation coefficient 0.65). Since CII measurements do not require highly-specialized biomechanical numerical analyses such as MRI-FE, CII has the potential to serve as a practical, quick, and cost-effective approximation of the loading intensity in muscles of wheelchair-bound or bedridden patients. Hence, CII measurements can be integrated into DTI-risk-assessment tools, the need of which is now being discussed intensively in the American and European Pressure Ulcer Advisory Panel meetings.

  18. Effect of carbon ion implantation on the tribology of metal-on-metal bearings for artificial joints

    PubMed Central

    Koseki, Hironobu; Tomita, Masato; Yonekura, Akihiko; Higuchi, Takashi; Sunagawa, Sinya; Baba, Koumei; Osaki, Makoto

    2017-01-01

    Metal-on-metal (MoM) bearings have become popular due to a major advantage over metal-on-polymer bearings for total hip arthroplasty in that the larger femoral head and hydrodynamic lubrication of the former reduce the rate of wear. However, concerns remain regarding adverse reactions to metal debris including metallosis caused by metal wear generated at the taper-head interface and another modular junction. Our group has hypothesized that carbon ion implantation (CII) may improve metal wear properties. The purpose of this study was to investigate the wear properties and friction coefficients of CII surfaces with an aim to ultimately apply these surfaces to MoM bearings in artificial joints. CII was applied to cobalt-chromium-molybdenum (Co-Cr-Mo) alloy substrates by plasma source ion implantation. The substrates were characterized using scanning electron microscopy and a 3D measuring laser microscope. Sliding contact tests were performed with a simple geometry pin-on-plate wear tester at a load of 2.5 N, a calculated contact pressure of 38.5 MPa (max: 57.8 MPa), a reciprocating velocity of 30 mm/s, a stroke length of 60 mm, and a reciprocating cycle count of 172,800 cycles. The surfaces of the CII substrates were generally featureless with a smooth surface topography at the same level as untreated Co-Cr-Mo alloy. Compared to the untreated Co-Cr-Mo alloy, the CII-treated bearings had lower friction coefficients, higher resistance to catastrophic damage, and prevented the adhesion of wear debris. The results of this study suggest that the CII surface stabilizes the wear status due to the low friction coefficient and low infiltration of partner materials, and these properties also prevent the adhesion of wear debris and inhibit excessive wear. Carbon is considered to be biologically inert; therefore, CII is anticipated to be applicable to the bearing surfaces of MoM prostheses. PMID:28615939

  19. Hydrophobic Man-1-P derivatives correct abnormal glycosylation in Type I congenital disorder of glycosylation fibroblasts.

    PubMed

    Eklund, Erik A; Merbouh, Nabyl; Ichikawa, Mie; Nishikawa, Atsushi; Clima, Jessica M; Dorman, James A; Norberg, Thomas; Freeze, Hudson H

    2005-11-01

    Patients with Type I congenital disorders of glycosylation (CDG-I) make incomplete lipid-linked oligosaccharides (LLO). These glycans are poorly transferred to proteins resulting in unoccupied glycosylation sequons. Mutations in phosphomannomutase (PMM2) cause CDG-Ia by reducing the activity of PMM, which converts mannose (Man)-6-P to Man-1-P before formation of GDP-Man. These patients have reduced Man-1-P and GDP-Man. To replenish intracellular Man-1-P pools in CDG-Ia cells, we synthesized two hydrophobic, membrane permeable acylated versions of Man-1-P and determined their ability to normalize LLO size and N-glycosylation in CDG-Ia fibroblasts. Both compounds, compound I (diacetoxymethyl 2,3,4,6-tetra-O-acetyl-alpha-D-mannopyranosyl phosphate) (C-I) and compound II (diacetoxymethyl 2,3,4,6-tetra-O-ethyloxycarbonyl-alpha-D-mannopyranosyl phosphate) (C-II), contain two acetoxymethyl (CH2OAc) groups O-linked to phosphorous. C-I contains acetyl esters and C-II contains ethylcarbonate (CO2Et) esters on the Man residue. Both C-I and C-II normalized truncated LLO, but C-II was about 2-fold more efficient than C-I. C-II replenished the GDP-Man pool in CDG-Ia cells and was more efficiently incorporated into glycoproteins than exogenous Man at low concentrations (25-75 mM). In a glycosylation assay of DNaseI in CDG-Ia cells, C-II restored glycosylation to control cell levels. C-II also corrected impaired LLO biosynthesis in cells from a Dolichol (Dol)-P-Man deficient patient (CDG-Ie) and partially corrected LLO in cells from an ALG12 mannosyltransferase-deficient patient (CDG-Ig), whereas cells from an ALG3-deficient patient (CDG-Id) and from an MPDU1-deficient patient (CDG-If) were not corrected. These results validate the general concept of using pro-Man-1-P substrates as potential therapeutics for CDG-I patients.

  20. [CII] At 1 < z < 2: Observing Star Formation in the Early Universe with Zeus (1 and 2)

    NASA Technical Reports Server (NTRS)

    Ferkinhoff, Carl; Hailey-Dunsheath, S.; Nikola, T.; Oberst, T.; Parshley, S.; Stacey, G.; Benford, D.; staguhn, J.

    2010-01-01

    We report the detection of the [CII] 158 micron fine structure line from six submillimeter galaxies with redshifts between 1.12 and 1.73. This more than doubles the total number of [CII] 158 micron detections reported from high redshift sources. These observations were made with the Redshift(z) and Early Universe Spectrometer(ZEUS) at the Caltech Submillimeter Observatory on Mauna Kea, Hawaii between December 2006 and March 2009. ZEUS is a background limited submm echelle grating spectrometer (Hailey-Dunsheath 2009). Currently we are constructing ZEUS-2. This new instrument will utilize the same grating but will feature a two dimensional transition-edge sensed bolometer array with SQUID multiplexing readout system enabling simultaneous background limited observations in the 200, 340,450 and 650 micron telluric windows. ZEUS-2 will allow for long slit imaging spectroscopy in nearby galaxies and a [CII] survey from z 0.25 to 2.5.

  1. Class I and II Small Heat Shock Proteins Together with HSP101 Protect Protein Translation Factors during Heat Stress1[OPEN

    PubMed Central

    Basha, Eman; Fowler, Mary E.; Kim, Minsoo; Bordowitz, Juliana; Katiyar-Agarwal, Surekha

    2016-01-01

    The ubiquitous small heat shock proteins (sHSPs) are well documented to act in vitro as molecular chaperones to prevent the irreversible aggregation of heat-sensitive proteins. However, the in vivo activities of sHSPs remain unclear. To investigate the two most abundant classes of plant cytosolic sHSPs (class I [CI] and class II [CII]), RNA interference (RNAi) and overexpression lines were created in Arabidopsis (Arabidopsis thaliana) and shown to have reduced and enhanced tolerance, respectively, to extreme heat stress. Affinity purification of CI and CII sHSPs from heat-stressed seedlings recovered eukaryotic translation elongation factor (eEF) 1B (α-, β-, and γ-subunits) and eukaryotic translation initiation factor 4A (three isoforms), although the association with CI sHSPs was stronger and additional proteins involved in translation were recovered with CI sHSPs. eEF1B subunits became partially insoluble during heat stress and, in the CI and CII RNAi lines, showed reduced recovery to the soluble cell fraction after heat stress, which was also dependent on HSP101. Furthermore, after heat stress, CI sHSPs showed increased retention in the insoluble fraction in the CII RNAi line and vice versa. Immunolocalization revealed that both CI and CII sHSPs were present in cytosolic foci, some of which colocalized with HSP101 and with eEF1Bγ and eEF1Bβ. Thus, CI and CII sHSPs have both unique and overlapping functions and act either directly or indirectly to protect specific translation factors in cytosolic stress granules. PMID:27474115

  2. Characterization of a lambda-cyhalothrin metabolizing glutathione S-transferase CpGSTd1 from Cydia pomonella (L.).

    PubMed

    Liu, Jiyuan; Yang, Xueqing; Zhang, Yalin

    2014-11-01

    In insects, glutathione S-transferases (GSTs) are enzymes involved in detoxification of insecticides. However, few data are available for the codling moth, Cydia pomonella (L.). In this study, we cloned a delta class GST gene CpGSTd1 from C. pomonella. Real-time quantitative PCR shows that CpGSTd1 was up-regulated with aging, and the mRNA level of CpGSTd1 was higher in the fat body and silk glands than in other tissues. The expression level of CpGSTd1 exposure to insecticide suggests that CpGSTd1 is up-regulated after chlorpyrifos-methyl and lambda-cyhalothrin treatments. Both lambda-cyhalothrin and chlorpyrifos-methyl altered GST activity in vivo. The purified CpGSTd1 protein exhibits a high catalytic efficiency with CDNB and was inhibited by lambda-cyhalothrin and chlorpyrifos-methyl in vitro. Metabolism assays indicate that lambda-cyhalothrin was significantly metabolized while chlorpyrifos-methyl was not metabolized by CpGSTd1. Binding free energy analysis suggests that CpGSTd1 binding is tighter with lambda-cyhalothrin than with chlorpyrifos-methyl. Our study suggests that CpGSTd1 plays a key role in the metabolism of insecticides in C. pomonella.

  3. 6 CFR 29.1 - Purpose and scope.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

  4. 6 CFR 29.1 - Purpose and scope.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

  5. 6 CFR 29.1 - Purpose and scope.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

  6. 6 CFR 29.1 - Purpose and scope.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

  7. Measuring the Epoch of Reionization using [CII] Intensity Mapping with TIME-Pilot

    NASA Astrophysics Data System (ADS)

    Crites, Abigail; Bock, James; Bradford, Matt; Bumble, Bruce; Chang, Tzu-Ching; Cheng, Yun-Ting; Cooray, Asantha R.; Hailey-Dunsheath, Steve; Hunacek, Jonathon; Li, Chao-Te; O'Brient, Roger; Shirokoff, Erik; Staniszewski, Zachary; Shiu, Corwin; Uzgil, Bade; Zemcov, Michael B.; Sun, Guochao

    2017-01-01

    TIME-Pilot (the Tomographic Ionized carbon Intensity Mapping Experiment) is a new instrument designed to probe the epoch of reionization (EoR) by measuring the 158 um ionized carbon emission line [CII] from redshift 5 - 9. TIME-Pilot will also probe the molecular gas content of the universe during the epoch spanning the peak of star formation (z ~ 1 -3) by making an intensity mapping measurement of the CO transitions in the TIME-Pilot band (CO(3-2), CO(4-3), CO(5-4), and CO(6-5)). I will describe the instrument we are building which is an R of ~100 spectrometer sensitive to the 200-300 GHz radiation. The camera is designed to measure the line emission from galaxies using an intensity mapping technique. This instrument will allow us to detect the [CII] clustering fluctuations from faint galaxies during EoR and compare these measurements to predicted [CII] amplitudes from current models. The CO measurements will allow us to constrain models for galaxies at lower redshift. The [CII] intensity mapping measurements that will be made with TIME-Pilot and detailed measurements made with future more sensitive mm-wavelength spectrometers are complimentary to 21-cm measurements of the EoR and complimentary to direct detections of high redshift galaxies with HST, ALMA, and, in the future, JWST.

  8. C+ detection of warm dark gas in diffuse clouds

    NASA Astrophysics Data System (ADS)

    Langer, W. D.; Velusamy, T.; Pineda, J. L.; Goldsmith, P. F.; Li, D.; Yorke, H. W.

    2010-10-01

    We present the first results of the Herschel open time key program, Galactic Observations of Terahertz C+ (GOT C+) survey of the [CII] 2P3/2-2P1/2 fine-structure line at 1.9 THz (158 μm) using the HIFI instrument on Herschel. We detected 146 interstellar clouds along sixteen lines-of-sight towards the inner Galaxy. We also acquired HI and CO isotopologue data along each line-of-sight for analysis of the physical conditions in these clouds. Here we analyze 29 diffuse clouds (AV < 1.3 mag) in this sample characterized by having [CII] and HI emission, but no detectable CO. We find that [CII] emission is generally stronger than expected for diffuse atomic clouds, and in a number of sources is much stronger than anticipated based on their HI column density. We show that excess [CII] emission in these clouds is best explained by the presence of a significant diffuse warm H2, dark gas, component. This first [CII] 158 μm detection of warm dark gas demonstrates the value of this tracer for mapping this gas throughout the Milky Way and in galaxies. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  9. Tertiary structure of human {Lambda}6 light chains.

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Pokkuluri, P. R.; Solomon, A.; Weiss, D. T.

    1999-01-01

    AL amyloidosis is a disease process characterized by the pathologic deposition of monoclonal light chains in tissue. To date, only limited information has been obtained on the molecular features that render such light chains amyloidogenic. Although protein products of the major human V kappa and V lambda gene families have been identified in AL deposits, one particular subgroup--lambda 6--has been found to be preferentially associated with this disease. Notably, the variable region of lambda 6 proteins (V lambda 6) has distinctive primary structural features including the presence in the third framework region (FR3) of two additional amino acid residues thatmore » distinguish members of this subgroup from other types of light chains. However, the structural consequences of these alterations have not been elucidated. To determine if lambda 6 proteins possess unique tertiary structural features, as compared to light chains of other V lambda subgroups, we have obtained x-ray diffraction data on crystals prepared from two recombinant V lambda 6 molecules. These components, isolated from a bacterial expression system, were generated from lambda 6-related cDNAs cloned from bone marrow-derived plasma cells from a patient (Wil) who had documented AL amyloidosis and another (Jto) with multiple myeloma and tubular cast nephropathy, but no evident fibrillar deposits. The x-ray crystallographic analyses revealed that the two-residue insertion located between positions 68 and 69 (not between 66 and 67 as previously surmised) extended an existing loop region that effectively increased the surface area adjacent to the first complementarity determining region (CDR1). Further, an unusual interaction between the Arg 25 and Phe 2 residues commonly found in lambda 6 molecules was noted. However, the structures of V lambda 6 Wil and Jto also differed from each other, as evidenced by the presence in the latter of certain ionic and hydrophobic interactions that we posit increased protein stability and thus prevented amyloid formation.« less

  10. Mutagenicity of furan in female Big Blue B6C3F1 mice

    PubMed Central

    Terrell, Ashley N.; Huynh, Mailee; Grill, Alex E.; Kovi, Ramesh C.; O’Sullivan, M. Gerard; Guttenplan, Joseph B.; Ho, Yen-Yi; Peterson, Lisa A.

    2014-01-01

    Furan is an abundant food and environmental contaminant that is a potent liver carcinogen in rodent models. To determine if furan is genotoxic in vivo, female B6C3F1 Big Blue transgenic mice were treated with 15 mg/kg bw furan by gavage 5 days a week for 6 weeks, or once weekly for 3 weeks. Liver cII trans-gene mutation-frequency and mutation spectra were determined. Furan did not increase the mutation frequency under either treatment condition. In the 6-week treatment regimen, there was a change in the cII transgene mutation-spectrum, with the fraction of GC to AT transitions significantly reduced. The only other significant change was an increase in GC to CG transversions; these represented a minor contribution to the overall mutation spectrum. A much larger furan-dependent shift was observed in the 3-week study. There was a significant increase in transversion mutations, predominantly GC to TA transversions as well as smaller non-significant changes in GC to CG and AT to TA transversions. To determine if these mutations were caused by cis-2-butene-1,4-dial (BDA), a reactive metabolite of furan, the mutagenic activity and the mutation spectrum of BDA was determined in vitro, in Big Blue mouse embryonic fibroblasts. This compound did not increase the cII gene mutation-frequency but caused a substantial increase in AT to CG transversions. This increase, however, lost statistical significance when adjusted for multiple comparisons. Together, these findings suggest that BDA may not be directly responsible for the in-vivo effects of furan on mutational spectra. Histopathological analysis of livers from furan-treated mice revealed that furan induced multifocal, hepatocellular necrosis admixed with reactive leukocytes and pigment-laden Kupffer cells, enhanced oval-cell hyperplasia, and increased hepatocyte mitoses, some of which were atypical. An indirect mechanism of genotoxicity is proposed in which chronic toxicity followed by inflammation and secondary cell proliferation triggers cancer development in furan-exposed rodents. PMID:25344163

  11. Class I and II Small Heat Shock Proteins Together with HSP101 Protect Protein Translation Factors during Heat Stress.

    PubMed

    McLoughlin, Fionn; Basha, Eman; Fowler, Mary E; Kim, Minsoo; Bordowitz, Juliana; Katiyar-Agarwal, Surekha; Vierling, Elizabeth

    2016-10-01

    The ubiquitous small heat shock proteins (sHSPs) are well documented to act in vitro as molecular chaperones to prevent the irreversible aggregation of heat-sensitive proteins. However, the in vivo activities of sHSPs remain unclear. To investigate the two most abundant classes of plant cytosolic sHSPs (class I [CI] and class II [CII]), RNA interference (RNAi) and overexpression lines were created in Arabidopsis (Arabidopsis thaliana) and shown to have reduced and enhanced tolerance, respectively, to extreme heat stress. Affinity purification of CI and CII sHSPs from heat-stressed seedlings recovered eukaryotic translation elongation factor (eEF) 1B (α-, β-, and γ-subunits) and eukaryotic translation initiation factor 4A (three isoforms), although the association with CI sHSPs was stronger and additional proteins involved in translation were recovered with CI sHSPs. eEF1B subunits became partially insoluble during heat stress and, in the CI and CII RNAi lines, showed reduced recovery to the soluble cell fraction after heat stress, which was also dependent on HSP101. Furthermore, after heat stress, CI sHSPs showed increased retention in the insoluble fraction in the CII RNAi line and vice versa. Immunolocalization revealed that both CI and CII sHSPs were present in cytosolic foci, some of which colocalized with HSP101 and with eEF1Bγ and eEF1Bβ. Thus, CI and CII sHSPs have both unique and overlapping functions and act either directly or indirectly to protect specific translation factors in cytosolic stress granules. © 2016 American Society of Plant Biologists. All Rights Reserved.

  12. The [CII]/[NII] far-infrared line ratio at z>5: extreme conditions for “normal” galaxies

    NASA Astrophysics Data System (ADS)

    Pavesi, Riccardo; Riechers, Dominik; Capak, Peter L.; Carilli, Chris Luke; Sharon, Chelsea E.; Stacey, Gordon J.; Karim, Alexander; Scoville, Nicholas; Smolcic, Vernesa

    2017-01-01

    Thanks to the Atacama Large (sub-)Millimeter Array (ALMA), observations of atomic far-infrared fine structure lines are a very productive way of measuring physical properties of the interstellar medium (ISM) in galaxies at high redshift, because they provide an unobscured view into the physical conditions of star formation. While the bright [CII] line has become a routine probe of the dynamical properties of the gas, its intensity needs to be compared to other lines in order to establish the physical origin of the emission. [NII] selectively traces the emission coming from the ionized fraction of the [CII]-emitting gas, offering insight into the phase structure of the ISM. Here we present ALMA measurements of [NII] 205 μm fine structure line emission from a representative sample of galaxies at z=5-6 spanning two orders of magnitude in star formation rate (SFR). Our results show at least two different regimes of ionized gas properties for galaxies in the first billion years of cosmic time, separated by their L[CII]/L[NII] ratio. First, we find extremely low [NII] emission compared to [CII] from a “typical” Lyman Break Galaxy (LBG-1), likely due to low dust content and reminiscent of local dwarfs. Second, the dusty Lyman Break Galaxy HZ10 and the extreme starburst AzTEC-3 show ionized gas fractions typical of local star-forming galaxies and show hints of spatial variations in their [CII]/[NII] line ratio. These observations of far-infrared lines in “normal” galaxies at z>5 yield some of the first constraints on ISM models for young galaxies in the first billion years of cosmic time and shed light on the observed evolution of the dust and gas properties.

  13. The control of lambda DNA terminase synthesis.

    PubMed Central

    Murialdo, H; Davidson, A; Chow, S; Gold, M

    1987-01-01

    Nu1 and A, the genes coding for bacteriophage lambda DNA terminase, rank among the most poorly translated genes expressed in E. coli. To understand the reason for this low level of translation the genes were cloned into plasmids and their expression measured. In addition, the wild type DNA sequences immediately preceding the genes were reduced and modified. It was found that the elements that control translation are contained in the 100 base pairs upstream from the initiation codon. Interchanging these upstream sequences with those of an efficiently translated gene dramatically increased the translation of terminase subunits. It seems unlikely that the rare codons present in the genes, and any feature of their mRNA secondary structure play a role in the control of their translation. The elimination of cos from plasmids containing Nu1 and A also resulted in an increase in terminase production. This result suggests a role for cos in the control of late gene expression. The terminase subunit overproducer strains are potentially very useful for the design of improved DNA packaging and cosmid mapping techniques. Images PMID:3029667

  14. Relationship between residual feed intake and lymphocyte mitochondrial complex protein concentration and ratio in crossbred steers.

    PubMed

    Davis, M P; Brooks, M A; Kerley, M S

    2016-04-01

    Rate of oxygen uptake by muscle mitochondria and respiratory chain protein concentrations differed between high- and low-residual feed intake (RFI) animals. The hypothesis of this research was that complex I (CI), II (CII), and III (CIII) mitochondria protein concentrations in lymphocyte (blood) mitochondria were related to the RFI phenotype of beef steers. Daily feed intake (ADFI) was individually recorded for 92 Hereford-crossbreed steers over 63 d using GrowSafe individual feed intake system. Predicted ADFI was calculated as the regression of ADFI on ADG and midtest BW. Difference between ADFI and predicted ADFI was RFI. Lymphocytes were isolated from low-RFI (-1.32 ± 0.11 kg/d; = 10) and high-RFI (1.34 ± 0.18 kg/d; = 8) steers. Immunocapture of CI, CII, and CIII proteins from the lymphocyte was done using MitoProfile CI, CII, and CIII immunocapture kits (MitoSciences Inc., Eugene, OR). Protein concentrations of CI, CII, and CIII and total protein were quantified using bicinchoninic acid colorimetric procedures. Low-RFI steers consumed 30% less ( = 0.0004) feed and had a 40% improvement ( < 0.0001) in feed efficiency compared with high-RFI steers with similar growth ( = 0.78) and weight measurements ( > 0.65). High- and low-RFI steers did not differ in CI ( = 0.22), CII ( = 0.69), and CIII ( = 0.59) protein concentrations. The protein concentration ratios for CI to CII ( = 0.03) were 20% higher and the ratios of CI to CIII ( = 0.01) were 30% higher, but the ratios of CII to CIII ( = 0.89) did not differ when comparing low-RFI steers with high-RFI steers. The similar magnitude difference in feed intake, feed efficiency measurements, and CI-to-CIII ratio between RFI phenotypes provides a plausible explanation for differences between the phenotypes. We also concluded that mitochondria isolated from lymphocytes could be used to study respiratory chain differences among differing RFI phenotypes. Further research is needed to determine if lymphocyte mitochondrial complex proteins can be used for identification of RFI phenotype.

  15. Collaborative Access Control For Critical Infrastructures

    NASA Astrophysics Data System (ADS)

    Baina, Amine; El Kalam, Anas Abou; Deswarte, Yves; Kaaniche, Mohamed

    A critical infrastructure (CI) can fail with various degrees of severity due to physical and logical vulnerabilities. Since many interdependencies exist between CIs, failures can have dramatic consequences on the entire infrastructure. This paper focuses on threats that affect information and communication systems that constitute the critical information infrastructure (CII). A new collaborative access control framework called PolyOrBAC is proposed to address security problems that are specific to CIIs. The framework offers each organization participating in a CII the ability to collaborate with other organizations while maintaining control of its resources and internal security policy. The approach is demonstrated on a practical scenario involving the electrical power grid.

  16. Cloning and study of the pectate lyase gene of Erwinia carotovora

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Bukanov, N.O.; Fonshtein, M.Yu.; Evtushenkov, A.N.

    1986-04-01

    The cloning of the gene of a secretable protein of Erwinia carotovora, pectate lyase, in Escherichia coli was described. Primary cloning was conducted using the phage vector lambda 47.1. In the gene library of E. carotovora obtained, eight phages carrying the gene sought were identified according to the appearance of enzymatic activity of the gene product, pectate lyase, in situ. The BamHI fragment of DNA, common to all these phages, was recloned on the plasmid pUC19. It was shown that the cloned pectate lyase gene is represented on the E. carotovora chromosome in one copy. Methods of production of representativemore » gene libraries on phage vectors from no less than 1 ..mu..g of cloned DNA even for the genomes of eukaryotes have now been developed. Vectors have been created, for example, lambda 47.1, permitting the selection only of hybrid molecules. A number of methods have been developed for the search for a required gene in the library, depending on whether the cloned gene can be expressed or not, and if it can, what properties it will impart to the hybrid clone containing it.« less

  17. 6 CFR 29.1 - Purpose and scope.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... INFORMATION § 29.1 Purpose and scope. (a) Purpose of this Part. This Part implements sections 211 through 215... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

  18. 47 CFR 22.973 - Information exchange.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 47 Telecommunication 2 2012-10-01 2012-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

  19. 47 CFR 22.973 - Information exchange.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 47 Telecommunication 2 2011-10-01 2011-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

  20. 47 CFR 22.973 - Information exchange.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 47 Telecommunication 2 2014-10-01 2014-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

  1. 47 CFR 22.973 - Information exchange.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 47 Telecommunication 2 2013-10-01 2013-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

  2. Novel mutations in the GPIHBP1 gene identified in 2 patients with recurrent acute pancreatitis.

    PubMed

    Ariza, María José; Martínez-Hernández, Pedro Luis; Ibarretxe, Daiana; Rabacchi, Claudio; Rioja, José; Grande-Aragón, Cristina; Plana, Nuria; Tarugi, Patrizia; Olivecrona, Gunilla; Calandra, Sebastiano; Valdivielso, Pedro

    2016-01-01

    Glycosylphosphatidylinositol-anchored high-density lipoprotein-binding protein 1 (GPIHBP1) has been demonstrated to be essential for the in vivo function of lipoprotein lipase (LPL), the major triglyceride (TG)-hydrolyzing enzyme involved in the intravascular lipolysis of TG-rich lipoproteins. Recently, loss-of-function mutations of GPIHBP1 have been reported as the cause of type I hyperlipoproteinemia in several patients. Two unrelated patients were referred to our Lipid Units because of a severe hypertriglyceridemia and recurrent pancreatitis. We measured LPL activity in postheparin plasma and serum ApoCII and sequenced LPL, APOC2, and GPIHBP1. The 2 patients exhibited very low LPL activity not associated with mutations in LPL gene or with ApoCII deficiency. The sequence of GPIHBP1 revealed 2 novel point mutations. One patient (proband 1) was found to be homozygous for a C>A transversion in exon 3 resulting in the conversion of threonine to lysine at position 80 (p.Thr80Lys). The other patient (proband 2) was found to be homozygous for a G>T transversion in the third base of the ATG translation initiation codon in exon 1, resulting in the conversion of methionine to isoleucine (p.Met1Ile). In conclusion, we have identified 2 novel GPIHBP1 missense mutations in 2 unrelated patients as the cause of their severe hypertriglyceridemia. Copyright © 2016 National Lipid Association. Published by Elsevier Inc. All rights reserved.

  3. Two-stage continuous operation of recombinant Escherichia coli using the bacteriophage lambda Q- vector.

    PubMed

    Oh, Jeong Seok; Cho, Daechul; Park, Tai Hyun

    2005-11-01

    A two-stage continuous culture of Escherichia coli in combination with a bacteriophage lambda system was performed in order to overcome the intrinsic plasmid instability that is frequently observed in recombinant fermentation. A phage lambda vector with a Q(-) mutation was used to enhance the expression of the lambda system. The optimal values of the important operational variables such as the substrate concentration, the dilution rate, and the mean residence time on the expression of the cloned gene were determined in both batch and continuous cultures. For all culturing modes, the full induction of the cloned gene was observed 4 h after the temperature shift. In the two stage continuous culture, the overproduction reached their maxima at D=0.25 h(-1) with 1.5 S(0) of the medium supply. The maximum productivity of the total beta-galactosidase was 16.3x10(6) U l(-1) h(-1), which was approximately seven times higher than that in the single-copy lysogenic stage. The recombinant cells were stable in the lysogenic state for more than 260 h, while they were stable for 40 h in the lytic state. The instability that developed rapidly in the second tank is believed to be due to the accumulation of lysis proteins as a result of vector leakage during the operation.

  4. Equitable Access to Healthcare Services and Income Replacement for Cancer: Is Critical Illness Insurance a Help or a Hindrance?

    PubMed Central

    Longo, Christopher J.

    2010-01-01

    Canada's publicly funded healthcare system ensures that medically necessary hospital and physician services are available without financial barriers, but not all community-based care is covered. Consequently, many patients experience financial shocks (FS) related to community-based healthcare services not funded by government, and perhaps also from lost income, a situation that may be difficult for patients to avoid. Critical illness insurance (CII) offers a patient-funded alternative to those who qualify and desire protection against FS, leaving those without CII exposed. The author discusses the benefits and limitations of CII to mitigate financially derived healthcare access inequities, using cancer as an example. PMID:21532761

  5. Significant Differences in Physicochemical Properties of Human Immunoglobulin Kappa and Lambda CDR3 Regions.

    PubMed

    Townsend, Catherine L; Laffy, Julie M J; Wu, Yu-Chang Bryan; Silva O'Hare, Joselli; Martin, Victoria; Kipling, David; Fraternali, Franca; Dunn-Walters, Deborah K

    2016-01-01

    Antibody variable regions are composed of a heavy and a light chain, and in humans, there are two light chain isotypes: kappa and lambda. Despite their importance in receptor editing, the light chain is often overlooked in the antibody literature, with the focus being on the heavy chain complementarity-determining region (CDR)-H3 region. In this paper, we set out to investigate the physicochemical and structural differences between human kappa and lambda light chain CDR regions. We constructed a dataset containing over 29,000 light chain variable region sequences from IgM-transcribing, newly formed B cells isolated from human bone marrow and peripheral blood. We also used a published human naïve dataset to investigate the CDR-H3 properties of heavy chains paired with kappa and lambda light chains and probed the Protein Data Bank to investigate the structural differences between kappa and lambda antibody CDR regions. We found that kappa and lambda light chains have very different CDR physicochemical and structural properties, whereas the heavy chains with which they are paired do not differ significantly. We also observed that the mean CDR3 N nucleotide addition in the kappa, lambda, and heavy chain gene rearrangements are correlated within donors but can differ between donors. This indicates that terminal deoxynucleotidyl transferase may work with differing efficiencies between different people but the same efficiency in the different classes of immunoglobulin chain within one person. We have observed large differences in the physicochemical and structural properties of kappa and lambda light chain CDR regions. This may reflect different roles in the humoral immune response.

  6. Significant Differences in Physicochemical Properties of Human Immunoglobulin Kappa and Lambda CDR3 Regions

    PubMed Central

    Townsend, Catherine L.; Laffy, Julie M. J.; Wu, Yu-Chang Bryan; Silva O’Hare, Joselli; Martin, Victoria; Kipling, David; Fraternali, Franca; Dunn-Walters, Deborah K.

    2016-01-01

    Antibody variable regions are composed of a heavy and a light chain, and in humans, there are two light chain isotypes: kappa and lambda. Despite their importance in receptor editing, the light chain is often overlooked in the antibody literature, with the focus being on the heavy chain complementarity-determining region (CDR)-H3 region. In this paper, we set out to investigate the physicochemical and structural differences between human kappa and lambda light chain CDR regions. We constructed a dataset containing over 29,000 light chain variable region sequences from IgM-transcribing, newly formed B cells isolated from human bone marrow and peripheral blood. We also used a published human naïve dataset to investigate the CDR-H3 properties of heavy chains paired with kappa and lambda light chains and probed the Protein Data Bank to investigate the structural differences between kappa and lambda antibody CDR regions. We found that kappa and lambda light chains have very different CDR physicochemical and structural properties, whereas the heavy chains with which they are paired do not differ significantly. We also observed that the mean CDR3 N nucleotide addition in the kappa, lambda, and heavy chain gene rearrangements are correlated within donors but can differ between donors. This indicates that terminal deoxynucleotidyl transferase may work with differing efficiencies between different people but the same efficiency in the different classes of immunoglobulin chain within one person. We have observed large differences in the physicochemical and structural properties of kappa and lambda light chain CDR regions. This may reflect different roles in the humoral immune response. PMID:27729912

  7. 46 CFR 193.50-10 - Location.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    .... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

  8. 46 CFR 193.50-10 - Location.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    .... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

  9. 46 CFR 193.50-10 - Location.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    .... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

  10. 46 CFR 193.50-10 - Location.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    .... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

  11. 46 CFR 193.50-10 - Location.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    .... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

  12. Evaluating Computer Integration in the Elementary School: A Step-by-Step Guide.

    ERIC Educational Resources Information Center

    Mowe, Richard

    This handbook was written to enable elementary school educators to conduct formative evaluations of their computer integrated instruction (CII) programs in minimum time. CII is defined as the use of computer software, such as word processing, database, and graphics programs, to help students solve problems or work more productively. The first…

  13. Far-infrared line emission from the galaxy. Ph.D. Thesis

    NASA Technical Reports Server (NTRS)

    Stacey, G. J.

    1985-01-01

    The diffuse 157.74 micron (CII) emission from the Galaxy was sampled at several galactic longitudes near the galactic plane including complete scan across the plane at (II) = 2.16 deg and (II) = 7.28 deg. The observed (CII) emission profiles follow closely the nearby (12)CO (J=1to0) emission profiles. The (CII) emission probably arises in neutral photodissociation regions near the edges of giant moleclar clouds (GMC's). These regions have densities of approximately 350 cm(-3) and temperatures of approximately 300 K, and amount to 4x10(8) solar mass of hydrogen in the inner Galaxy. The total 157.74 micron luminosity of the Galaxy is estimated to be 6x10(7) solar luminosity. Estimates were also made of the galactic emission in other far-infrared (FIR) cooling lines. The (CII) line was found to be the dominant FIR emission line from the galaxy and the primary coolant for the warm neutral gas near the galactic plane. Other cooling lines predicted to be prominent in the galactic spectrum are discussed. The 145.53 micron (OI) emission line from the Orion nebula was also measured.

  14. Ordered shotgun sequencing of a 135 kb Xq25 YAC containing ANT2 and four possible genes, including three confirmed by EST matches.

    PubMed Central

    Chen, C N; Su, Y; Baybayan, P; Siruno, A; Nagaraja, R; Mazzarella, R; Schlessinger, D; Chen, E

    1996-01-01

    Ordered shotgun sequencing (OSS) has been successfully carried out with an Xq25 YAC substrate. yWXD703 DNA was subcloned into lambda phage and sequences of insert ends of the lambda subclones were used to generate a map to select a minimum tiling path of clones to be completely sequenced. The sequence of 135 038 nt contains the entire ANT2 cDNA as well as four other candidates suggested by computer-assisted analyses. One of the putative genes is homologous to a gene implicated in Graves' disease and it, ANT2 and two others are confirmed by EST matches. The results suggest that OSS can be applied to YACs in accord with earlier simulations and further indicate that the sequence of the YAC accurately reflects the sequence of uncloned human DNA. PMID:8918809

  15. Sequences of heavy and light chain variable regions from four bovine immunoglobulins.

    PubMed

    Armour, K L; Tempest, P R; Fawcett, P H; Fernie, M L; King, S I; White, P; Taylor, G; Harris, W J

    1994-12-01

    Oligodeoxyribonucleotide primers based on the 5' ends of bovine IgG1/2 and lambda constant (C) region genes, together with primers encoding conserved amino acids at the N-terminus of mature variable (V) regions from other species, have been used in cDNA and polymerase chain reactions (PCRs) to amplify heavy and light chain V region cDNA from bovine heterohybridomas. The amino acid sequences of VH and V lambda from four bovine immunoglobulins of different specificities are presented.

  16. Targeting of viral interleukin-10 with an antibody fragment specific to damaged arthritic cartilage improves its therapeutic potency

    PubMed Central

    2014-01-01

    Introduction We previously demonstrated that a single-chain fragment variable (scFv) specific to collagen type II (CII) posttranslationally modified by reactive oxygen species (ROS) can be used to target anti-inflammatory therapeutics specifically to inflamed arthritic joints. The objective of the present study was to demonstrate the superior efficacy of anti-inflammatory cytokines when targeted to inflamed arthritic joints by the anti-ROS modified CII (anti-ROS-CII) scFv in a mouse model of arthritis. Methods Viral interleukin-10 (vIL-10) was fused to anti-ROS-CII scFv (1-11E) with a matrix-metalloproteinase (MMP) cleavable linker to create 1-11E/vIL-10 fusion. Binding of 1-11E/vIL-10 to ROS-CII was determined by enzyme-linked immunosorbent assay (ELISA), Western blotting, and immune-staining of arthritic cartilage, whereas vIL-10 bioactivity was evaluated in vitro by using an MC-9 cell-proliferation assay. Specific in vivo localization and therapeutic efficacy of 1-11E/vIL-10 was tested in the mouse model of antigen-induced arthritis. Results 1-11E/vIL-10 bound specifically to ROS-CII and to damaged arthritic cartilage. Interestingly, the in vitro vIL-10 activity in the fusion protein was observed only after cleavage with MMP-1. When systemically administered to arthritic mice, 1-11E/vIL-10 localized specifically to the arthritic knee, with peak accumulation observed after 3 days. Moreover, 1-11E/vIL-10 reduced inflammation significantly quicker than vIL-10 fused to the control anti-hen egg lysozyme scFv (C7/vIL10). Conclusions Targeted delivery of anti-inflammatory cytokines potentiates their anti-arthritic action in a mouse model of arthritis. Our results further support the hypothesis that targeting biotherapeutics to arthritic joints may be extended to include anti-inflammatory cytokines that lack efficacy when administered systemically. PMID:25029910

  17. Comparative Analysis of the Lambda-Interferons IL-28A and IL-29 regarding Their Transcriptome and Their Antiviral Properties against Hepatitis C Virus

    PubMed Central

    Diegelmann, Julia; Beigel, Florian; Zitzmann, Kathrin; Kaul, Artur; Göke, Burkhard; Auernhammer, Christoph J.; Bartenschlager, Ralf; Diepolder, Helmut M.; Brand, Stephan

    2010-01-01

    Background Specific differences in signaling and antiviral properties between the different Lambda-interferons, a novel group of interferons composed of IL-28A, IL-28B and IL-29, are currently unknown. This is the first study comparatively investigating the transcriptome and the antiviral properties of the Lambda-interferons IL-28A and IL-29. Methodology/Principal Findings Expression studies were performed by microarray analysis, quantitative PCR (qPCR), reporter gene assays and immunoluminometric assays. Signaling was analyzed by Western blot. HCV replication was measured in Huh-7 cells expressing subgenomic HCV replicon. All hepatic cell lines investigated as well as primary hepatocytes expressed both IFN-λ receptor subunits IL-10R2 and IFN-λR1. Both, IL-28A and IL-29 activated STAT1 signaling. As revealed by microarray analysis, similar genes were induced by both cytokines in Huh-7 cells (IL-28A: 117 genes; IL-29: 111 genes), many of them playing a role in antiviral immunity. However, only IL-28A was able to significantly down-regulate gene expression (n = 272 down-regulated genes). Both cytokines significantly decreased HCV replication in Huh-7 cells. In comparison to liver biopsies of patients with non-viral liver disease, liver biopsies of patients with HCV showed significantly increased mRNA expression of IL-28A and IL-29. Moreover, IL-28A serum protein levels were elevated in HCV patients. In a murine model of viral hepatitis, IL-28 expression was significantly increased. Conclusions/Significance IL-28A and IL-29 are up-regulated in HCV patients and are similarly effective in inducing antiviral genes and inhibiting HCV replication. In contrast to IL-29, IL-28A is a potent gene repressor. Both IFN-λs may have therapeutic potential in the treatment of chronic HCV. PMID:21170333

  18. C+/CO Transitions in the Diffuse ISM: Transitional Cloud Sample from the GOT C+ Survey of [CII] in the inner Galaxy at l = -30deg to 30deg

    NASA Astrophysics Data System (ADS)

    Velusamy, T.; Pineda, J. L.; Langer, W. D.; Willacy, K.; Goldsmith, P. F.

    2011-05-01

    Our knowledge of interstellar gas has been limited primarily to the diffuse atomic phase traced by HI and the well-shielded molecular phase traced by CO. Recently, using the first results of the Herschel Key Project GOT C+, a HIFI C+ survey of the Galactic plane, Velusamy, Langer, Pineda et al. (A&A 521, L18, 2010) have shown that in the diffuse interstellar transition clouds a significant fraction of the carbon exists primarily as C^+ with little C^0 and CO in a warm 'dark gas' layer in which hydrogen is mostly H_2 with little atomic H, surrounding a modest 12CO-emitting core. The [CII] fine structure transition, at 1.9 THz (158 μm) is the best tracer of this component of the interstellar medium, which is critical to our understanding of the atomic to molecular cloud transitions. The Herschel Key Project GOT C+ is designed to study such clouds by observing with HIFI the [CII] line emission along 500 lines of sight (LOSs) throughout the Galactic disk. Here we present the identification and chemical status of a few hundred diffuse and transition clouds traced by [CII], along with auxiliary HI and CO data covering ~100 LOSs in the inner Galaxy between l= -30° and 30°. We identify transition clouds as [CII] components that are characterized by the presence of both HI and 12CO, but no 13CO emission. The intensities, I(CII) and I(HI), are used as measures of the visual extinction, AV, in the cloud up to the C^+/C^0/CO transition layer and a comparison with I(12CO) yields a more complete H_2 molecular inventory. Our results show that [CII] emission is an excellent tool to study transition clouds and their carbon chemistry in the ISM, in particular as a unique tracer of molecular H_2, which is not easily observed by other means. The large sample presented here will serve as a resource to study the chemical and physical status of diffuse transition clouds in a wide range of Galactic environments and constrain the physical parameters such as the FUV intensity and cosmic ray ionization rate that drive the CO chemistry in the diffuse ISM.

  19. Organization and sequence of four flagellin-encoding genes of Edwardsiella icataluri

    USDA-ARS?s Scientific Manuscript database

    Edwardsiella ictaluri, the cause of enteric septicemia in channel catfish (Ictalurus punctatus), is motile by means of peritrichous flagella. We determined the complete flagellin gene sequences and their organization in E. ictaluri by sequencing genomic segments selected from a lambda-ZAP phage gen...

  20. Phenotyping polyclonal kappa and lambda light chain molecular mass distributions in patient serum using mass spectrometry.

    PubMed

    Barnidge, David R; Dasari, Surendra; Ramirez-Alvarado, Marina; Fontan, Adrian; Willrich, Maria A V; Tschumper, Renee C; Jelinek, Diane F; Snyder, Melissa R; Dispenzieri, Angela; Katzmann, Jerry A; Murray, David L

    2014-11-07

    We previously described a microLC-ESI-Q-TOF MS method for identifying monoclonal immunoglobulins in serum and then tracking them over time using their accurate molecular mass. Here we demonstrate how the same methodology can be used to identify and characterize polyclonal immunoglobulins in serum. We establish that two molecular mass distributions observed by microLC-ESI-Q-TOF MS are from polyclonal kappa and lambda light chains using a combination of theoretical molecular masses from gene sequence data and the analysis of commercially available purified polyclonal IgG kappa and IgG lambda from normal human serum. A linear regression comparison of kappa/lambda ratios for 74 serum samples (25 hypergammaglobulinemia, 24 hypogammaglobulinemia, 25 normal) determined by microflowLC-ESI-Q-TOF MS and immunonephelometry had a slope of 1.37 and a correlation coefficient of 0.639. In addition to providing kappa/lambda ratios, the same microLC-ESI-Q-TOF MS analysis can determine the molecular mass for oligoclonal light chains observed above the polyclonal background in patient samples. In 2 patients with immune disorders and hypergammaglobulinemia, we observed a skewed polyclonal molecular mass distribution which translated into biased kappa/lambda ratios. Mass spectrometry provides a rapid and simple way to combine the polyclonal kappa/lambda light chain abundance ratios with the identification of dominant monoclonal as well as oligoclonal light chain immunoglobulins. We anticipate that this approach to evaluating immunoglobulin light chains will lead to improved understanding of immune deficiencies, autoimmune diseases, and antibody responses.

  1. Discovery of a protein phosphatase activity encoded in the genome of bacteriophage lambda. Probable identity with open reading frame 221.

    PubMed

    Cohen, P T; Cohen, P

    1989-06-15

    Infection of Escherichia coli with phage lambda gt10 resulted in the appearance of a protein phosphatase with activity towards 32P-labelled casein. Activity reached a maximum near the point of cell lysis and declined thereafter. The phosphatase was stimulated 30-fold by Mn2+, while Mg2+ and Ca2+ were much less effective. Activity was unaffected by inhibitors 1 and 2, okadaic acid, calmodulin and trifluoperazine, distinguishing it from the major serine/threonine-specific protein phosphatases of eukaryotic cells. The lambda phosphatase was also capable of dephosphorylating other substrates in the presence of Mn2+, although activity towards 32P-labelled phosphorylase was 10-fold lower, and activity towards phosphorylase kinase and glycogen synthase 25 50-fold lower than with casein. No casein phosphatase activity was present in either uninfected cells, or in E. coli infected with phage lambda gt11. Since lambda gt11 lacks part of the open reading frame (orf) 221, previously shown to encode a protein with sequence similarity to protein phosphatase-1 and protein phosphatase-2A of mammalian cells [Cohen, Collins, Coulson, Berndt & da Cruz e Silva (1988) Gene 69, 131-134], the results indicate that ORF221 is the protein phosphatase detected in cells infected with lambda gt10. Comparison of the sequence of ORF221 with other mammalian protein phosphatases defines three highly conserved regions which are likely to be essential for function. The first of these is deleted in lambda gt11.

  2. MX, A DRINKING WATER CARCINOGEN, DOES NOT INDUCE MUTATIONS IN THE LIVER OF CII TRANSGENIC MEDAKA

    EPA Science Inventory

    MX, a drinking water carcinogen, does not induce mutations in the liver of cII transgenic medaka
    Geter, DR; Winn, RN; Fournie, JW; Norris, MB; DeAngelo, AB; and Hawkins, WE

    Abstract

    Geter et al., page 2
    Abstract
    "Salmonella" mutagenicity assays have shown t...

  3. General transfer matrix formalism to calculate DNA-protein-drug binding in gene regulation: application to OR operator of phage lambda.

    PubMed

    Teif, Vladimir B

    2007-01-01

    The transfer matrix methodology is proposed as a systematic tool for the statistical-mechanical description of DNA-protein-drug binding involved in gene regulation. We show that a genetic system of several cis-regulatory modules is calculable using this method, considering explicitly the site-overlapping, competitive, cooperative binding of regulatory proteins, their multilayer assembly and DNA looping. In the methodological section, the matrix models are solved for the basic types of short- and long-range interactions between DNA-bound proteins, drugs and nucleosomes. We apply the matrix method to gene regulation at the O(R) operator of phage lambda. The transfer matrix formalism allowed the description of the lambda-switch at a single-nucleotide resolution, taking into account the effects of a range of inter-protein distances. Our calculations confirm previously established roles of the contact CI-Cro-RNAP interactions. Concerning long-range interactions, we show that while the DNA loop between the O(R) and O(L) operators is important at the lysogenic CI concentrations, the interference between the adjacent promoters P(R) and P(RM) becomes more important at small CI concentrations. A large change in the expression pattern may arise in this regime due to anticooperative interactions between DNA-bound RNA polymerases. The applicability of the matrix method to more complex systems is discussed.

  4. Seven gene deletions in seven days: Fast generation of Escherichia coli strains tolerant to acetate and osmotic stress

    PubMed Central

    Jensen, Sheila I.; Lennen, Rebecca M.; Herrgård, Markus J.; Nielsen, Alex T.

    2015-01-01

    Generation of multiple genomic alterations is currently a time consuming process. Here, a method was established that enables highly efficient and simultaneous deletion of multiple genes in Escherichia coli. A temperature sensitive plasmid containing arabinose inducible lambda Red recombineering genes and a rhamnose inducible flippase recombinase was constructed to facilitate fast marker-free deletions. To further speed up the procedure, we integrated the arabinose inducible lambda Red recombineering genes and the rhamnose inducible FLP into the genome of E. coli K-12 MG1655. This system enables growth at 37 °C, thereby facilitating removal of integrated antibiotic cassettes and deletion of additional genes in the same day. Phosphorothioated primers were demonstrated to enable simultaneous deletions during one round of electroporation. Utilizing these methods, we constructed strains in which four to seven genes were deleted in E. coli W and E. coli K-12. The growth rate of an E. coli K-12 quintuple deletion strain was significantly improved in the presence of high concentrations of acetate and NaCl. In conclusion, we have generated a method that enables efficient and simultaneous deletion of multiple genes in several E. coli variants. The method enables deletion of up to seven genes in as little as seven days. PMID:26643270

  5. iMARS--mutation analysis reporting software: an analysis of spontaneous cII mutation spectra.

    PubMed

    Morgan, Claire; Lewis, Paul D

    2006-01-31

    The sensitivity of any mutational assay is determined by the level at which spontaneous mutations occur in the corresponding untreated controls. Establishing the type and frequency at which mutations occur naturally within a test system is essential if one is to draw scientifically sound conclusions regarding chemically induced mutations. Currently, mutation-spectra analysis is laborious and time-consuming. Thus, we have developed iMARS, a comprehensive mutation-spectrum analysis package that utilises routinely used methodologies and visualisation tools. To demonstrate the use and capabilities of iMARS, we have analysed the distribution, types and sequence context of spontaneous base substitutions derived from the cII gene mutation assay in transgenic animals. Analysis of spontaneous mutation spectra revealed variation both within and between the transgenic rodent test systems Big Blue Mouse, MutaMouse and Big Blue Rat. The most common spontaneous base substitutions were G:C-->A:T transitions and G:C-->T:A transversions. All Big Blue Mouse spectra were significantly different from each other by distribution and nearly all by mutation type, whereas the converse was true for the other test systems. Twenty-eight mutation hotspots were observed across all spectra generally occurring in CG, GA/TC, GG and GC dinucleotides. A mutation hotspot at nucleotide 212 occurred at a higher frequency in MutaMouse and Big Blue Rat. In addition, CG dinucleotides were the most mutable in all spectra except two Big Blue Mouse spectra. Thus, spontaneous base-substitution spectra showed more variation in distribution, type and sequence context in Big Blue Mouse relative to spectra derived from MutaMouse and Big Blue Rat. The results of our analysis provide a baseline reference for mutation studies utilising the cII gene in transgenic rodent models. The potential differences in spontaneous base-substitution spectra should be considered when making comparisons between these test systems. The ease at which iMARS has allowed us to carry out an exhaustive investigation to assess mutation distribution, mutation type, strand bias, target sequences and motifs, as well as predict mutation hotspots provides us with a valuable tool in helping to distinguish true chemically induced hotspots from background mutations and gives a true reflection of mutation frequency.

  6. Role of the RNA polymerase α subunits in CII-dependent activation of the bacteriophage λ pE promoter: identification of important residues and positioning of the α C-terminal domains

    PubMed Central

    Kedzierska, Barbara; Lee, David J.; Węgrzyn, Grzegorz; Busby, Stephen J. W.; Thomas, Mark S.

    2004-01-01

    The bacteriophage λ CII protein stimulates the activity of three phage promoters, pE, pI and paQ, upon binding to a site overlapping the –35 element at each promoter. Here we used preparations of RNA polymerase carrying a DNA cleavage reagent attached to specific residues in the C-terminal domain of the RNA polymerase α subunit (αCTD) to demonstrate that one αCTD binds near position –41 at pE, whilst the other αCTD binds further upstream. The αCTD bound near position –41 is oriented such that its 261 determinant is in close proximity to σ70. The location of αCTD in CII-dependent complexes at the pE promoter is very similar to that found at many activator-independent promoters, and represents an alternative configuration for αCTD at promoters where activators bind sites overlapping the –35 region. We also used an in vivo alanine scan analysis to show that the DNA-binding determinant of αCTD is involved in stimulation of the pE promoter by CII, and this was confirmed by in vitro transcription assays. We also show that whereas the K271E substitution in αCTD results in a drastic decrease in CII-dependent activation of pE, the pI and paQ promoters are less sensitive to this substitution, suggesting that the role of αCTD at the three lysogenic promoters may be different. PMID:14762211

  7. Employing Replay Connectors for SIEM Operator Education

    DTIC Science & Technology

    2013-09-01

    BLANK xiii LIST OF ACRONYMS AND ABBREVIATIONS CORR Correlation Optimized Retention and Retrieval CII Critical Information Infrastructure GLBA...vast distances is now quicker and easier with the advancement in mobile computing devices and more ubiquitous connectivity and bandwidth. As a result...breakdown of the Critical Information Infrastructure (CII) is one of the core risks facing the international economy. The World Economic Forum

  8. Herschel Observations of C+ in the Vicinity of Star Forming Complexes in the Galactic Plane

    NASA Astrophysics Data System (ADS)

    Pineda, Jorge; Velusamy, T.; Langer, W.; Goldsmith, P.; Li, D.; Yorke, H.

    2010-05-01

    The CII fine-structure line at 158 um, is an excellent tracer of the warm diffuse gas and the hot, dense Photon Dominated Regions (PDRs). We can, therefore, use the CII emission as a probe to understand the effects of star formation on their interstellar environment. Here we present the first results from the Galactic Observations of Terahertz C+ (GOT C+), a Herschel Key Project study of CII fine structure emission in the vicinity of star forming complexes. In the Priority Science Phase of HIFI observations, the GOT C+ project collects data along a dozen lines of sight passing near star forming regions in the inner Galaxy from longitude 310 degrees to 25 degrees. We discuss our first results on the transition between dense and hot gas (traced by CII) and dense and cold gas (traced by 12CO and 13CO). This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration. JLP was supported under the NASA Postdoctoral Program at JPL, Caltech, administered by Oak Ridge Associated Universities through a contract with NASA, and is currently supported as a Caltech-JPL Postdoc.

  9. A single amino acid substitution in the variable region of the light chain specifically blocks immunoglobulin secretion.

    PubMed Central

    Dul, J L; Argon, Y

    1990-01-01

    Although immunoglobulin light chains are usually secreted in association with heavy chains, free light chains can be secreted by lymphocytes. To identify the structural features of light chains that are essential for their secretion, we mutated a conserved sequence in the variable domain of a lambda I light chain. The effects of the mutations on secretion were assayed by transient expression in COS-1 cells. One mutant (AV60), which replaced Ala-60 with Val, was secreted as efficiently as wild-type lambda I by transfected COS-1 cells. This result was not surprising because secreted lambda II chains contain valine in this position. However, a second lambda I mutant (AV60FS62), which replaced Phe-62 with Ser as well as Ala-60 with Val, was not secreted. This mutant was arrested in the endoplasmic reticulum, as judged by immunofluorescence and by its association with a lumenal endoplasmic reticulum protein, immunoglobulin heavy chain binding protein (BiP). The defect in secretion was not due to gross misfolding of the lambda I chain, since cells cotransfected with AV60FS62 and an immunoglobulin heavy chain gene produced functional antigen-binding antibodies. These assembled IgM molecules were still not secreted. Hence, the replacement of Phe-62 with Ser specifically affects a determinant on the lambda I light chain that is necessary for the intracellular transport of this molecule. Images PMID:2122454

  10. Enhanced expression of cro-beta-galactosidase fusion proteins under the control of the PR promoter of bacteriophage lambda.

    PubMed Central

    Zabeau, M; Stanley, K K

    1982-01-01

    Hybrid plasmids carrying cro-lacZ gene fusions have been constructed by joining DNA segments carrying the PR promoter and the start of the cro gene of bacteriophage lambda to the lacZ gene fragment carried by plasmid pLG400 . Plasmids in which the translational reading frames of the cro and lacZ genes are joined in-register (type I) direct the synthesis of elevated levels of cro-beta-galactosidase fusion protein amounting to 30% of the total cellular protein, while plasmids in which the genes are fused out-of-register (type II) produce a low level of beta-galactosidase protein. Sequence rearrangements downstream of the cro initiator AUG were found to influence the efficiency of translation, and have been correlated with alterations in the RNA secondary structure of the ribosome-binding site. Plasmids which direct the synthesis of high levels of beta-galactosidase are conditionally lethal and can only be propagated when the PR promoter is repressed. Deletion of sequences downstream of the lacZ gene restored viability, indicating that this region of the plasmid encodes a function which inhibits the growth of the cells. The different applications of these plasmids for expression of cloned genes are discussed. Images Fig. 6. PMID:6327257

  11. Family values in the age of genomics: comparative analyses of temperate bacteriophage HK022.

    PubMed

    Weisberg, R A; Gottesmann, M E; Hendrix, R W; Little, J W

    1999-01-01

    HK022 is a temperate coliphage related to phage lambda. Its chromosome has been completely sequenced, and several aspects of its life cycle have been intensively studied. In the overall arrangement, expression, and function of most of its genes, HK022 broadly resembles lambda and other members of the lambda family. Upon closer view, significant differences emerge. The differences reveal alternative strategies used by related phages to cope with similar problems and illuminate previously unknown regulatory and structural motifs. HK022 prophages protect lysogens from superinfection by producing a sequence-specific RNA binding protein that prematurely terminates nascent transcripts of infecting phage. It uses a novel RNA-based mechanism to antiterminate its own early transcription. The HK022 protein shell is strengthened by a complex pattern of covalent subunit interlinking to form a unitary structure that resembles chain-mail armour. Its integrase and repressor proteins are similar to those of lambda, but the differences provide insights into the evolution of biological specificity and the elements needed for construction of a stable genetic switch.

  12. Bacterial genes mutL, mutS, and dcm participate in repair of mismatches at 5-methylcytosine sites.

    PubMed Central

    Lieb, M

    1987-01-01

    Certain amber mutations in the cI gene of bacteriophage lambda appear to recombine very frequently with nearby mutations. The aberrant mutations included C-to-T transitions at the second cytosine in 5'CC(A/T)GG sequences (which are subject to methylation by bacterial cytosine methylase) and in 5'CCAG and 5'CAGG sequences. Excess cI+ recombinants arising in crosses that utilize these mutations are attributable to the correction of mismatches by a bacterial very-short-patch (VSP) mismatch repair system. In the present study I found that two genes required for methyladenine-directed (long-patch) mismatch repair, mutL and mutS, also functioned in VSP mismatch repair; mutH and mutU (uvrD) were dispensable. VSP mismatch repair was greatly reduced in a dcm Escherichia coli mutant, in which 5-methylcytosine was not methylated. However, mismatches in heteroduplexes prepared from lambda DNA lacking 5-methylcytosine were repaired in dcm+ bacteria. These results indicate that the product of gene dcm has a repair function in addition to its methylase activity. PMID:2959653

  13. METSAT information content: Cloud screening and solar correction investigations on the influence of NOAA-6 advanced very high resolution radiometer derived vegetation assessment

    NASA Technical Reports Server (NTRS)

    Mathews, M. L.

    1983-01-01

    The development of the cloud indicator index (CII) for use with METSAT's advanced very high resolution radiometer (AVHRR) is described. The CII is very effective at identification of clouds. Also, explored are different solar correction and standard techniques and the impact of these corrections have on the information content of AVHRR data.

  14. Amyloid fibril proteins and amyloidosis: chemical identification and clinical classification International Society of Amyloidosis 2016 Nomenclature Guidelines.

    PubMed

    Sipe, Jean D; Benson, Merrill D; Buxbaum, Joel N; Ikeda, Shu-Ichi; Merlini, Giampaolo; Saraiva, Maria J M; Westermark, Per

    2016-12-01

    The Nomenclature Committee of the International Society of Amyloidosis (ISA) met during the XVth Symposium of the Society, 3 July-7 July 2016, Uppsala, Sweden, to assess and formulate recommendations for nomenclature for amyloid fibril proteins and the clinical classification of the amyloidoses. An amyloid fibril must exhibit affinity for Congo red and with green, yellow or orange birefringence when the Congo red-stained deposits are viewed with polarized light. While congophilia and birefringence remain the gold standard for demonstration of amyloid deposits, new staining and imaging techniques are proving useful. To be included in the nomenclature list, in addition to congophilia and birefringence, the chemical identity of the protein must be unambiguously characterized by protein sequence analysis when possible. In general, it is insufficient to identify a mutation in the gene of a candidate amyloid protein without confirming the variant changes in the amyloid fibril protein. Each distinct form of amyloidosis is uniquely characterized by the chemical identity of the amyloid fibril protein that deposits in the extracellular spaces of tissues and organs and gives rise to the disease syndrome. The fibril proteins are designated as protein A followed by a suffix that is an abbreviation of the parent or precursor protein name. To date, there are 36 known extracellular fibril proteins in humans, 2 of which are iatrogenic in nature and 9 of which have also been identified in animals. Two newly recognized fibril proteins, AApoCII derived from apolipoprotein CII and AApoCIII derived from apolipoprotein CIII, have been added. AApoCII amyloidosis and AApoCIII amyloidosis are hereditary systemic amyloidoses. Intracellular protein inclusions displaying some of the properties of amyloid, "intracellular amyloid" have been reported. Two proteins which were previously characterized as intracellular inclusions, tau and α-synuclein, are now recognized to form extracellular deposits upon cell death and thus have been included in Table 1 as ATau and AαSyn.

  15. Human Anti-V3 HIV-1 Monoclonal Antibodies Encoded by the VH5-51/VL Lambda Genes Define a Conserved Antigenic Structure

    PubMed Central

    Gorny, Miroslaw K.; Sampson, Jared; Li, Huiguang; Jiang, Xunqing; Totrov, Maxim; Wang, Xiao-Hong; Williams, Constance; O'Neal, Timothy; Volsky, Barbara; Li, Liuzhe; Cardozo, Timothy; Nyambi, Phillipe; Zolla-Pazner, Susan; Kong, Xiang-Peng

    2011-01-01

    Preferential usage of immunoglobulin (Ig) genes that encode antibodies (Abs) against various pathogens is rarely observed and the nature of their dominance is unclear in the context of stochastic recombination of Ig genes. The hypothesis that restricted usage of Ig genes predetermines the antibody specificity was tested in this study of 18 human anti-V3 monoclonal Abs (mAbs) generated from unrelated individuals infected with various subtypes of HIV-1, all of which preferentially used pairing of the VH5-51 and VL lambda genes. Crystallographic analysis of five VH5-51/VL lambda-encoded Fabs complexed with various V3 peptides revealed a common three dimensional (3D) shape of the antigen-binding sites primarily determined by the four complementarity determining regions (CDR) for the heavy (H) and light (L) chains: specifically, the H1, H2, L1 and L2 domains. The CDR H3 domain did not contribute to the shape of the binding pocket, as it had different lengths, sequences and conformations for each mAb. The same shape of the binding site was further confirmed by the identical backbone conformation exhibited by V3 peptides in complex with Fabs which fully adapted to the binding pocket and the same key contact residues, mainly germline-encoded in the heavy and light chains of five Fabs. Finally, the VH5-51 anti-V3 mAbs recognized an epitope with an identical 3D structure which is mimicked by a single mimotope recognized by the majority of VH5-51-derived mAbs but not by other V3 mAbs. These data suggest that the identification of preferentially used Ig genes by neutralizing mAbs may define conserved epitopes in the diverse virus envelopes. This will be useful information for designing vaccine immunogen inducing cross-neutralizing Abs. PMID:22164215

  16. The Probiotic Escherichia coli Strain Nissle 1917 Combats Lambdoid Bacteriophages stx and λ.

    PubMed

    Bury, Susanne; Soundararajan, Manonmani; Bharti, Richa; von Bünau, Rudolf; Förstner, Konrad U; Oelschlaeger, Tobias A

    2018-01-01

    Shiga toxin (Stx) producing E. coli (STEC) such as Enterohemorrhagic E. coli (EHEC) are the major cause of foodborne illness in humans. In vitro studies showed the probiotic Escherichia coli strain Nissle 1917 (EcN) to efficiently inhibit the production of Stx. Life threatening EHEC strains as for example the serotype O104:H4, responsible for the great outbreak in 2011 in Germany, evolutionary developed from certain E. coli strains which got infected by stx2 -encoding lambdoid phages turning the E. coli into lysogenic and subsequently Stx producing strains. Since antibiotics induce stx genes and Stx production, EHEC infected persons are not recommended to be treated with antibiotics. Therefore, EcN might be an alternative medication. However, because even commensal E. coli strains might be converted into Stx-producers after becoming host to a stx encoding prophage, we tested EcN for stx -phage genome integration. Our experiments revealed the resistance of EcN toward not only stx -phages but also against lambda-phages. This resistance was not based on the lack of or by mutated phage receptors. Rather it involved the expression of a phage repressor ( pr ) gene of a defective prophage in EcN which was able to partially protect E. coli K-12 strain MG1655 against stx and lambda phage infection. Furthermore, we observed EcN to inactivate phages and thereby to protect E. coli K-12 strains against infection by stx - as well as lambda-phages. Inactivation of lambda-phages was due to binding of lambda-phages to LamB of EcN whereas inactivation of stx -phages was caused by a thermostable protein of EcN. These properties together with its ability to inhibit Stx production make EcN a good candidate for the prevention of illness caused by EHEC and probably for the treatment of already infected people.

  17. Obesity aggravates the joint inflammation in a collagen-induced arthritis model through deviation to Th17 differentiation

    PubMed Central

    Jhun, Joo-Yeon; Yoon, Bo-Young; Park, Mi-Kyung; Oh, Hye-Joa; Byun, Jae-Kyeong; Lee, Seon-Young; Min, Jun-Ki; Park, Sung-Hwan; Kim, Ho-Youn

    2012-01-01

    White fat cells secrete adipokines that induce inflammation and obesity has been reported to be characterized by high serum levels of inflammatory cytokines such as IL-6 and TNF-α. Rheumatoid arthritis (RA) is a prototype of inflammatory arthritis, but the relationship between RA and obesity is controversial. We made an obese inflammatory arthritis model: obese collagen-induced arthritis (CIA). C57BL/6 mice were fed a 60-kcal high fat diet (HFD) from the age of 4 weeks and they were immunized twice with type II collagen (CII). After immunization, the obese CIA mice showed higher arthritis index scores and histology scores and a more increased incidence of developing arthritis than did the lean CIA mice. After treatment with CII, mixed lymphocyte reaction also showed CII-specific response more intensely in the obese CIA mice than lean CIA. The anti-CII IgG and anti-CII IgG2a levels in the sera of the obese CIA mice were higher than those of the lean CIA mice. The number of Th17 cells was higher and the IL-17 mRNA expression of the splenocytes in the obese CIA mice was higher than that of the lean CIA mice. Obese CIA mice also showed high IL-17 expression on synovium in immunohistochemistry. Although obesity may not play a pathogenic role in initiating arthritis, it could play an important role in amplifying the inflammation of arthritis through the Th1/Th17 response. The obese CIA murine model will be an important tool when we investigate the effect of several therapeutic target molecules to treat RA. PMID:22513335

  18. Mammalian proliferating cell nuclear antigen stimulates the processivity of two wheat embryo DNA polymerases.

    PubMed Central

    Laquel, P; Litvak, S; Castroviejo, M

    1993-01-01

    Multiple DNA polymerases have been described in all organisms studied to date. Their specific functions are not easy to determine, except when powerful genetic and/or biochemical tools are available. However, the processivity of a DNA polymerase could reflect the physiological role of the enzyme. In this study, analogies between plant and animal DNA polymerases have been investigated by analyzing the size of the products synthesized by wheat DNA polymerases A, B, CI, and CII as a measure of their processivity. Thus, incubations have been carried out with poly(dA)-oligo(dT) as a template-primer under varying assay conditions. In the presence of MgCl2, DNA polymerase A was highly processive, whereas DNA polymerases B, CI, and CII synthesized much shorter products. With MnCl2 instead of MgCl2, DNA polymerase A was highly processive, DNA polymerases B and CII were moderately processive, and DNA polymerase CI remained strictly distributive. The effect of calf thymus proliferating cell nuclear antigen (PCNA) on wheat polymerases was studied as described for animal DNA polymerases. The high processivity of DNA polymerase A was PCNA independent, whereas both enzyme activity and processivity of wheat DNA polymerases B and CII were significantly stimulated by PCNA. On the other hand, DNA polymerase CI was not stimulated by PCNA and, like animal DNA polymerase beta, was distributive in all cases. From these results, we propose that wheat DNA polymerase A could correspond to a DNA polymerase alpha, DNA polymerases B and CII could correspond to the delta-like enzyme, and DNA polymerase CI could correspond to DNA polymerase beta. PMID:7906418

  19. Anti-rheumatoid arthritic effects of Saussurea involucrata on type II collagen-induced arthritis in rats.

    PubMed

    Xu, Meihong; Guo, Qianying; Wang, Shuangjia; Wang, Na; Wei, Liren; Wang, Junbo

    2016-02-01

    Saussurea involucrata (SI) has long been used under the herbal name "snow lotus" for treatment of inflammation and pain-related diseases in traditional Chinese medicine. The present study aimed to evaluate the pharmacological effects of SI on collagen II (CII)-induced arthritis in rats. Rats with collagen II (CII)-induced arthritis were orally administered SI (420 mg kg(-1)) for 40 consecutive days. Histopathological examination indicated that SI alleviates infiltration of inflammatory cells and synovial hyperplasia and slows joint destruction. SI intervention reduced the serum levels of RF, COMP, CRP and anti-CII IgG. Results also showed that SI is a potential therapeutic agent for alleviating the severity of the disease based on the reduced arthritic index. It was concluded that SI can ameliorate inflammation and joint destruction in CIA rats.

  20. Cloning and sequence analysis of the human brain beta-adrenergic receptor. Evolutionary relationship to rodent and avian beta-receptors and porcine muscarinic receptors.

    PubMed

    Chung, F Z; Lentes, K U; Gocayne, J; Fitzgerald, M; Robinson, D; Kerlavage, A R; Fraser, C M; Venter, J C

    1987-01-26

    Two cDNA clones, lambda-CLFV-108 and lambda-CLFV-119, encoding for the beta-adrenergic receptor, have been isolated from a human brain stem cDNA library. One human genomic clone, LCV-517 (20 kb), was characterized by restriction mapping and partial sequencing. The human brain beta-receptor consists of 413 amino acids with a calculated Mr of 46480. The gene contains three potential glucocorticoid receptor-binding sites. The beta-receptor expressed in human brain was homology with rodent (88%) and avian (52%) beta-receptors and with porcine muscarinic cholinergic receptors (31%), supporting our proposal [(1984) Proc. Natl. Acad. Sci. USA 81, 272 276] that adrenergic and muscarinic cholinergic receptors are structurally related. This represents the first cloning of a neurotransmitter receptor gene from human brain.

  1. Immature surface Ig+ B cells can continue to rearrange kappa and lambda L chain gene loci

    PubMed Central

    1993-01-01

    Pro and pre B cells possess the long-term capacity to proliferate in vitro on stromal cells and interleukin 7 (IL-7) and can differentiate to surface immunoglobulin (sIg+) cells upon removal of IL-7 from the cultures. A key event in this differentiation is the extensive cell loss due to apoptosis. Because the proto-oncogene bcl-2 can promote cell survival, we established pre-B cell lines from E mu-bcl-2 transgenic mice. These pre-B cells have the same properties as those derived from non-bcl-2 transgenic mice except that they do not die by apoptosis. This allowed us to study the fate of newly formed B cells in vitro for a longer period of time. Here we show that early during the differentiation of pre-B cells, upregulation of RAG-1 and RAG-2 expression go hand in hand with rearrangements of the Ig gene loci. Moreover, the newly formed sIg+ B cells continue to express RAG-1 and RAG-2 and continue to rearrange L chain gene loci, even in the absence of proliferation, in an orderly fashion, so that kappa L+ sIg+ cells can become lambda L+ sIg+ or sIg- cells, whereas lambda L+ sIg+ cells can become sIg-, but not kappa L+ sIg+ cells. Thus, deposition of a complete Ig molecule on the surface of a B cell does not automatically stop the Ig-rearrangement machinery. PMID:8376934

  2. The Tomographic Ionized-Carbon Mapping Experiment (TIME) CII Imaging Spectrometer

    NASA Astrophysics Data System (ADS)

    Staniszewski, Z.; Bock, J. J.; Bradford, C. M.; Brevik, J.; Cooray, A.; Gong, Y.; Hailey-Dunsheath, S.; O'Brient, R.; Santos, M.; Shirokoff, E.; Silva, M.; Zemcov, M.

    2014-09-01

    The Tomographic Ionized-Carbon Mapping Experiment (TIME) and TIME-Pilot are proposed imaging spectrometers to measure reionization and large scale structure at redshifts 5-9. We seek to exploit the 158 restframe emission of [CII], which becomes measurable at 200-300 GHz at reionization redshifts. Here we describe the scientific motivation, give an overview of the proposed instrument, and highlight key technological developments underway to enable these measurements.

  3. A Herschel and CARMA synergistic study of turbulent gas in Hickson Compact Groups

    NASA Astrophysics Data System (ADS)

    Appleton, Philip N.; Alatalo, Katherine A.; Lisenfeld, Ute; Bitsakis, Thodoris; Guillard, Pierre; Charmandaris, Vassilis; Cluver, Michelle; Dopita, Michael A.; Freeland, Emily; Hickson Compact Group Team

    2015-01-01

    We have performed deep PACS and SPIRE imaging, [CII] and [OI] spectroscopy and CARMA CO J= 1-0 imaging of a dozen Hickson Compact Groups (HCGs). The observations attempt to explore the physical conditions of the gas in a subset of galaxies containing large quantities of warm molecular hydrogen based on previous Spitzer IRS observations. The H2 is too powerful to be heated in PDR regions, and is most likely powered by turbulence and shocks. Such galaxies are found to fall in a region of the IR color-color space believed to show galaxies rapidly transitioning from the blue cloud to the red sequence, and so shocks may play a role in quenching star formation. We explore far-IR line luminosities and surface densities for extended diffuse [CII] emission and compare this to similar quanties in the CO emitting gas, and the far-IR continuum. Preliminary results suggest that high [CII]/FIR and [CII]/CO ratios are common in these systems, and in some cases correlate with peculiar velocities in the CO emitting gas. Star formation suppression may be seen in some of the systems with the highest warm H2/PAH ratios found by Spitzer, implying that turbulence may suppress star formation.

  4. Chemical changes demonstrated in cartilage by synchrotron infrared microspectroscopy in an antibody-induced murine model of rheumatoid arthritis

    NASA Astrophysics Data System (ADS)

    Croxford, Allyson M.; Selva Nandakumar, Kutty; Holmdahl, Rikard; Tobin, Mark J.; McNaughton, Don; Rowley, Merrill J.

    2011-06-01

    Collagen antibody-induced arthritis develops in mice following passive transfer of monoclonal antibodies (mAbs) to type II collagen (CII) and is attributed to effects of proinflammatory immune complexes, but transferred mAbs may react directly and damagingly with CII. To determine whether such mAbs cause cartilage damage in vivo in the absence of inflammation, mice lacking complement factor 5 that do not develop joint inflammation were injected intravenously with two arthritogenic mAbs to CII, M2139 and CIIC1. Paws were collected at day 3, decalcified, paraffin embedded, and 5-μm sections were examined using standard histology and synchrotron Fourier-transform infrared microspectroscopy (FTIRM). None of the mice injected with mAb showed visual or histological evidence of inflammation but there were histological changes in the articular cartilage including loss of proteoglycan and altered chondrocyte morphology. Findings using FTIRM at high lateral resolution revealed loss of collagen and the appearance of a new peak at 1635 cm-1 at the surface of the cartilage interpreted as cellular activation. Thus, we demonstrate the utility of synchrotron FTIRM for examining chemical changes in diseased cartilage at the microscopic level and establish that arthritogenic mAbs to CII do cause cartilage damage in vivo in the absence of inflammation.

  5. Blind Spectroscopic Galaxy Surveys Using an Ultra-Wide-Band Imaging Spectrograph on AtLAST and LST

    NASA Astrophysics Data System (ADS)

    Kohno, Kotaro

    2018-01-01

    A novel approach to elucidation of cosmic star formation history is a blind search for CO and [CII] emissions using a ultra-wide-band imaging spectrograph on the future large submm telescopes like AtLAST and LST. In particular, searching for [CII] emitters in the appropriate frequency range allows us to sample those sources very efficiently for a redshift range of 3.5 to 9 (190 to 420 GHz), reaching the star-formation in the EoR. Further, spectroscopic analysis of CO in the lower frequency bands will constrain the evolution of CO luminosity functions across cosmic time. We conducted a feasibility study of ``CO/[CII] tomography'' based on a mock galaxy catalog containing 1.4 million objects drawn from the S(3) -SAX (Obreschkow et al. 2009). We find that a blind spectroscopic survey using a 50-m telescope equipped with a 100-pixel imaging spectrograph, which covers 70-370 GHz simultaneously, will be promising indeed. A survey of 2 deg(2) in 1,000 hr (on-source) will uncover > 10^5 line-emitting galaxies in total, including 10^3 [CII] emitters in the EoR (Tamura et al., in prep.). Wider surveys (10 deg^2 or wider) will also be discussed for RSD science cases.

  6. Lambda light chain revision in the human intestinal IgA response.

    PubMed

    Su, Wen; Gordon, John N; Barone, Francesca; Boursier, Laurent; Turnbull, Wayne; Mendis, Surangi; Dunn-Walters, Deborah K; Spencer, Jo

    2008-07-15

    Revision of Ab L chains by secondary rearrangement in mature B cells has the potential to change the specific target of the immune response. In this study, we show for the first time that L chain revision is normal and widespread in the largest Ab producing population in man: intestinal IgA plasma cells (PC). Biases in the productive and non-productive repertoire of lambda L chains, identification of the circular products of rearrangement that have the characteristic biases of revision, and identification of RAG genes and protein all reflect revision during normal intestinal IgA PC development. We saw no evidence of IgH revision, probably due to inappropriately orientated recombination signal sequences, and little evidence of kappa-chain revision, probably due to locus inactivation by the kappa-deleting element. We propose that the lambda L chain locus is available and a principal modifier and diversifier of Ab specificity in intestinal IgA PCs.

  7. Evidence of translation efficiency adaptation of the coding regions of the bacteriophage lambda.

    PubMed

    Goz, Eli; Mioduser, Oriah; Diament, Alon; Tuller, Tamir

    2017-08-01

    Deciphering the way gene expression regulatory aspects are encoded in viral genomes is a challenging mission with ramifications related to all biomedical disciplines. Here, we aimed to understand how the evolution shapes the bacteriophage lambda genes by performing a high resolution analysis of ribosomal profiling data and gene expression related synonymous/silent information encoded in bacteriophage coding regions.We demonstrated evidence of selection for distinct compositions of synonymous codons in early and late viral genes related to the adaptation of translation efficiency to different bacteriophage developmental stages. Specifically, we showed that evolution of viral coding regions is driven, among others, by selection for codons with higher decoding rates; during the initial/progressive stages of infection the decoding rates in early/late genes were found to be superior to those in late/early genes, respectively. Moreover, we argued that selection for translation efficiency could be partially explained by adaptation to Escherichia coli tRNA pool and the fact that it can change during the bacteriophage life cycle.An analysis of additional aspects related to the expression of viral genes, such as mRNA folding and more complex/longer regulatory signals in the coding regions, is also reported. The reported conclusions are likely to be relevant also to additional viruses. © The Author 2017. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

  8. Experimental arthritis and uveitis in rats associated with Mycobacterium butyricum.

    PubMed

    Petty, R E; Hunt, D W; Mathers, D M; McCormick, A Q; Barker, H; Southwood, T R; Corson, L

    1994-08-01

    To determine if the anterior uveitis associated with adjuvant arthritis (AA) in the rat can be passively transferred with arthritis to syngeneic recipients using spleen cells or T cell lines prepared from animals given complete Freund's adjuvant (CFA) and Mycobacterium butyricum (M. butyricum) in incomplete Freund's adjuvant (IFA). Spleen cells from Lewis or Lewis SsN rats given IFA, CFA, type I collagen in IFA (CI-IFA), or type II collagen in IFA (CII-IFA) were administered to naive rats or rats treated with pertussis toxin or bacterial endotoxin. Three CD4+ T cell lines, propagated from CFA injected rats and maintained in vitro with M. butyricum (M-1), bovine proteoglycan (PR-1) or an extract of M. butyricum (MBE-1) were administered to naive or immunosuppressed rats. The arthritogenic and uveitogenic properties of these cell preparations and intradermal MBE-IFA, CII-IFA and intraperitoneal (ip) M. butyricum without adjuvant were evaluated. Uveitis was observed in 15/69 (22%) arthritic rats given CFA. Spleen cells prepared from CFA injected rats caused arthritis in 55 (82%) and uveitis in 2 (3%) of 67 cell recipients. Uveitis occurred in 2/6 cell recipients pretreated with bacterial endotoxin. Neither uveitis nor arthritis was observed in rats given IFA (0/6) or spleen cells prepared from rats given IFA (0/27), CI-IFA (0/6), or CII-IFA (0/28). CII-IFA produced polyarthritis in 5/6 rats, but no uveitis. CII-IFA induced arthritis associated uveitis in 1/15 animals receiving spleen cells from rats given CII-IFA, but not those given CI-IFA (0/3) or IFA (0/13). Uveitis was observed in one recipient of the M-1 T cell line and in 2 recipients of the PR-1 T cell line. Immunization with 400 micrograms of MBE-IFA induced uveitis but not arthritis in 3/11 animals. The MBE specific T cell line was neither arthritogenic nor uveitogenic. A high frequency (5/6) of uveitis accompanied arthritis in male Lewis rats given ip M. butyricum. Arthritis occurred in 4/10 female Lewis rats given ip M. butyricum and 2 arthritic animals also developed uveitis. Uveitis occurs infrequently in arthritic rats given spleen cells from CFA injected animals. The ip administration of M. butyricum constitutes a novel disease model in which the immunopathological relationships between arthritis and uveitis may be more reliably studied.

  9. [CII] emission from NGC 4258 with SOFIA/FIFI-LS

    NASA Astrophysics Data System (ADS)

    Fadda, Dario; Appleton, Philip N.; Diaz Santos, Tanio; Togi, Aditya; Ogle, Patrick

    2018-06-01

    We present the [CII]157.7μm map of the NGC 4258 (M106) galaxy obtained with the FIFI-LS spectrometer onboard SOFIA.M106 contains an active nucleus classified as type 1.9 Seyfert with a warped inner rotating disk of water-vapor masers which allowed for the first high accuracy measurements of the mass of a supermassive black hole in any galaxy. A relativistic jet is thought to be responsible for anomalous radio-continuum spiral arms, which appear several kpc from the center, and extend outwards through the outer disk. These arms do not correlate with the galaxy's underlying stellar spiral structure, and their presence suggest that in the past, the jet has strongly interacted with the galaxy's outer disk , exciting synchrotron radiation. Since that time, a new burst of activity seems to have occurred, creating a compact jet at the core of the galaxy, and two radio hotspots further out associated with optical "bow-shocks". The position angle of this new "active" jet is different from that needed to excited the outer radio arms, presumably because the jet has precessed, perhaps as a result of precession of the axis of the inner warped accretion disk.Our observations reveal three main sources of [CII] emission: two associated with large regions of gas at the ends of the active jet, and a third minor axis filament associated with linear clumps of star formation and dust seen in HST images offset from the nucleus. We combine the SOFIA observations with previous Spitzer mid-IR, Chandra X-ray and VLA radio observations to explore the nature of the detected [CII] emission. In regions along the northern active jet, we see a significant deficiency in the [CII]/FIR ratio, and higher ratios near the ends of the jet. This implies that the jet has changed the conditions of the gas along its length. In several places near the jet, the [CII] emission shows very broad lines, suggestive of enhanced turbulence. Additionally, the minor-axis filament we discovered may represent gas in-falling towards the nucleus perpendicular to the jet. The results provide clues about how radio jets in active galaxies can influence the star formation properties of their host galaxies.

  10. STARFIRE: The Spectroscopic Terahertz Airborne Receiver for Far-InfraRed Exploration

    NASA Astrophysics Data System (ADS)

    Aguirre, James; STARFIRE Collaboration

    2018-01-01

    Understanding the formation and evolution of galaxies is one of the foremost goals of astrophysics and cosmology today. The cosmic star formation rate has undergone a dramatic evolution over the course of the last seven billion years, with a peak in cosmic star formation near z ~ 1, largely in dust-obscured star forming galaxies (DSFGs), followed by a dramatic fall in both the star formation rate and the fraction of star formation occurring in DSFGs. A variety of unextincted diagnostic lines are present in the far-infrared (FIR) which can provide insight into the conditions of star formation in DSFGs. Spectroscopy in the far-infrared is thus scientifically crucial for understanding galaxy evolution, yet remains technically difficult, particularly for wavelengths shorter than those accessible to ALMA.STARFIRE (the Spectroscopic Terahertz Airborne Receiver for Far-InfraRed Exploration) is a proposed integral-field spectrometer using kinetic inductance detectors, operating from 240 - 420 μm and coupled to a 2.5 meter low-emissivity carbon-fiber balloon-borne telescope. Using dispersive spectroscopy and the stratospheric platform, STARFIRE can achieve better performance than SOFIA or Herschel-SPIRE FTS. STARFIRE is designed to study the ISM of galaxies from 0.5 < z < 1.5, primarily in the [CII](158 μm) line, and also in cross-correlation with [NII] (122 μm). This offers a view of the star-forming medium with minimal impact from dust extinction through the period of peak cosmic star formation and into the current epoch where the star formation rate begins to decline. STARFIRE will be capable of making a high significance detection of the [CII] power spectrum in at least 4 redshift bins and measuring the [CII] x [NII] power spectrum at z ~ 1. The intensity mapped power spectra will be sensitive to one- and two-halo clustering, as well as shot noise, and will relate the mean [CII] intensity as a function of redshift (a proxy for star formation rate density) to the large scale structure. In addition, STARFIRE will detect at least 50 galaxies directly in the [CII] line, and will also be able to stack on optical galaxies to below the SPIRE confusion limit to measure the [CII] luminosity of more typical galaxies.

  11. Identification of polypeptides necessary for chemotaxis in Escherichia coli.

    PubMed Central

    Silverman, M; Simon, M

    1977-01-01

    Molecular cloning techniques were used to construct Escherichia coli-lambda hybrids that contained many of the genes necessary for flagellar rotation and chemotaxis. The properties of specific hybrids that carried the classical "cheA" and "cheB" loci were examined by genetic complementation and by measuring the capacity of the hybrids to direct the synthesis of specific polypeptides. The results of these tests with lambda hybrids and with a series of deletion mutations derived from the hybrids redefined the "cheA" and "cheB" regions. Six genes were resolved: cheA, cheW, cheX, cheB, cheY, and cheZ. They directed the synthesis of specific polypeptides with the following apparent molecular weights: cheA, 76,000 and 66,000; cheW, 12,000; cheX, 28,000; cheB, 38,000; cheY, 8,000; and cheZ, 24,000. The presence of another gene, cheM, was inferred from the protein synthesis experiments. The cheM gene directed the synthesis of polypeptides with apparent molecular weights of 63,000, 61,000, and 60,000. The synthesis of all of these polypeptides is regulated by the same mechanisms that regulate the synthesis of flagellar-related structural components. Images PMID:324984

  12. Dual color microscopic imagery of cells expressing the green fluorescent protein and a red-shifted variant.

    PubMed

    Yang, T T; Kain, S R; Kitts, P; Kondepudi, A; Yang, M M; Youvan, D C

    1996-01-01

    The green fluorescent protein (GFP) from the jellyfish, Aequorea victoria, has become a versatile reporter for monitoring gene expression and protein localization in a variety of cells and organisms. GFP emits bright green light (lambda max = 510 nm) when excited with ultraviolet (UV) or blue light (lambda max = 395 nm, minor peak at 470 nm). The chromophore in GFP is intrinsic to the primary structure of the protein, and fluorescence from GFP does not require additional gene products, substrates or other factors. GFP fluorescence is stable, species-independent and can be monitored noninvasively using the techniques of fluorescence microscopy and flow cytometry [Chalfie et al., Science 263 (1994) 802-805; Stearns, Curr. Biol. 5 (1995) 262-264]. The protein appears to undergo an autocatalytic reaction to create the fluorophore [Heim et al., Proc. Natl. Acad. Sci. USA 91 (1994) 12501-12504] in a process involving cyclization of a Tyr66 aa residue. Recently [Delagrave et al., Bio/Technology 13 (1995) 151-154], a combinatorial mutagenic strategy was targeted at aa 64 through 69, which spans the chromophore of A. victoria GFP, yielding a number of different mutants with red-shifted fluorescence excitation spectra. One of these, RSGFP4, retains the characteristic green emission spectra (lambda max = 505 nm), but has a single excitation peak (lambda max = 490 nm). The fluorescence properties of RSGFP4 are similar to those of another naturally occurring GFP from the sea pansy, Renilla reniformis [Ward and Cormier, Photobiochem. Photobiol. 27 (1978) 389-396]. In the present study, we demonstrate by fluorescence microscopy that selective excitation of A. victoria GFP and RSGFP4 allows for spectral separation of each fluorescent signal, and provides the means to image these signals independently in a mixed population of bacteria or mammalian cells.

  13. Mutations of the phage lambda nutL region that prevent the action of Nun, a site-specific transcription termination factor.

    PubMed Central

    Baron, J; Weisberg, R A

    1992-01-01

    Phage HK022 encodes a protein, Nun, that promotes transcription termination within the pL and pR operons of its relative, phage lambda. The lambda sequences required for termination had previously been shown to overlap the nut sites, which are essential for transcription antitermination during normal lambda growth. To further specify the Nun target and to determine its relation to the nut sites, we constructed deletion and base substitution mutations of the lambda nutL region and measured Nun-dependent reduction of the expression of a downstream reporter gene. The shortest construct that retained full Nun responsiveness was a 42-bp segment that included both boxA and boxB, sequences that have been implicated in lambda antitermination. Deletion of boxA reduced Nun termination, and deletion of both sequences eliminated Nun termination. Base substitutions in boxA and the proximal portion of boxB impaired Nun termination, while base substitutions between boxA and boxB, in the distal portion of boxB, and immediately downstream from boxB had no appreciable effect. The termination defect of all of the base substitution mutations was relieved by increasing the level of Nun protein; in contrast, the deletions and a multiple-base substitution did not regain full Nun responsiveness at elevated Nun concentrations. We also asked if these mutant nut regions retained their ability to interact with N, the lambda-encoded antitermination protein. A qualitative assay showed that mutations within boxA or boxB reduced interaction, while mutations outside boxA and boxB did not. These data show that (i) the recognition sites for N and Nun overlap to a very considerable extent but are probably not identical and (ii) a high concentration of Nun promotes its interaction with mutant nut sites, a behavior also reported to be characteristic of N. PMID:1532174

  14. In situ analysis of lung antigen-presenting cells during murine pulmonary infection with virulent Mycobacterium tuberculosis

    PubMed Central

    Pedroza-González, Alexander; García-Romo, Gina S; Aguilar-León, Diana; Calderon-Amador, Juana; Hurtado-Ortiz, Raquel; Orozco-Estevez, Hector; Lambrecht, Bart N; Estrada-García, Iris; Hernández-Pando, Rogelio; Flores-Romo, Leopoldo

    2004-01-01

    Scarce information exists about the role of lung antigen-presenting cells (APCs) in vivo during pulmonary tuberculosis. As APCs activate cellular immunity, following intratracheal inoculation with virulent Mycobacterium tuberculosis, we assessed in situ lung APC recruitment, distribution, granuloma involvement, morphology and mycobacterial burden by using MHC-CII, CD14, scavenger receptor class A (SRA), the murine dendritic cell (DC)-restricted marker CD11c and Ziehl–Neelsen staining. CD11c+ DC and CD14+ cell recruitment into lungs appeared by day 14, continuing until day 60. MHC-CII+ cells increased since day 7, persisting until day 60. Thus, virulent mycobacteria delays (14–21 days) lung APC recruitment compared to model antigens and nonvirulent bacilli (24–48 h). Regarding granuloma constitution, highly bacillary CD14+ and SRA+ cells were centrally located. MHC-CII+ cells were more peripheral, with less mycobacteria. CD11c+ cells were heterogeneously distributed within granulomas, with scarce bacilli. When labelling lung suspensions for MHC-CII and classifying cells as macrophages or DC, then staining for Ziehl–Neelsen, a remarkable segregation was found regarding bacillary burden. Most macrophage-like cells contained numerous bacilli, while DC had no or scarce mycobacteria. This implies differential APC contributions in situ during pulmonary tuberculosis regarding mycobacterial uptake, granuloma involvement and perhaps bacillary growth. PMID:15255967

  15. Lipoprotein lipase activity and mass, apolipoprotein C-II mass and polymorphisms of apolipoproteins E and A5 in subjects with prior acute hypertriglyceridaemic pancreatitis

    PubMed Central

    2009-01-01

    Background Severe hypertriglyceridaemia due to chylomicronemia may trigger an acute pancreatitis. However, the basic underlying mechanism is usually not well understood. We decided to analyze some proteins involved in the catabolism of triglyceride-rich lipoproteins in patients with severe hypertriglyceridaemia. Methods Twenty-four survivors of acute hypertriglyceridaemic pancreatitis (cases) and 31 patients with severe hypertriglyceridaemia (controls) were included. Clinical and anthropometrical data, chylomicronaemia, lipoprotein profile, postheparin lipoprotein lipase mass and activity, hepatic lipase activity, apolipoprotein C II and CIII mass, apo E and A5 polymorphisms were assessed. Results Only five cases were found to have LPL mass and activity deficiency, all of them thin and having the first episode in childhood. No cases had apolipoprotein CII deficiency. No significant differences were found between the non-deficient LPL cases and the controls in terms of obesity, diabetes, alcohol consumption, drug therapy, gender distribution, evidence of fasting chylomicronaemia, lipid levels, LPL activity and mass, hepatic lipase activity, CII and CIII mass or apo E polymorphisms. However, the SNP S19W of apo A5 tended to be more prevalent in cases than controls (40% vs. 23%, NS). Conclusion Primary defects in LPL and C-II are rare in survivors of acute hypertriglyceridaemic pancreatitis; lipase activity measurements should be restricted to those having their first episode during chilhood. PMID:19534808

  16. tif-dependent induction of colicin E1, prophage lambda, and filamentation in Escherichia coli K-12.

    PubMed

    Tessman, E S; Peterson, P K

    1980-09-01

    To help understand how the tif-1 mutation of the recA gene of Escherichia coli confers adenine activability on the recA protein, we used the fact that cytidine plus guanosine inhibits induction of prophage lambda and cell filamentation in a tif-1 mutant, and that adenine reverses this inhibition. We varied the amount of adenine in agar plates containing a fixed amount of cytidine and scored for survivors of three different tif-dependent lethal induction processes. Much more adenine was required for cell killing when cytidine was present than when it was absent. Therefore adenine does not override cytidine inhibition, but instead appears to compete with it for a site of action which may be on the recA protein. The competition is not at the cell transport level. Our results lead to a model in which the tif form of the recA protein is an allosteric enzyme that binds both negative and positive modulators. By varying the adenine-cytidine ratio of the medium it is possible to control the degree of induction in a tif-1 cell. For the three different tif-dependent inductions studied here, least adenine was required for lambda induction and most for lethal filamentation, presumably reflecting requirements for different amounts of activated recA protein in each process. Varying the adenine-cytidine ratio revealed two stable intermediate stages in lambda induction, as well as a stage of colicin E1 induction in which the cells produced colicin without cell death. The rate of filament formation could be similarly controlled. Experiments with tif (ColE1, lambda) gave evidence of a competition between colicin repressor and lambda repressor for activated recA protein.

  17. Predicting BRCA1 and BRCA2 gene mutation carriers: comparison of LAMBDA, BRCAPRO, Myriad II, and modified Couch models.

    PubMed

    Lindor, Noralane M; Lindor, Rachel A; Apicella, Carmel; Dowty, James G; Ashley, Amanda; Hunt, Katherine; Mincey, Betty A; Wilson, Marcia; Smith, M Cathie; Hopper, John L

    2007-01-01

    Models have been developed to predict the probability that a person carries a detectable germline mutation in the BRCA1 or BRCA2 genes. Their relative performance in a clinical setting is unclear. To compare the performance characteristics of four BRCA1/BRCA2 gene mutation prediction models: LAMBDA, based on a checklist and scores developed from data on Ashkenazi Jewish (AJ) women; BRCAPRO, a Bayesian computer program; modified Couch tables based on regression analyses; and Myriad II tables collated by Myriad Genetics Laboratories. Family cancer history data were analyzed from 200 probands from the Mayo Clinic Familial Cancer Program, in a multispecialty tertiary care group practice. All probands had clinical testing for BRCA1 and BRCA2 mutations conducted in a single laboratory. For each model, performance was assessed by the area under the receiver operator characteristic curve (ROC) and by tests of accuracy and dispersion. Cases "missed" by one or more models (model predicted less than 10% probability of mutation when a mutation was actually found) were compared across models. All models gave similar areas under the ROC curve of 0.71 to 0.76. All models except LAMBDA substantially under-predicted the numbers of carriers. All models were too dispersed. In terms of ranking, all prediction models performed reasonably well with similar performance characteristics. Model predictions were widely discrepant for some families. Review of cancer family histories by an experienced clinician continues to be vital to ensure that critical elements are not missed and that the most appropriate risk prediction figures are provided.

  18. In vitro expression of Escherichia coli ribosomal protein genes: autogenous inhibition of translation.

    PubMed Central

    Yates, J L; Arfsten, A E; Nomura, M

    1980-01-01

    Escherichia coli ribosomal protein L1 (0.5 micro M) was found to inhibit the synthesis of both proteins of the L11 operon, L11 and L1, but not the synthesis of other proteins directed by lambda rifd 18 DNA. Similarly, S4 (1 micro M) selectively inhibited the synthesis of three proteins of the alpha operon, S13, S11, and S4, directed by lambda spcI DNA or a restriction enzyme fragment obtained from this DNA. S8 (3.6 micro M) also showed preferential inhibitory effects on the synthesis of some proteins encoded in the spc operon, L24 and L5 (and probably S14 and S8), directed by lambda spcl DNA or a restriction enzyme fragment carrying the genes for these proteins. The inhibitory effect of L1 was observed only with L1 and not with other proteins examined, including S4 and S8. Similarly, the effect of S4 was not observed with L1 or S8, and that of S8 was not seen with L1 or S4. Inhibition was shown to take place at the level of translation rather than transcription. Thus, at least some ribosomal proteins (L1 S4, and S8) have the ability to cause selective translational inhibition of the synthesis of certain ribosomal proteins whose genes are in the same operon as their own. These results support the hypothesis that certain free ribosomal proteins not assembled into ribosomes act as "autogenous" feedback inhibitors to regulate the synthesis of ribosomal proteins. Images PMID:6445562

  19. Five-Body Cluster Structure of the Double-{Lambda} Hypernucleus {sub {Lambda}{Lambda}}{sup 11}Be

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Hiyama, E.; Kamimura, M.; Yamamoto, Y.

    2010-05-28

    Energy levels of the double {Lambda} hypernucleus, {sub {Lambda}{Lambda}}{sup 11}Be are calculated within the framework of a {alpha}{alpha}n{Lambda}{Lambda} five-body model. Interactions between constituent particles are determined so as to reproduce reasonably the observed low-energy properties of the {alpha}{alpha}, {alpha}{alpha}n nuclei and the existing data for {Lambda}-binding energies of the {alpha}{Lambda}, {alpha}{alpha}{Lambda}, {alpha}n{Lambda}, and {alpha}{alpha}n{Lambda} systems. An effective {Lambda}{Lambda} interaction is constructed so as to reproduce, within the {alpha}{Lambda}{Lambda} three-body model, the B{sub {Lambda}{Lambda}}of {sub {Lambda}{Lambda}}{sup 6}He, which was extracted from the emulsion experiment, the NAGARA event. With no adjustable parameters for the {alpha}{alpha}n{Lambda}{Lambda} system, B{sub {Lambda}{Lambda}}of the ground and boundmore » excited states of {sub {Lambda}{Lambda}}{sup 11}Be are calculated with the Gaussian expansion method. The Hida event, recently observed at KEK-E373 experiment, is interpreted as an observation of the ground state of the {sub {Lambda}{Lambda}}{sup 11}Be.« less

  20. Isolation, molecular properties, and kinetic characterization of lipoprotein lipase from rat heart

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chung, J.; Scanu, A.M.

    1977-06-25

    Lipoprotein lipase was isolated to electrophoretic and chromatographic purity from rat heart acetone/ether powder by a combination of n-butyl alcohol precipitation and heparin/sepharose affinity column chromatography. By sedimentation equilibrium ultracentrifugation in 6 M guanidine hydrochloride, and by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, the enzyme was found to have a minimum molecular weight of about 34,000. It had a relative abundance of glutamic acid and contains 3.3 percent carbohydrate by weight. The composition was as follows, in moles per 34,000 g: mannose (neutral sugars), 5.1; sialic acid, 0.8; and glucosamine, 2.3. When tested against a triolein emulsion, the enzyme was activemore » only in the presence of apolipoprotein glutamic acid (apo C-II); it was inactivated by 1 M NaCl and by apolipoproteins serine and alanine isolated from human serum very low density lipoprotein. In order to define the kinetics of hydrolysis of triglyceride by lipoprotein lipase, we carried out studies on monomolecular films of glyceryl tri(1-/sup 14/C)octanoate. In the presence of excess apo C-II, the hydrolysis followed first order time course and yielded a second order rate constant of 1.85 x 10/sup 5/ M/sup -1/ S/sup -1/. The apparent first order rate constants, k/sub exp/, were proportional to enzyme concentrations over at least a 5-fold range. When enzyme concentrations of 0.22, 0.35, and 0.66 ..mu..g/ml were used, the rate of hydrolysis increased as a function of apo C-II concentration and reached a maximum at a concentration of apo C-II corresponding to a molar ratio of enzyme to apo C-II of about 1 : 1, respectively, which suggests the formation of a stoichiometric complex. The availability of a pure enzyme and the knowledge of its kinetics should stimulate further studies on the molecular basis of enzyme action.« less

  1. Myocardial Infarction Injury in Patients with Chronic Lung Disease Entering Pulmonary Rehabilitation: Frequency and Association with Heart Rate Parameters.

    PubMed

    Sima, Carmen A; Lau, Benny C; Taylor, Carolyn M; van Eeden, Stephan F; Reid, W Darlene; Sheel, Andrew W; Kirkham, Ashley R; Camp, Pat G

    2018-03-14

    Myocardial infarction (MI) remains under-recognized in chronic lung disease (CLD) patients. Rehabilitation health professionals need accessible clinical measurements to identify the presence of prior MI in order to determine appropriate training prescription. To estimate prior MI in CLD patients entering a pulmonary rehabilitation program, as well as its association with heart rate parameters such as resting heart rate and chronotropic response index. Retrospective cohort design. Pulmonary rehabilitation outpatient clinic in a tertiary care university-affiliated hospital. Eighty-five CLD patients were studied. Electrocardiograms at rest and peak cardiopulmonary exercise testing, performed before pulmonary rehabilitation, were analyzed. Electrocardiographic evidence of prior MI, quantified by the Cardiac Infarction Injury Score (CIIS), was contrasted with reported myocardial events and then correlated with resting heart rate and chronotropic response index parameters. CIIS, resting heart rate, and chronotropic response index. Sixteen CLD patients (19%) demonstrated electrocardiographic evidence of prior MI, but less than half (8%) had a reported MI history (P < .05). The Cohen's kappa test revealed poor level of agreement between CIIS and medical records (kappa = 0.165), indicating that prior MI diagnosis was under-reported in the medical records. Simple and multiple regression analyses showed that resting heart rate but not chronotropic response index was positively associated with CIIS in our population (R 2 = 0.29, P < .001). CLD patients with a resting heart rate higher than 80 beats/min had approximately 5 times higher odds of having prior MI, as evidenced by a CIIS ≥20. CLD patients entering pulmonary rehabilitation are at risk of unreported prior MI. Elevated resting heart rate seems to be an indicator of prior MI in CLD patients; therefore, careful adjustment of training intensity such as intermittent training is recommended under these circumstances. III. Copyright © 2018 American Academy of Physical Medicine and Rehabilitation. Published by Elsevier Inc. All rights reserved.

  2. Neon and [CII] 158 μm Emission Line Profiles in Dusty Starbursts and Active Galactic Nuclei

    NASA Astrophysics Data System (ADS)

    Samsonyan, A.; Weedman, D.; Lebouteiller, V.; Barry, D.; Sargsyan, L.

    2017-07-01

    Identifying and understanding the initial formation of massive galaxies and quasars in the early universe is a fundamental goal of observational cosmology. A rapidly developing capability for tracing luminosity sources to high redshifts is the observation of the [CII] 158 μm emission line at redshifts z > 4 using ground based submillimeter interferometers, with detections now having been made to z = 7. This has long been known as the strongest far-infrared line in most sources, often carrying about 1% of the total source luminosity, and is thought to be associated with star formation because it should arise within the photodissociation region (PDR) surrounding starbursts. The sample of 382 extragalactic sources has been analysed that have mid-infrared,high resolution spectroscopy with the Spitzer Infrared Spectrograph (IRS) and also spectroscopy of the [CII] 158 μm line with the Herschel Photodetector Array Camera and Spectrometer (PACS). The emission line profiles of [NeII] 12.81μm , [NeIII] 15.55 μm , and [CII] 158 μm are studied, and intrinsic line widths are determined. All line profiles together with overlays comparing positions of PACS and IRS observations are made available in the Cornell Atlas of Spitzer IRS Sources (CASSIS). Sources are classified from AGN to starburst based on equivalent widths of the 6.2 μm polycyclic aromatic hydrocarbon feature. It is found that intrinsic line widths do not change among classification for [CII], with median widths of 207 km s-1 for AGN, 248 km s-1 for composites, and 233 km s-1 for starbursts. The [NeII] line widths also do not change with classification, but [NeIII] lines are progressively broader from starburst to AGN. A small number of objects with unusually broad lines or unusual redshift differences in any feature are identified.

  3. Escherichia coli heat-labile enterotoxin B subunit prevents autoimmune arthritis through induction of regulatory CD4+ T cells.

    PubMed

    Luross, Jeffrey A; Heaton, Tricia; Hirst, Timothy R; Day, Michael J; Williams, Neil A

    2002-06-01

    The receptor-binding B subunit of Escherichia coli heat-labile enterotoxin (EtxB) is a highly stable, nontoxic protein that is capable of modulating immune responses. This study was conducted to determine whether mucosal administration of EtxB can block collagen-induced arthritis (CIA) and to investigate the mechanisms involved. Clinical arthritis in DBA/1 mice was monitored following mucosal administration of EtxB on 4 occasions. The dependence of disease prevention on receptor binding by EtxB and the associated alterations to the immune response to type II collagen (CII) were assessed. Adoptive transfer experiments and lymph node cell cocultures were used to investigate the underlying mechanisms. Both intranasal and intragastric delivery of EtxB were effective in preventing CIA; a 1-microg dose of EtxB was protective after intranasal administration. A non-receptor-binding mutant of EtxB failed to prevent disease. Intranasal EtxB lowered both the incidence and severity of arthritis when given either at the time of disease induction or 25 days later. EtxB markedly reduced levels of anti-CII IgG2a antibodies and interferon-gamma (IFNgamma) production while not affecting levels of IgG1, interleukin-4 (IL-4), or IL-10. Disease protection could be transferred by CD4+ T cells from treated mice, an effect that was abrogated upon depletion of the CD25+ population. In addition, CD4+CD25+ T cells from treated mice were able to suppress anti-CII IFNgamma production by CII-primed lymph node cells. Mucosal administration of EtxB can be used to prevent or treat CIA. Modulation of the anti-CII immune response by EtxB is associated with a reduction in Th1 cell reactivity without a concomitant shift toward Th2. Instead, EtxB mediates its effects through enhancing the activity of a population of CD4+ regulatory T cells.

  4. Resistance to lambda-cyhalothrin in Spanish field populations of Ceratitis capitata and metabolic resistance mediated by P450 in a resistant strain.

    PubMed

    Arouri, Rabeh; Le Goff, Gaelle; Hemden, Hiethem; Navarro-Llopis, Vicente; M'saad, Mariem; Castañera, Pedro; Feyereisen, René; Hernández-Crespo, Pedro; Ortego, Félix

    2015-09-01

    The withdrawal of malathion in the European Union in 2009 resulted in a large increase in lambda-cyhalothrin applications for the control of the Mediterranean fruit fly, Ceratitis capitata, in Spanish citrus crops. Spanish field populations of C. capitata have developed resistance to lambda-cyhalothrin (6-14-fold), achieving LC50 values (129-287 ppm) higher than the recommended concentration for field treatments (125 ppm). These results contrast with the high susceptibility to lambda-cyhalothrin found in three Tunisian field populations. We have studied the mechanism of resistance in the laboratory-selected resistant strain W-1Kλ (205-fold resistance). Bioassays with synergists showed that resistance was almost completely suppressed by the P450 inhibitor PBO. The study of the expression of 53 P450 genes belonging to the CYP4, CYP6, CYP9 and CYP12 families in C. capitata revealed that CYP6A51 was overexpressed (13-18-fold) in the resistant strain. The W-1Kλ strain also showed high levels of cross-resistance to etofenprox (240-fold) and deltamethrin (150-fold). Field-evolved resistance to lambda-cyhalothrin has been found in C. capitata. Metabolic resistance mediated by P450 appears to be the main resistance mechanism in the resistant strain W-1Kλ. The levels of cross-resistance found may compromise the effectiveness of other pyrethroids for the control of this species. © 2014 Society of Chemical Industry. © 2014 Society of Chemical Industry.

  5. Pyrethroid insecticide lambda-cyhalothrin and its metabolites induce liver injury through the activation of oxidative stress and proinflammatory gene expression in rats following acute and subchronic exposure.

    PubMed

    Aouey, Bakhta; Derbali, Mohamed; Chtourou, Yassine; Bouchard, Michèle; Khabir, Abdelmajid; Fetoui, Hamadi

    2017-02-01

    Lambda-cyhalothrin (LTC) [α-cyano-3-phenoxybenzyl-3-(2-chloro-3,3,3-trifluoro-1-propenyl)-2,2-dimethylcyclo-propanecarboxylate] is a synthetic type II pyrethroid insecticide commonly used in residential and agricultural areas. The potential hepatotoxicity of pyrethroids remains unclear and could easily be assessed by measuring common clinical indicators of liver disease. To understand more about the potential risks for humans associated with LTC exposure, male adult rats were orally exposed to 6.2 and 31.1 mg/kg bw of LTC for 7, 30, 45, and 60 days. Histopathological changes and alterations of main parameters related to oxidative stress and inflammatory responses in the liver were evaluated. Further, lambda-cyhalothrin metabolites [3-(2-chloro-3,3,3-trifluoroprop-1-enyl)-2,2-dimethyl-cyclopropane carboxylic acid (CFMP), 4-hydroxyphenoxybenzoic acid (4-OH-3-PBA), and 3-phenoxybenzoic acid (3-PBA)] in the liver tissues were identified and quantified by ultra-high-performance liquid chromatography coupled to quadripole time-of-flight mass spectrometry (UHPLC-MS-Q-ToF). Results revealed that LTC exposure significantly increased markers of hepatic oxidative stress in a time-dependent and dose-dependent manner, and this was associated with an accumulation of CFMP and 3-PBA in the liver tissues. In addition, the levels of tumor necrosis factor-α (TNF-α) and interleukin (IL-6 and IL-1β) gene expressions were significantly increased in the liver of exposed rats compared to controls. Correlation analyses revealed that CFMP and 3-PBA metabolite levels in the liver tissues were significantly correlated with the indexes of oxidative stress, redox status, and inflammatory markers in rats exposed to lambda-cyhalothin. Overall, this study provided novel evidence that hepatic damage is likely due to increased oxidative stress and inflammation under the condition of acute and subchronic exposure to lambda-cyhalothrin and that LTC metabolites (CFMP and 3-PBA) could be used as potential biomarker in human biomonitoring studies.

  6. Study of {Lambda}-{Lambda} oscillation in quantum coherent {Lambda}{Lambda} by using J/{psi}{yields}{Lambda}{Lambda} decay

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kang Xianwei; Department of Physics, Henan Normal University, Xinxiang 453007; Li Haibo

    2010-03-01

    We discuss the possibility of searching for the {Lambda}-{Lambda} oscillations for coherent {Lambda}{Lambda} production in the J/{psi}{yields}{Lambda}{Lambda} decay process. The sensitivity of measurement of {Lambda}-{Lambda} oscillation in the external field at BES-III experiment is considered. These considerations indicate an alternative way to probe the {Delta}B=2 amplitude in addition to neutron oscillation experiments. Both coherent and time-dependent information can be used to extract the {Lambda}-{Lambda} oscillation parameter. With one year's luminosity at BES-III, we can set an upper limit of {delta}m{sub {Lambda}{Lambda}<}10{sup -15} MeV at 90% confidence level, corresponding to about 10{sup -6} s of {Lambda}-{Lambda} oscillation time.

  7. The tumor suppressor cybL, a component of the respiratory chain, mediates apoptosis induction.

    PubMed

    Albayrak, Timur; Scherhammer, Volker; Schoenfeld, Nicole; Braziulis, Erik; Mund, Thomas; Bauer, Manuel K A; Scheffler, Immo E; Grimm, Stefan

    2003-08-01

    A genetic screen was established to clone apoptosis-inducing genes in a high-throughput format. It led to the isolation of several proapoptotic genes whose proteins are localized to mitochondria. One of the isolated genes is cytochrome bL (cybL also known as SDHC, CII-3, or QPs-1), a component of the respiratory chain complex II. It was further investigated because both cybL and another component of complex II, cybS, have recently been identified as tumor suppressor proteins, some of which act by controlling apoptosis. Our studies reveal that cell death induction by cybL expression is concomitant with a transient inhibition of complex II and the generation of reactive oxygen species. Importantly, cells that are constitutively deficient in cybL are resistant to a variety of proapoptotic cytostatic drugs and to the effects of the Fas receptor. Our results therefore identify complex II as a sensor for apoptosis induction and could explain the unexpected observation that complex II is inactivated in tumors.

  8. The Tumor Suppressor cybL, a Component of the Respiratory Chain, Mediates Apoptosis Induction

    PubMed Central

    Albayrak, Timur; Scherhammer, Volker; Schoenfeld, Nicole; Braziulis, Erik; Mund, Thomas; Bauer, Manuel K.A.; Scheffler, Immo E.; Grimm, Stefan

    2003-01-01

    A genetic screen was established to clone apoptosis-inducing genes in a high-throughput format. It led to the isolation of several proapoptotic genes whose proteins are localized to mitochondria. One of the isolated genes is cytochrome bL (cybL also known as SDHC, CII-3, or QPs-1), a component of the respiratory chain complex II. It was further investigated because both cybL and another component of complex II, cybS, have recently been identified as tumor suppressor proteins, some of which act by controlling apoptosis. Our studies reveal that cell death induction by cybL expression is concomitant with a transient inhibition of complex II and the generation of reactive oxygen species. Importantly, cells that are constitutively deficient in cybL are resistant to a variety of proapoptotic cytostatic drugs and to the effects of the Fas receptor. Our results therefore identify complex II as a sensor for apoptosis induction and could explain the unexpected observation that complex II is inactivated in tumors. PMID:12925748

  9. IFNL4 affects clearance of hepatitis C virus

    Cancer.gov

    Scientists have discovered a new human interferon gene, Interferon Lambda 4 (IFNL4), that affects clearance of the hepatitis C virus. They also identified an inherited genetic variant within IFNL4 that predicts how people respond to treatment for hepatit

  10. 3D-DIVIMP(HC) code modeling of DIII-D DiMES porous plug injector experiments

    NASA Astrophysics Data System (ADS)

    Mu, Y.; Elder, J. D.; Stangeby, P. C.; McLean, A. G.

    2011-08-01

    A Porous Plug Injector (PPI) system for the Divertor Material Evaluation System (DiMES) on DIII-D has been employed for in situ study of chemical erosion in the tokamak divertor environment. The 3D-DIVIMP(HC) code has been applied to the interpretation of the CI, CII and other spectroscopic measurements made at the PPI location, for (a) the synthetic source due to injection of CH4 through the PPI, and (b) the natural emission from the PPI head itself, which was inserted above surrounding graphite tiles by ˜0.3 mm.The code successfully replicated the MDS (spectrometer)-measured absolute emissions of CH, CI, CII 427 nm, 514 nm, and 658 nm [1] and the DiMES TV-measured spatial shapes of the CH, CI, and CII 514 nm [1] emission "clouds" to within the combined uncertainties. It is thus concluded that the most important physics and chemistry of chemical sputtering have most likely been included in the model.

  11. Mitochondrial complex II is a source of the reserve respiratory capacity that is regulated by metabolic sensors and promotes cell survival.

    PubMed

    Pfleger, J; He, M; Abdellatif, M

    2015-07-30

    The survival of a cell depends on its ability to meet its energy requirements. We hypothesized that the mitochondrial reserve respiratory capacity (RRC) of a cell is a critical component of its bioenergetics that can be utilized during an increase in energy demand, thereby, enhancing viability. Our goal was to identify the elements that regulate and contribute to the development of RRC and its involvement in cell survival. The results show that activation of metabolic sensors, including pyruvate dehydrogenase and AMP-dependent kinase, increases cardiac myocyte RRC via a Sirt3-dependent mechanism. Notably, we identified mitochondrial complex II (cII) as a target of these metabolic sensors and the main source of RRC. Moreover, we show that RRC, via cII, correlates with enhanced cell survival after hypoxia. Thus, for the first time, we show that metabolic sensors via Sirt3 maximize the cellular RRC through activating cII, which enhances cell survival after hypoxia.

  12. Teaching and learning in the operating room is a two-way street: resident perceptions.

    PubMed

    Vikis, Elena A; Mihalynuk, Tanis V; Pratt, Dan D; Sidhu, Ravi S

    2008-05-01

    The transformation of a trainee into a surgeon is influenced strongly by communication patterns in the operating room (OR). In the current era of limited educational opportunities, elucidation of teaching and learning strategies in this environment is critical. The aim of this study was to further understand the elements of an effective communicative instructional interaction (CII) as perceived by surgical residents. Qualitative research methodology was used to explore University of British Columbia surgery residents' perceptions of what constitutes an effective CII in the OR. Purposeful sampling was used to select participants from various years of training. Eighteen residents participated in semistructured interviews to facilitate reflection of their OR experiences. Interviews were transcribed, analyzed, and fed back to residents to confirm their accuracy. Independent coding and analysis led to the development of key emergent themes. Themes represented the interplay of ideals expressed by the residents. The primary emergent theme was that both teacher and learner play a major role in the creation of an effective CII. The ideal teacher had an instructional plan, facilitated surgical independence, and showed support and empathy for the surgical resident. The ideal resident was receptive, prepared, and acknowledged limitations. The contextual constraints of the OR played a central role in learning, and residents identified ways to maintain educational value despite primarily nonmodifiable contextual elements (ie, time constraints). In a unique environment such as the OR, both teacher and learner may benefit by an enhanced understanding of the elements of an effective CII.

  13. Recombineering Pseudomonas syringae

    USDA-ARS?s Scientific Manuscript database

    Here we report the identification of functions that promote genomic recombination of linear DNA introduced into Pseudomonas cells by electroporation. The genes encoding these functions were identified in Pseudomonas syringae pv. syringae B728a based on similarity to the lambda Red Exo/Beta and RecE...

  14. Dephosphorylation of the Core Clock Protein KaiC in the Cyanobacterial KaiABC Circadian Oscillator Proceeds via an ATP Synthase Mechanism

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Egli, Martin; Mori, Tetsuya; Pattanayek, Rekha

    The circadian clock of the cyanobacterium Synechococcus elongatus can be reconstituted in vitro from three proteins, KaiA, KaiB, and KaiC in the presence of ATP, to tick in a temperature-compensated manner. KaiC, the central cog of this oscillator, forms a homohexamer with 12 ATP molecules bound between its N- and C-terminal domains and exhibits unusual properties. Both the N-terminal (CI) and C-terminal (CII) domains harbor ATPase activity, and the subunit interfaces between CII domains are the sites of autokinase and autophosphatase activities. Hydrolysis of ATP correlates with phosphorylation at threonine and serine sites across subunits in an orchestrated manner, suchmore » that first T432 and then S431 are phosphorylated, followed by dephosphorylation of these residues in the same order. Although structural work has provided insight into the mechanisms of ATPase and kinase, the location and mechanism of the phosphatase have remained enigmatic. From the available experimental data based on a range of approaches, including KaiC crystal structures and small-angle X-ray scattering models, metal ion dependence, site-directed mutagenesis (i.e., E318, the general base), and measurements of the associated clock periods, phosphorylation patterns, and dephosphorylation courses as well as a lack of sequence motifs in KaiC that are typically associated with known phosphatases, we hypothesized that KaiCII makes use of the same active site for phosphorylation and dephosphorlyation. We observed that wild-type KaiC (wt-KaiC) exhibits an ATP synthase activity that is significantly reduced in the T432A/S431A mutant. We interpret the first observation as evidence that KaiCII is a phosphotransferase instead of a phosphatase and the second that the enzyme is capable of generating ATP, both from ADP and P{sub i} (in a reversal of the ATPase reaction) and from ADP and P-T432/P-S431 (dephosphorylation). This new concept regarding the mechanism of dephosphorylation is also supported by the strikingly similar makeups of the active sites at the interfaces between {alpha}/{beta} heterodimers of F1-ATPase and between monomeric subunits in the KaiCII hexamer. Several KaiCII residues play a critical role in the relative activities of kinase and ATP synthase, among them R385, which stabilizes the compact form and helps kinase action reach a plateau, and T426, a short-lived phosphorylation site that promotes and affects the order of dephosphorylation.« less

  15. Shell-model predictions for Lambda Lambda hypernuclei

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Gal, A.; Millener, D.

    2011-06-02

    It is shown how the recent shell-model determination of {Lambda}N spin-dependent interaction terms in {Lambda} hypernuclei allows for a reliable deduction of {Lambda}{Lambda} separation energies in {Lambda}{Lambda} hypernuclei across the nuclear p shell. Comparison is made with the available data, highlighting {sub {Lambda}{Lambda}}{sup 11}Be and {sub {Lambda}{Lambda}}{sup 12}Be which have been suggested as possible candidates for the KEK-E373 HIDA event.

  16. Assignment of the gene encoding the 5-HT{sub 1E} serotonin receptor (S31) (locus HTR1E) to human chromosome 6q14-q15

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Levy, F.O.; Tasken, K.; Solberg, R.

    1994-08-01

    The human gene for the 5-HT{sub 1E} serotonin receptor was recently cloned, but no chromosomal assignment has yet been given to this gene (locus HTR1E). In this work, we demonstrate by two independent polymerase chain reactions on a panel of human-hamster somatic cell hybrid genomic DNA that the 5-HT{sub 1E} serotonin receptor gene is localized on human chromosome 6. Furthermore, by means of in situ hybridization to human metaphase chromosomes, using the cloned 5-HT{sub 1E} receptor gene (phage clone {lambda}-S31) as a probe, we demonstrate that this gene is localized to the q14-q15 region on chromosome 6. Screening of genomicmore » DNA from 15 unrelated Caucasian individuals, using as a probe the open reading frame of the cloned 5-HT{sub 1E} receptor gene, did not reveal any restriction fragment length polymorphisms with the enzymes BamHI, BanII, BglII, EcoRI, HincII, HindIII, HinfI, MspI, PstI, and PvuII. Since the 5-HT{sub 1E} receptor is found mainly in the cerebral cortex and abnormal function of the serotonergic system has been implicated in a variety of neurologic and psychiatric diseases, the precise chromosomal assignment of the 5-HT{sub 1E} receptor gene is the crucial first step toward the evaluation of this locus as a candidate for mutations in such syndromes. 28 refs., 2 figs., 2 tabs.« less

  17. Analyses of chicken immunoglobulin light chain cDNA clones indicate a few germline V lambda genes and allotypes of the C lambda locus.

    PubMed

    Parvari, R; Ziv, E; Lentner, F; Tel-Or, S; Burstein, Y; Schechter, I

    1987-01-01

    cDNA libraries of chicken spleen and Harder gland (a gland enriched with immunocytes) constructed in pBR322 were screened by differential hybridization and by mRNA hybrid-selected translation. Eleven L-chain cDNA clones were identified from which VL probes were prepared and each was annealed with kidney DNA restriction digests. All VL probes revealed the same set of bands, corresponding to about 15 germline VL genes of one subgroup. The nucleotide sequences of six VL clones showed greater than or equal to 85% homology, and the predicted amino acid sequences were identical or nearly identical to the major N-terminal sequence of L-chains in chicken serum. These findings, and the fact that the VL clones were randomly selected from normal lymphoid tissues, strongly indicate that the bulk of chicken L-chains is encoded by a few germline VL genes, probably much less than 15 since many of the VL genes are known to be pseudogenes. Therefore, it is likely that somatic mechanisms operating prior to specific triggering by antigen play a major role in the generation of antibody diversity in chicken. Analysis of the constant region locus (sequencing of CL gene and cDNAs) demonstrate a single CL isotype and suggest the presence of CL allotypes.

  18. High Inter-Individual Diversity of Point Mutations, Insertions, and Deletions in Human Influenza Virus Nucleoprotein-Specific Memory B Cells

    PubMed Central

    Bussmann, Bianca M.; Horn, Susanne; Sieg, Michael; Jassoy, Christian

    2015-01-01

    The diversity of virus-specific antibodies and of B cells among different individuals is unknown. Using single-cell cloning of antibody genes, we generated recombinant human monoclonal antibodies from influenza nucleoprotein-specific memory B cells in four adult humans with and without preceding influenza vaccination. We examined the diversity of the antibody repertoires and found that NP-specific B cells used numerous immunoglobulin genes. The heavy chains (HCs) originated from 26 and the kappa light chains (LCs) from 19 different germ line genes. Matching HC and LC chains gave rise to 43 genetically distinct antibodies that bound influenza NP. The median lengths of the CDR3 of the HC, kappa and lambda LC were 14, 9 and 11 amino acids, respectively. We identified changes at 13.6% of the amino acid positions in the V gene of the antibody heavy chain, at 8.4 % in the kappa and at 10.6 % in the lambda V gene. We identified somatic insertions or deletions in 8.1% of the variable genes. We also found several small groups of clonal relatives that were highly diversified. Our findings demonstrate broadly diverse memory B cell repertoires for the influenza nucleoprotein. We found extensive variation within individuals with a high number of point mutations, insertions, and deletions, and extensive clonal diversification. Thus, structurally conserved proteins can elicit broadly diverse and highly mutated B-cell responses. PMID:26086076

  19. Measurement of the forward-backward asymmetry of $$\\Lambda$$ and $$\\bar{\\Lambda}$$ production in $$p \\bar{p}$$ collisions

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Abazov, Victor Mukhamedovich

    Here, we studymore » $$\\Lambda$$ and $$\\bar{\\Lambda}$$ production asymmetries in $$p \\bar{p} \\rightarrow \\Lambda (\\bar{\\Lambda}) X$$, $$p \\bar{p} \\rightarrow J/\\psi \\Lambda (\\bar{\\Lambda}) X$$, and $$p \\bar{p} \\rightarrow \\mu^\\pm \\Lambda (\\bar{\\Lambda}) X$$ events recorded by the D0 detector at the Fermilab Tevatron collider at $$\\sqrt{s} = 1.96$$ TeV. We find an excess of $$\\Lambda$$'s ($$\\bar{\\Lambda}$$'s) produced in the proton (antiproton) direction. This forward-backward asymmetry is measured as a function of rapidity. We confirm that the $$\\bar{\\Lambda}/\\Lambda$$ production ratio, measured by several experiments with various targets and a wide range of energies, is a universal function of "rapidity loss", i.e., the rapidity difference of the beam proton and the lambda.« less

  20. Measurement of the forward-backward asymmetry of $$\\Lambda$$ and $$\\bar{\\Lambda}$$ production in $$p \\bar{p}$$ collisions

    DOE PAGES

    Abazov, Victor Mukhamedovich

    2016-02-09

    Here, we studymore » $$\\Lambda$$ and $$\\bar{\\Lambda}$$ production asymmetries in $$p \\bar{p} \\rightarrow \\Lambda (\\bar{\\Lambda}) X$$, $$p \\bar{p} \\rightarrow J/\\psi \\Lambda (\\bar{\\Lambda}) X$$, and $$p \\bar{p} \\rightarrow \\mu^\\pm \\Lambda (\\bar{\\Lambda}) X$$ events recorded by the D0 detector at the Fermilab Tevatron collider at $$\\sqrt{s} = 1.96$$ TeV. We find an excess of $$\\Lambda$$'s ($$\\bar{\\Lambda}$$'s) produced in the proton (antiproton) direction. This forward-backward asymmetry is measured as a function of rapidity. We confirm that the $$\\bar{\\Lambda}/\\Lambda$$ production ratio, measured by several experiments with various targets and a wide range of energies, is a universal function of "rapidity loss", i.e., the rapidity difference of the beam proton and the lambda.« less

  1. Factors affecting expression of the recF gene of Escherichia coli K-12.

    PubMed

    Sandler, S J; Clark, A J

    1990-01-31

    This report describes four factors which affect expression of the recF gene from strong upstream lambda promoters under temperature-sensitive cIAt2-encoded repressor control. The first factor was the long mRNA leader sequence consisting of the Escherichia coli dnaN gene and 95% of the dnaA gene and lambda bet, N (double amber) and 40% of the exo gene. When most of this DNA was deleted, RecF became detectable in maxicells. The second factor was the vector, pBEU28, a runaway replication plasmid. When we substituted pUC118 for pBEU28, RecF became detectable in whole cells by the Coomassie blue staining technique. The third factor was the efficiency of initiation of translation. We used site-directed mutagenesis to change the mRNA leader, ribosome-binding site and the 3 bp before and after the translational start codon. Monitoring the effect of these mutational changes by translational fusion to lacZ, we discovered that the efficiency of initiation of translation was increased 30-fold. Only an estimated two- or threefold increase in accumulated levels of RecF occurred, however. This led us to discover the fourth factor, namely sequences in the recF gene itself. These sequences reduce expression of the recF-lacZ fusion genes 100-fold. The sequences responsible for this decrease in expression occur in four regions in the N-terminal half of recF. Expression is reduced by some sequences at the transcriptional level and by others at the translational level.

  2. Measurements of J/{psi} and {psi}(2S) decays into {lambda}{lambda}{pi}{sup 0} and {lambda}{lambda}{eta}

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Ablikim, M.; Bai, J. Z.; Cai, X.

    2007-11-01

    Using 58x10{sup 6} J/{psi} and 14x10{sup 6} {psi}(2S) events collected by the BESII detector at the BEPC, branching fractions or upper limits for the decays J/{psi} and {psi}(2S){yields}{lambda}{lambda}{pi}{sup 0} and {lambda}{lambda}{eta} are measured. For the isospin violating decays, the upper limits are determined to be B(J/{psi}{yields}{lambda}{lambda}{pi}{sup 0})<6.4x10{sup -5} and B[{psi}(2S){yields}{lambda}{lambda}{pi}{sup 0}]<4.9x10{sup -5} at the 90% confidence level. The isospin conserving process J/{psi}{yields}{lambda}{lambda}{eta} is observed for the first time, and its branching fraction is measured to be B(J/{psi}{yields}{lambda}{lambda}{eta})=(2.62{+-}0.60{+-}0.44)x10{sup -4}, where the first error is statistical and the second one is systematic. No {lambda}{lambda}{eta} signal is observed in {psi}(2S) decays, and B[{psi}(2S){yields}{lambda}{lambda}{eta}]<1.2x10{supmore » -4} is set at the 90% confidence level. Branching fractions of J/{psi} decays into {sigma}{sup +}{pi}{sup -}{lambda} and {sigma}{sup -}{pi}{sup +}{lambda} are also reported, and the sum of these branching fractions is determined to be B(J/{psi}{yields}{sigma}{sup +}{pi}{sup -}{lambda}+c.c.)=(1.52{+-}0.08{+-}0.16)x10{sup -3}.« less

  3. Measurement of the branching fraction $${\\mathcal{B}}(\\Lambda^0_b\\rightarrow \\Lambda^+_c\\pi^-\\pi^+\\pi^-)$$ at CDF

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Aaltonen, T.; /Helsinki Inst. of Phys.; Alvarez Gonzalez, B.

    We report an analysis of the {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -} decay in a data sample collected by the CDF II detector at the Fermilab Tevatron corresponding to 2.4 fb{sup -1} of integrated luminosity. We reconstruct the currently largest samples of the decay modes {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}(2595){sup +}{pi}{sup -} (with {Lambda}{sub c}(2595){sup +} {yields} {Lambda}{sub c}{sup +}{pi}{sup +}{pi}{sup -}), {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}(2625){sup +}{pi}{sup -} (with {Lambda}{sub c}(2625){sup +} {yields} {Lambda}{sub c}{sup +}{pi}{sup +}{pi}{sup -}), {Lambda}{sub b}{sup 0} {yields} {Sigma}{sub c}(2455){sup ++}{pi}{sup -}{pi}{sup -} (with {Sigma}{sub c}(2455){sup ++} {yields} {Lambda}{submore » c}{sup +}{pi}{sup +}), and {Lambda}{sub b}{sup 0} {yields} {Sigma}{sub c}(2455)0{pi}{sup +}{pi}{sup -} (with {Sigma}{sub c}(2455)0 {yields} {Lambda}{sub c}{sup +}{pi}{sup -}) and measure the branching fractions relative to the {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -} branching fraction. We measure the ratio {Beta}({Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -})/ {Beta}({Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -})=3.04 {+-} 0.33(stat){sub -0.55}{sup +0.70}(syst) which is used to derive {Beta}({Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -})=(26.8{sub -11.2}{sup +11.9}) x 10{sup -3}.« less

  4. Mutation Analysis in Cultured Cells of Transgenic Rodents

    PubMed Central

    Zheng, Albert; Bates, Steven E.; Tommasi, Stella

    2018-01-01

    To comply with guiding principles for the ethical use of animals for experimental research, the field of mutation research has witnessed a shift of interest from large-scale in vivo animal experiments to small-sized in vitro studies. Mutation assays in cultured cells of transgenic rodents constitute, in many ways, viable alternatives to in vivo mutagenicity experiments in the corresponding animals. A variety of transgenic rodent cell culture models and mutation detection systems have been developed for mutagenicity testing of carcinogens. Of these, transgenic Big Blue® (Stratagene Corp., La Jolla, CA, USA, acquired by Agilent Technologies Inc., Santa Clara, CA, USA, BioReliance/Sigma-Aldrich Corp., Darmstadt, Germany) mouse embryonic fibroblasts and the λ Select cII Mutation Detection System have been used by many research groups to investigate the mutagenic effects of a wide range of chemical and/or physical carcinogens. Here, we review techniques and principles involved in preparation and culturing of Big Blue® mouse embryonic fibroblasts, treatment in vitro with chemical/physical agent(s) of interest, determination of the cII mutant frequency by the λ Select cII assay and establishment of the mutation spectrum by DNA sequencing. We describe various approaches for data analysis and interpretation of the results. Furthermore, we highlight representative studies in which the Big Blue® mouse cell culture model and the λ Select cII assay have been used for mutagenicity testing of diverse carcinogens. We delineate the advantages of this approach and discuss its limitations, while underscoring auxiliary methods, where applicable. PMID:29337872

  5. The role of lipopolysaccharide injected systemically in the reactivation of collagen-induced arthritis in mice

    PubMed Central

    Yoshino, Shin; Ohsawa, Motoyasu

    2000-01-01

    We investigated the role of bacterial lipopolysaccharide (LPS) in the reactivation of autoimmune disease by using collagen-induced arthritis (CIA) in mice in which autoimmunity to the joint cartilage component type II collagen (CII) was involved.CIA was induced by immunization with CII emulsified with complete Freund's adjuvant at the base of the tail (day 0) followed by a booster injection on day 21. Varying doses of LPS from E. coli were i.p. injected on day 50.Arthritis began to develop on day 25 after immunization with CII and reached a peak on day 35. Thereafter, arthritis subsided gradually but moderate joint inflammation was still observed on day 50. An i.p. injection of LPS on day 50 markedly reactivated arthritis on a dose-related fashion. Histologically, on day 55, there were marked oedema of synovium which had proliferated by the day of LPS injection, new formation of fibrin, and intense infiltration of neutrophils accompanied with a large number of mononuclear cells. The reactivation of CIA by LPS was associated with increases in anti-CII IgG and IgG2a antibodies as well as various cytokines including IL-12, IFN-γ, IL-1β, and TNF-α. LPS from S. enteritidis, S. typhimurium, and K. neumoniae and its component, lipid A from E. coli also reactivated the disease. Polymyxin B sulphate suppressed LPS- or lipid A-induced reactivation of CIA.These results suggest that LPS may play an important role in the reactivation of autoimmune joint inflammatory diseases such as rheumatoid arthritis in humans. PMID:10742285

  6. Prophylactic Injection of Recombinant Alpha-Enolase Reduces Arthritis Severity in the Collagen-Induced Arthritis Mice Model

    PubMed Central

    Guillou, Clément; Derambure, Céline; Fréret, Manuel; Verdet, Mathieu; Avenel, Gilles; Golinski, Marie-Laure; Sabourin, Jean-Christophe; Loarer, François Le; Adriouch, Sahil; Boyer, Olivier; Lequerré, Thierry; Vittecoq, Olivier

    2015-01-01

    Objective To evaluate the ability of the glycolytic enzyme alpha-enolase (ENO1) or its immunodominant peptide (pEP1) to reduce the severity of CIA in DBA/1 mice when injected in a prophylactic way. Methods Mice were treated with mouse ENO1 or pEP1 one day prior to collagen II immunization. Clinical assessment was evaluated using 4 parameters (global and articular scores, ankle thickness and weight). Titers of serum anti-ENO1, anti-cyclic citrullinated peptides (anti-CCP) and anti-CII (total IgG and IgG1/IgG2a isotypes) antibodies were measured by ELISA at different time-points. Disease activity was assessed by histological analysis of both anterior and hind paws at the end of experimentation. Results Prophylactic injection of 100 μg of ENO1 reduced severity of CIA. Serum levels of anti-CII antibodies were reduced in ENO1-treated mice. Concordantly, ENO1-treated mice joints presented less severe histological signs of arthritis. ENO1 did not induce a shift toward a Th2 response since IgG1/IgG2a ratio of anti-CII antibodies remained unchanged and IL-4 serum levels were similar to those measured in the control group. Conclusions Pre-immunization with ENO1 or its immunodominant peptide pEP1 reduces CIA severity at the clinical, immunological and histological levels. Effects of pEP1 were less pronounced. This immunomodulatory effect is associated with a reduction in anti-CII antibodies production but is not due to a Th1/Th2 shift. PMID:26302382

  7. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

    PubMed

    Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

    2009-02-01

    Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

  8. Recombineering using RecET from Pseudomonas syringae

    USDA-ARS?s Scientific Manuscript database

    Here we report the identification of functions that promote genomic recombination of linear DNA introduced into Pseudomonas cells by electroporation. The genes encoding these functions were identified in Pseudomonas syringae pv. syringae B728a based on similarity to the lambda Red Exo/Beta and RecE...

  9. Study of B{yields}{lambda}{sub c}{lambda}{sub c} and B{yields}{lambda}{sub c}{lambda}{sub c}K

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Cheng, H.-Y.; Hsiao, Y.-K.; Chua, C.-K.

    2009-06-01

    We study the doubly charmful two-body and three-body baryonic B decays B{yields}{lambda}{sub c}{sup +}{lambda}{sub c}{sup -} and B{yields}{lambda}{sub c}{sup +}{lambda}{sub c}{sup -}K. As pointed out before, a naive estimate of the branching ratio O(10{sup -8}) for the latter decay is too small by 3 to 4 orders of magnitude compared to experiment. Previously, it has been shown that a large enhancement for the {lambda}{sub c}{sup +}{lambda}{sub c}{sup -}K production can occur due to a charmoniumlike resonance (e.g. X(4630) discovered by Belle) with a mass near the {lambda}{sub c}{lambda}{sub c} threshold. Motivated by the BABAR's observation of a resonance in themore » {lambda}{sub c}K system with a mass of order 2930 MeV, we study in this work the contribution to B{yields}{lambda}{sub c}{sup +}{lambda}{sub c}{sup -}K from the intermediate state {xi}{sub c}(2980) which is postulated to be a first positive-parity excited D-wave charmed baryon state. Assuming that a soft qq quark pair is produced through the {sigma} and {pi} meson exchanges in the configuration for B{yields}{xi}{sub c}(2980){lambda}{sub c} and {lambda}{sub c}{lambda}{sub c}, it is found that branching ratios of B{yields}{lambda}{sub c}{sup +}{lambda}{sub c}{sup -}K and B{yields}{lambda}{sub c}{sup +}{lambda}{sub c}{sup -} are of order 3.5x10{sup -4} and 5x10{sup -5}, respectively, in agreement with experiment except that the prediction for the {lambda}{sub c}{lambda}{sub c}K{sup -} is slightly smaller. In conjunction with our previous analysis, we conclude that the enormously large rate of B{yields}{lambda}{sub c}{sup +}{lambda}{sub c}{sup -}K arises from the resonances {xi}{sub c}(2980) and X(4630)« less

  10. A Single Molecule Study of Two Bacteriophage Epigenetic Switches

    NASA Astrophysics Data System (ADS)

    Wang, Haowei

    Epigenetic switches allow organisms to evolve into different states by activating/repressing different sets of genes without mutations of the underlying DNA sequence. The study of epigenetic switches is very important to understand the mechanism of human development, the origin of cancer, mental illness and fundamental processes such as gene regulation. The coliphage lambda epigenetic switch, which allows switching from lysogeny to lysis, has been studied for more than 50 years as a paradigm, and has recently received renewed attention. Atomic force microscopy (AFM) was used here to show that the lambda repressor oligomerizes on DNA, primarily as a dodecamer, to secure a DNA loop, which is the basis of the lambda switch. This study also provides support for the idea that specifically bound repressor stabilizes adjacent, non-specifically bound repressor molecules, which confers robustness to the switch. 186 is a member of a different coliphage family. One of the major differences between the two coliphage families is that lambda phages can be induced to switch from the lysogenic to the lytic state by UV radiation, but most coliphages of P2 family, to which 186 belongs, cannot. Interaction between coliphage 186 repressor and DNA is characterized by AFM and tethered particle motion (TPM). To expedite analysis of the AFM data, MatLab codes were written to automate the laborious, manual tracing procedures. The programs automatically recognize DNA segments and protein particles in an image, in order to measure the DNA length and position of bound particles as well as their height, diameter and volume. Application of these algorithms greatly improved the efficiency of AFM analysis. It was showed that 186 CI dimers form heptameric wheels, which induce DNA wrapping and different kinds of DNA looping producing various conformations of nucleoprotein complexes. Information about the dynamics of DNA wrapping and looping on 186 CI particles was also obtained by TPM.

  11. Measurement of the $$\\Lambda_b$$ cross section and the $$_{\\bar{\\Lambda}_b}$$ to $$\\Lambda_b$$ ratio with $$J/\\Psi \\Lambda$$ decays in $pp$ collisions at $$\\sqrt{s}=7$$ TeV

    DOE PAGES

    Chatrchyan, Serguei; et al.

    2013-07-16

    The Lambda(b) differential production cross section and the cross section ratio anti-Lambda(b)/Lambda(b) are measured as functions of transverse momentum pt(Lambda(b)) and rapidity abs(y(Lambda(b))) in pp collisions at sqrt(s) = 7 TeV using data collected by the CMS experiment at the LHC. The measurements are based on Lambda(b) decays reconstructed in the exclusive final state J/Psi Lambda, with the subsequent decays J/Psi to an opposite-sign muon pair and Lambda to proton pion, using a data sample corresponding to an integrated luminosity of 1.9 inverse femtobarns. The product of the cross section times the branching ratio for Lambda(b) to J/Psi Lambda versusmore » pt(Lambda(b)) falls faster than that of b mesons. The measured value of the cross section times the branching ratio for pt(Lambda(b)) > 10 GeV and abs(y(Lambda(b))) < 2.0 is 1.06 +/- 0.06 +/- 0.12 nb, and the integrated cross section ratio for anti-Lambda(b)/Lambda(b) is 1.02 +/- 0.07 +/- 0.09, where the uncertainties are statistical and systematic, respectively.« less

  12. OT1_mputman_1: ASCII: All Sky observations of Galactic CII

    NASA Astrophysics Data System (ADS)

    Putman, M.

    2010-07-01

    The Milky Way and other galaxies require a significant source of ongoing star formation fuel to explain their star formation histories. A new ubiquitous population of discrete, cold clouds have recently been discovered at the disk-halo interface of our Galaxy that could potentially provide this source of fuel. We propose to observe a small sample of these disk-halo clouds with HIFI to determine if the level of [CII] emission detected suggests they represent the cooling of warm clouds at the interface between the star forming disk and halo. These cooling clouds are predicted by simulations of warm clouds moving into the disk-halo interface region. We target 5 clouds in this proposal for which we have high resolution HI maps and can observe the densest core of the cloud. The results of our observations will also be used to interpret the surprisingly high detections of [CII] for low HI column density clouds in the Galactic Plane by the GOT C+ Key Program by extending the clouds probed to high latitude environments.

  13. Resistance to collagen-induced arthritis in SHPS-1 mutant mice

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Okuzawa, Chie; Kaneko, Yoriaki; Murata, Yoji

    SHPS-1 is a transmembrane protein that binds the protein tyrosine phosphatases SHP-1 and SHP-2 through its cytoplasmic region and is abundantly expressed on dendritic cells and macrophages. Here we show that mice expressing a mutant form of SHPS-1 fail to develop type-II collagen (CII)-induced arthritis (CIA), a model for rheumatoid arthritis in humans. Histological examinations of the arthritic paws from immunized wild-type mice revealed that cartilage was destroyed in association with marked mononuclear cell infiltration, while only mild cell infiltration was observed in immunized SHPS-1 mutant mice. Consistently, the serum levels of both IgG and IgG2a specific to CII andmore » of IL-1{beta} in immunized SHPS-1 mutant mice were markedly reduced compared with those apparent for wild-type mice. The CII-induced proliferation of, and production of cytokines by, T cells from immunized SHPS-1 mutant mice were reduced compared to wild-type cells. These results suggest that SHPS-1 is essential for development of CIA.« less

  14. Nuclease-resistant double-stranded DNA controls or standards for hepatitis B virus nucleic acid amplification assays

    PubMed Central

    2009-01-01

    Background Identical blood samples tested using different kits can give markedly different hepatitis B virus (HBV) DNA levels, which can cause difficulty in the interpretation of viral load. A universal double-stranded DNA control or standard that can be used in all commercial HBV DNA nucleic acid amplification assay kits is urgently needed. By aligning all HBV genotypes (A-H), we found that the surface antigen gene and precore-core gene regions of HBV are the most conserved regions among the different HBV genotypes. We constructed a chimeric fragment by overlapping extension polymerase chain reaction and obtained a 1,349-bp HBVC+S fragment. We then packaged the fragment into lambda phages using a traditional lambda phage cloning procedure. Results The obtained armored DNA was resistant to DNase I digestion and was stable, noninfectious to humans, and could be easily extracted using commercial kits. More importantly, the armored DNA may be used with all HBV DNA nucleic acid amplification assay kits. Conclusions The lambda phage packaging system can be used as an excellent expression platform for armored DNA. The obtained armored DNA possessed all characteristics of an excellent positive control or standard. In addition, this armored DNA is likely to be appropriate for all commercial HBV DNA nucleic acid amplification detection kits. Thus, the constructed armored DNA can probably be used as a universal positive control or standard in HBV DNA assays. PMID:20025781

  15. A point mutation (L1015F) of the voltage-sensitive sodium channel gene associated with lambda-cyhalothrin resistance in Apolygus lucorum (Meyer-Dür) population from the transgenic Bt cotton field of China.

    PubMed

    Zhen, Congai; Gao, Xiwu

    2016-02-01

    In China, the green mirid bug, Apolygus lucorum (Meyer-Dür), has caused severe economic damage to many kinds of crops, especially the cotton and jujubes. Pyrethroid insecticides have been widely used for controlling this pest in the transgenic Bt cotton field. Five populations of A. lucorum collected from cotton crops at different locations in China were evaluated for lambda-cyhalothrin resistance. The results showed that only the population collected from Shandong Province exhibited 30-fold of resistance to lambda-cyhalothrin. Neither PBO nor DEF had obvious synergism when compared the synergistic ratio between SS and RR strain which was originated from the Shandong population. Besides, there were no statistically significant differences (p>0.05) in the carboxylesterase, glutathione S-transferase, or 7-ethoxycoumarin O-deethylase activities between the Shandong population and the laboratory susceptible strain (SS). The full-length sodium channel gene named AlVSSC encoding 2028 amino acids was obtained by RT-PCR and rapid amplification of cDNA ends (RACE). One single point mutation L1015F in the AlVSSC was detected only in the Shandong population. Our results revealed that the L1015F mutation associated with pyrethroid resistance was identified in A. lucorum populations in China. These results will be useful for the rational chemical control of A. lucorum in the transgenic Bt cotton field. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Understanding Emission From The Ism In The Milky Way And Other Galaxies Using [Nii] And Other Tracers

    NASA Astrophysics Data System (ADS)

    Goldsmith, Paul

    We propose to combine recently-obtained data on the far-infrared fine structure lines of ionized nitrogen ([NII]) with studies of radio continuum and other far-infrared lines, to address a number of key questions about the structure of the interstellar medium, star formation, and to bootstrap our detailed understanding of processes in the Milky Way to more distant galaxies. The [CII] 158 μm line is the most powerful single far-infrared line emitted by galaxies, but since carbon can be ionized by photons having wavelengths longer than required to ionized hydrogen, [CII] emission can originate in atomic, molecular, and ionized regions. Due to its ionization potential being higher than that of hydrogen, nitrogen is a more selective tracer than carbon, and can serve as a critical ingredient to determine how much of the [CII] emission is produced in HII regions powered by massive young stars. We propose to take advantage of a newly-completed Herschel survey of the Galactic plane in both of the [NII] lines at 205 μm and 122 μm wavelength, complementing the GOT C+ survey of [CII]. The relative intensity of the two [NII] lines is a direct indicator of the electron density, and thus allows determination of the N+ column density. With the two data sets we can then determine what fraction of the [CII] emission is produced in HII regions, and what may be from the more diffuse components, thus enabling reconciliation of the Herschel and COBE measurements of this critical tracer. We also propose to use Planck and WMAP all-sky maps of the radio free-free emission to determine the emission measure. Comparison with the electron density and ionized nitrogen column density enables a novel probe of clumpiness in this component of the interstellar medium in addition to giving an improved method of determining the overall Galactic electron density distribution. A second aspect of our investigation of clumpiness will be to utilize the fact that each [NII] observation with the PACS instrument on Herschel consists of 25 spectra on a 5x5 grid. Using these, we will compare derived column densities and electron densities over these small regions to assess the degree of clumpiness. A third input to our analysis of inhomogeneities will be to compare the Planck & WMAP images of selected regions with much higher resolution ground-based data from survey such as CORNISH and GALFACTS. We also will use the improved understanding of [CII] and [NII] emission to develop a template for use in interpreting emission of these (and possibly other) tracers from other galaxies. We will be able to calculate the relative luminosities of these two tracers as a function of Galactocentric distance in the Milky Way, which will be available for comparison with existing and future data on other galaxies. This very active field suffers from an inability to distinguish the multiple sources of [CII] emission, and the understanding of how this spectral line works as a tracer of star formation is of very great interest to a large community of extragalactic astronomers. Together these studies will significantly improve our understanding of [CII] emission and its role as a coolant of the ISM, and the role of HII regions produced by massive young stars as sources of far-infrared line emission. In addition to a better appreciation of the life cycle of the interstellar medium, this work will also set the stage for better understanding of far-infrared emission from other galaxies though development of an improved Milky Way template. All of the data have been taken and are available including our own Herschel [NII] data, which have been reduced. As indicated in the proposal, we have made a limited demonstration of the required techniques, so that we are confident that this proposal will yield the desired new information and astrophysical results.

  17. Sequencing analysis of mutations induced by N-ethyl-N-nitrosourea at different sampling times in mouse bone marrow.

    PubMed

    Wang, Jianyong; Chen, Tao

    2010-03-01

    In our previous study (Wang et al., 2004, Toxicol. Sci. 82: 124-128), we observed that the cII gene mutant frequency (MF) in the bone marrow of Big Blue mice showed significant increase as early as day 1, reached the maximum at day 3 and then decreased to a plateau by day 15 after a single dose of carcinogen N-ethyl-N-nitrosourea (ENU) treatment, which is different from the longer mutation manifestation time and the constancy of MFs after reaching their maximum in some other tissues. To determine the mechanism underlying the quick increase in MF and the peak formation in the mutant manifestation, we examined the mutation frequencies and spectra of the ENU-induced mutants collected from different sampling times in this study. The cII mutants from days 1, 3 and 120 after ENU treatment were randomly selected from different animals. The mutation frequencies were 33, 217, 305 and 144 x 10(-6) for control, days 1, 3, and 120, respectively. The mutation spectra at days 1 and 3 were significantly different from that at day 120. Considering that stem cells are responsible for the ultimate MF plateau (day 120) and transit cells are accountable for the earlier MF induction (days 1 or 3) in mouse bone marrow, we conclude that transit cells are much more sensitive to mutation induction than stem cells in mouse bone marrow, which resulted in the specific mutation manifestation induced by ENU.

  18. Mutations That Improve the pRE Promoter of Coliphage Lambda

    PubMed Central

    Mahoney, Michael E.; Wulff, Daniel L.

    1987-01-01

    The dya5 mutation, a C→T change at position -43 of the λ pRE promoter, results in a twofold increase in pRE activity in vivo. Smaller increases in pRE activity are found for the dya2 mutation, a T→C change at position -1 of pRE, and the dya3 mutation, an A→G change at +5 of pRE. The mutant p RE promoters retain complete dependence on cII protein for activity. These observations argue, at least for pRE-like promoters, that promoter activities are influenced by nucleotide sequences at least eight nucleotides to the 5'-side of the conventional -35 region consensus sequence, and by nucleotide sequences near the start-site of transcription. Although Hawley and McClure (1983) found A·T pairs more frequently than G·TC pairs in the region of -40 to -45 of prokaryotic promoters, other mutations that change a G·TC pair to an A·T pair at positions -41, -44 and -45 of pRE do not result in increased promoter activity. We also found that a T→C change at position -42 results in a mild decrease in promoter activity. These observations argue that Ts at positions -42 and -43 of pRE are required for maximum promoter activity, but do not support the hypothesis that As and Ts in the -40 to -45 region generally lead to higher promoter activities. PMID:2953648

  19. [The expression of interferon-lambda1 in CHO cell].

    PubMed

    Yuan, Wu-Mei; Ma, Fen-Lian; Zhang, Qian; Zheng, Wen-Zhi; Zheng, Li-Shu

    2013-06-01

    To construct the eukaryotic expression vector PCI-dhfr-lambda1 and PCI-dhfr-SP163-lambda1 which linked the enhancer SP163 with interferon lambda1. Then express the interferon lambda1 in CHO (dhfr-) cells. Using PCR method to introduce the restriction enzyme sites and through the fusion PCR binding the enhancer with the interferon Lambda1. After sequenced, lambda1 and SP163-lambda1 was inserted into PCI-dhfr forming the expression vector PCI-dhfr-lambda1 and PCI-dhfr-SP163-lambda1 which was constructed successfully confirming by sequencing. Then the expressing vectors were transfected into CHO (dhfr-) cells using liposome transfection method and interferon lambda1 protein was assayed with indirect immunofluorescence and Western Blot. Using cytopathic effect inhibition evaluated the antiviral activity of interferon lambda1. Successfully constructing the eukaryotic expression vectors of interferon lambda and the vectors could express interferon lambda1. The result of immunofluorescence showed the enhancer developed the expression of interferon lambda1. Detecting the interferon lambda1 in CHO (dhfr-) cells after transfecting 48 hour using Western Blot. The cytopathic effect inhibition showed the expressed interferon lambda1 has the antiviral activity. Successfully expressed the interferon lambda1 in CHO (dhfr-) cells and the protein possesses antiviral activity, which may supply a valuable basis for building the stable cell line of interferon lambda1.

  20. Energy of the ground and 2{sup +} excited states of {sub {lambda}}{sub {lambda}}{sup 10}Be: A partial ten-body model

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Shoeb, Mohammad; Sonika

    2009-08-15

    The energies of the ground and excited 2{sup +} states of {sub {lambda}}{sub {lambda}}{sup 10}Be have been calculated variationally in the Monte Carlo framework. The hypernucleus is treated as a partial ten-body problem in the {lambda}{lambda}+{alpha}{alpha} model where nucleonic degrees of freedom of {alpha}'s are taken into consideration ignoring the antisymmetrization between two {alpha}'s. The central two-body {lambda}N and {lambda}{lambda} and the three-body dispersive and two-pion exchange {lambda}NN forces, constrained by the {lambda}p scattering data and the observed ground state energies of {sub {lambda}}{sup 5}He and {sub {lambda}}{sub {lambda}}{sup 6}He, are employed. The product-type trial wave function predicts binding energymore » for the ground state considerably less than for the event reported by Danysz et al.; however, it is consistent with the value deduced assuming a {gamma} ray of 3.04 MeV must have escaped undetected in the decay of the product {sub {lambda}}{sup 9}Be* {yields} {sub {lambda}}{sup 9}Be+{gamma} of the emulsion event {sub {lambda}}{sub {lambda}}{sup 10}Be{yields} {pi}{sup -}+p+{sub {lambda}}{sup 9}Be* and for the excited 2{sup +} state closer to the value measured in the Demachi-Yanagi event. The hypernucleus {sub {lambda}}{sub {lambda}}{sup 10}Be has an oblate shape in the excited state. These results are consistent with the earlier four-body {alpha} cluster model approach where {alpha}'s are assumed to be structureless entities.« less

  1. The TIME-Pilot intensity mapping experiment

    NASA Astrophysics Data System (ADS)

    Crites, A. T.; Bock, J. J.; Bradford, C. M.; Chang, T. C.; Cooray, A. R.; Duband, L.; Gong, Y.; Hailey-Dunsheath, S.; Hunacek, J.; Koch, P. M.; Li, C. T.; O'Brient, R. C.; Prouve, T.; Shirokoff, E.; Silva, M. B.; Staniszewski, Z.; Uzgil, B.; Zemcov, M.

    2014-08-01

    TIME-Pilot is designed to make measurements from the Epoch of Reionization (EoR), when the first stars and galaxies formed and ionized the intergalactic medium. This will be done via measurements of the redshifted 157.7 um line of singly ionized carbon ([CII]). In particular, TIME-Pilot will produce the first detection of [CII] clustering fluctuations, a signal proportional to the integrated [CII] intensity, summed over all EoR galaxies. TIME-Pilot is thus sensitive to the emission from dwarf galaxies, thought to be responsible for the balance of ionizing UV photons, that will be difficult to detect individually with JWST and ALMA. A detection of [CII] clustering fluctuations would validate current theoretical estimates of the [CII] line as a new cosmological observable, opening the door for a new generation of instruments with advanced technology spectroscopic array focal planes that will map [CII] fluctuations to probe the EoR history of star formation, bubble size, and ionization state. Additionally, TIME-Pilot will produce high signal-to-noise measurements of CO clustering fluctuations, which trace the role of molecular gas in star-forming galaxies at redshifts 0 < z < 2. With its unique atmospheric noise mitigation, TIME-Pilot also significantly improves sensitivity for measuring the kinetic Sunyaev-Zel'dovich (kSZ) effect in galaxy clusters. TIME-Pilot will employ a linear array of spectrometers, each consisting of a parallel-plate diffraction grating. The spectrometer bandwidth covers 185-323 GHz to both probe the entire redshift range of interest and to include channels at the edges of the band for atmospheric noise mitigation. We illuminate the telescope with f/3 horns, which balances the desire to both couple to the sky with the best efficiency per beam, and to pack a large number of horns into the fixed field of view. Feedhorns couple radiation to the waveguide spectrometer gratings. Each spectrometer grating has 190 facets and provides resolving power above 100. At this resolution, the longest dimension of the grating is 31 cm, which allows us to stack gratings in two blocks (one for each polarization) of 16 within a single cryostat, providing a 1x16 array of beams in a 14 arcminute field of view. Direct absorber TES sensors sit at the output of the grating on six linear facets over the output arc, allowing us to package and read out the detectors as arrays in a modular manner. The 1840 detectors will be read out with the NIST time-domain-multiplexing (TDM) scheme and cooled to a base temperature of 250 mK with a 3He sorption refrigerator. We present preliminary designs for the TIME-Pilot cryogenics, spectrometers, bolometers, and optics.

  2. Evolution of the iss gene in Escherichia coli.

    PubMed

    Johnson, Timothy J; Wannemuehler, Yvonne M; Nolan, Lisa K

    2008-04-01

    The increased serum survival gene iss has long been recognized for its role in extraintestinal pathogenic Escherichia coli (ExPEC) virulence. iss has been identified as a distinguishing trait of avian ExPEC but not of human ExPEC. This gene has been localized to large virulence plasmids and shares strong similarities with the bor gene from bacteriophage lambda. Here, we demonstrate that three alleles of iss occur among E. coli isolates that appear to have evolved from a common lambda bor precursor. In addition to the occurrence of iss on the ColV/BM virulence plasmids, at least two iss alleles occur within the E. coli chromosome. One of these alleles (designated type 3) was found to occur in the genomes of all currently sequenced ExPEC strains on a similar prophage element that also harbors the Sit iron and manganese transport system. When the prevalence of the three iss types was examined among 487 E. coli isolates, the iss type 3 gene was found to occur at a high frequency among ExPEC isolates, irrespective of the host source. The plasmid-borne iss allele (designated type 1) was highly prevalent among avian pathogenic E. coli and neonatal meningitis-associated E. coli isolates but not among uropathogenic E. coli isolates. This study demonstrates the evolution of iss in E. coli and provides an additional tool for discriminating among E. coli pathotypes through the differentiation of the three iss allele types and bor.

  3. Beauty Baryons at CDF and DO

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kryemadhi, Abaz

    The results from Tevatron in the baryonic sector are presented. The lifetime of {lambda}b {yields} J/{psi}{lambda}, the observation of hadronic decay of {lambda}b {yields} {lambda}c{pi}, the semileptonic decays of {lambda}b {yields} {lambda}c{mu}{nu}, the hadronization of the b-baryons, and the {lambda}b decays to {lambda}b {yields} p{pi} and {lambda}b {yields} pK are discussed. These measurements paint a nice picture of our understanding of the beauty baryons.

  4. Improved measurement of the form factors in the decay lambda+c-->lambda + nue.

    PubMed

    Hinson, J W; Huang, G S; Lee, J; Miller, D H; Pavlunin, V; Rangarajan, R; Sanghi, B; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Park, C S; Park, W; Thayer, J B; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Stroynowski, R; Artuso, M; Boulahouache, C; Blusk, S; Dambasuren, E; Dorjkhaidav, O; Mountain, R; Muramatsu, H; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Csorna, S E; Danko, I; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Patterson, J R; Peterson, D; Pivarski, J; Richichi, S J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Wilksen, T; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stoeck, H; Yelton, J; Benslama, K; Cawlfield, C; Eisenstein, B I; Gollin, G D; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Besson, D; Anderson, S; Frolov, V V; Gong, D T; Kubota, Y; Li, S Z; Poling, R; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z; Seth, K K; Tomaradze, A; Zweber, P; Ahmed, S; Alam, M S; Ernst, J; Jian, L; Saleem, M; Wappler, F; Arms, K; Eckhart, E; Gan, K K; Gwon, C; Honscheid, K; Kagan, H; Kass, R; Pedlar, T K; von Toerne, E; Severini, H; Skubic, P; Dytman, S A; Mueller, J A; Nam, S; Savinov, V

    2005-05-20

    Using the CLEO detector at the Cornell Electron Storage Ring, we have studied the distribution of kinematic variables in the decay lambda(+)(c)lambda--> e(+)nu(e). By performing a four-dimensional maximum likelihood fit, we determine the form factor ratio, R= f(2)/f(1) = -0.31 +/- 0.05(stat) +/- 0.04(syst), the pole mass, M(pole) = [2.21 +/- 0.08(stat) +/- 0.14(syst)] GeV/c(2), and the decay asymmetry parameter of the lambda(+)(c), alpha (lambda(c)) = -0.86 +/-0.03(stat) +/- 0.02(syst), for q(2) = 0.67 (GeV/c(2))(2). We compare the angular distributions of the lambda(+)(c) and lambda(-)(c) and find no evidence for CP violation: A(lambda(c)) = (alpha(lambda(c)) + alpha (lambda(c)))/(alpha(lambda(c))-alpha(lambda(c))) = 0.00 +/- 0.03(stat) +/- 0.01(syst) +/- 0.02, where the third error is from the uncertainty in the world average of the CP-violating parameter, A(lambda), for ppi(-).

  5. Why aye-ayes see blue.

    PubMed

    Melin, Amanda D; Moritz, Gillian L; Fosbury, Robert A E; Kawamura, Shoji; Dominy, Nathaniel J

    2012-03-01

    The capacity for cone-mediated color vision varies among nocturnal primates. Some species are colorblind, having lost the functionality of their short-wavelength-sensitive-1 (SWS1) opsin pigment gene. In other species, such as the aye-aye (Daubentonia madagascariensis), the SWS1 gene remains intact. Recent studies focused on aye-ayes indicate that this gene has been maintained by natural selection and that the pigment has a peak sensitivity (lambda(max)) of 406 nm, which is -20 nm closer to the ultraviolet region of the spectrum than in most primates. The functional significance behind the retention and unusual lambda(max) of this opsin pigment is unknown, and it is perplexing given that all mammals are presumed to be colorblind in the dark. Here we comment on this puzzle and discuss recent findings on the color vision intensity thresholds of terrestrial vertebrates with comparable optics to aye-ayes. We draw attention to the twilight activities of aye-ayes and report that twilight is enriched in short-wavelength (bluish) light. We also show that the intensity of twilight and full moonlight is probably sufficient to support cone-mediated color vision. We speculate that the intact SWS1 opsin pigment gene of aye-ayes is a crepuscular adaptation and we report on the blueness of potential visual targets, such as scent marks and the brilliant blue arils of Ravenala madagascariensis.

  6. Observation of B{sup 0}{yields}{lambda}{lambda}K{sup 0} and B{sup 0}{yields}{lambda}{lambda}K*{sup 0} at Belle

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chang, Y.-W.; Wang, M.-Z.; Chao, Y.

    2009-03-01

    We study the charmless decays B{yields}{lambda}{lambda}h, where h stands for {pi}{sup +}, K{sup +}, K{sup 0},K*{sup +}, or K*{sup 0}, using a 605 fb{sup -1} data sample collected at the {upsilon}(4S) resonance with the Belle detector at the KEKB asymmetric energy e{sup +}e{sup -} collider. We observe B{sup 0}{yields}{lambda}{lambda}K{sup 0} and B{sup 0}{yields}{lambda}{lambda}K*{sup 0} with branching fractions of (4.76{sub -0.68}{sup +0.84}(stat){+-}0.61(syst))x10{sup -6} and (2.46{sub -0.72}{sup +0.87}{+-}0.34)x10{sup -6}, respectively. The significances of these signals in the threshold-mass enhanced mass region, M{sub {lambda}}{sub {lambda}}<2.85 GeV/c{sup 2}, are 12.4{sigma} and 9.3{sigma}, respectively. We also update the branching fraction B(B{sup +}{yields}{lambda}{lambda}K{sup +})=(3.38{sub -0.36}{sup +0.41}{+-}0.41)x10{supmore » -6} with better accuracy, and report the following measurement or 90% confidence level upper limit in the threshold-mass-enhanced region: B(B{sup +}{yields}{lambda}{lambda}K*{sup +})=(2.19{sub -0.88}{sup +1.13}{+-}0.33)x10{sup -6} with 3.7{sigma} significance; B(B{sup +}{yields}{lambda}{lambda}{pi}{sup +})<0.94x10{sup -6}. A related search for B{sup 0}{yields}{lambda}{lambda}D{sup 0} yields a branching fraction B(B{sup 0}{yields}{lambda}{lambda}D{sup 0})=(1.05{sub -0.44}{sup +0.57}{+-}0.14)x10{sup -5}. This may be compared with the large, {approx}10{sup -4}, branching fraction observed for B{sup 0}{yields}ppD{sup 0}. The M{sub {lambda}}{sub {lambda}} enhancements near threshold and related angular distributions for the observed modes are also reported.« less

  7. Initiation of lambda DNA replication. The Escherichia coli small heat shock proteins, DnaJ and GrpE, increase DnaK's affinity for the lambda P protein.

    PubMed

    Osipiuk, J; Georgopoulos, C; Zylicz, M

    1993-03-05

    It is known that the initiation of bacteriophage lambda replication requires the orderly assembly of the lambda O.lambda P.DnaB helicase protein preprimosomal complex at the ori lambda DNA site. The DnaK, DnaJ, and GrpE heat shock proteins act together to destabilize the lambda P.DnaB complex, thus freeing DnaB and allowing it to unwind lambda DNA near the ori lambda site. The first step of this disassembly reaction is the binding of DnaK to the lambda P protein. In this report, we examined the influence of the DnaJ and GrpE proteins on the stability of the lambda P.DnaK complex. We present evidence for the existence of the following protein-protein complexes: lambda P.DnaK, lambda P.DnaJ, DnaJ.DnaK, DnaK.GrpE, and lambda P.DnaK.GrpE. Our results suggest that the presence of GrpE alone destabilizes the lambda P.DnaK complex, whereas the presence of DnaJ alone stabilizes the lambda P.DnaK complex. Using immunoprecipitation, we show that in the presence of GrpE, DnaK exhibits a higher affinity for the lambda P.DnaJ complex than it does alone. Using cross-linking with glutaraldehyde, we show that oligomeric forms of DnaK exhibit a higher affinity for lambda P than monomeric DnaK. However, in the presence of GrpE, monomeric DnaK can efficiently bind lambda P protein. These findings help explain our previous results, namely that in the GrpE-dependent lambda DNA replication system, the DnaK protein requirement can be reduced up to 10-fold.

  8. A new macroseismic intensity prediction equation and magnitude estimates of the 1811-1812 New Madrid and 1886 Charleston, South Carolina, earthquakes

    NASA Astrophysics Data System (ADS)

    Boyd, O. S.; Cramer, C. H.

    2013-12-01

    We develop an intensity prediction equation (IPE) for the Central and Eastern United States, explore differences between modified Mercalli intensities (MMI) and community internet intensities (CII) and the propensity for reporting, and estimate the moment magnitudes of the 1811-1812 New Madrid, MO, and 1886 Charleston, SC, earthquakes. We constrain the study with North American census data, the National Oceanic and Atmospheric Administration MMI dataset (responses between 1924 and 1985), and the USGS ';Did You Feel It?' CII dataset (responses between June, 2000 and August, 2012). The combined intensity dataset has more than 500,000 felt reports for 517 earthquakes with magnitudes between 2.5 and 7.2. The IPE has the basic form, MMI=c1+c2M+c3exp(λ)+c4λ. where M is moment magnitude and λ is mean log hypocentral distance. Previous IPEs use a limited dataset of MMI, do not differentiate between MMI and CII data in the CEUS, nor account for spatial variations in population. These factors can have an impact at all magnitudes, especially the last factor at large magnitudes and small intensities where the population drops to zero in the Atlantic Ocean and Gulf of Mexico. We assume that the number of reports of a given intensity have hypocentral distances that are log-normally distributed, the distribution of which is modulated by population and the propensity for individuals to report their experience. We do not account for variations in stress drop, regional variations in Q, or distance-dependent geometrical spreading. We simulate the distribution of reports of a given intensity accounting for population and use a grid search method to solve for the fraction of population to report the intensity, the standard deviation of the log-normal distribution and the mean log hypocentral distance, which appears in the above equation. We find that lower intensities, both CII and MMI, are less likely to be reported than greater intensities. Further, there are strong spatial variations in the level of CII reporting. For example, large metropolitan areas appear to have a lower level of reporting relative to rural areas. In general, we find that intensities decrease with increasing distance and decreasing magnitude, as expected. Coefficients for the IPE are c1=1.98×0.13 c2=1.76×0.02 c3=-0.0027×0.0004, and c4=-1.26×0.03. We find significant differences in mean log hypocentral distance between MMI- and CII-based reporting, particularly at smaller mean log distance and higher intensity. Values of mean log distance for CII at high intensity tend to be smaller than for MMI at the same value of intensity. The new IPE leads to magnitude estimates for the 1811-1812 New Madrid earthquakes that are within the broad range of those determined previously. Using three MMI datasets for the New Madrid mainshocks, the new relation results in estimates for the moment magnitudes of the December 16th, 1811, January 23rd, 1812, and February 7th, 1812 mainshocks and December 16th dawn aftershock of 7.1¬¬-7.4, 7.2, 7.5-7.7, and 6.7-7.2, respectively, with a magnitude uncertainty of about ×0.4 units. We estimate a magnitude of 7.0×0.3 for the 1886 Charleston, SC earthquake.

  9. Constraining star formation through redshifted CO and CII emission in archival CMB data

    NASA Astrophysics Data System (ADS)

    Switzer, Eric

    LCDM is a strikingly successful paradigm to explain the CMB anisotropy and its evolution into observed galaxy clustering statistics. The formation and evolution of galaxies within this context is more complex and only partly characterized. Measurements of the average star formation and its precursors over cosmic time are required to connect theories of galaxy evolution to LCDM evolution. The fine structure transition in CII at 158 um traces star formation rates and the ISM radiation environment. Cold, molecular gas fuels star formation and is traced well by a ladder of CO emission lines. Catalogs of emission lines in individual galaxies have provided the most information about CII and CO to-date but are subject to selection effects. Intensity mapping is an alternative approach to measuring line emission. It surveys the sum of all line radiation as a function of redshift, and requires angular resolution to reach cosmologically interesting scales, but not to resolve individual sources. It directly measures moments of the luminosity function from all emitting objects. Intensity mapping of CII and CO can perform an unbiased census of stars and cold gas across cosmic time. We will use archival COBE-FIRAS and Planck data to bound or measure cosmologically redshifted CII and CO line emission through 1) the monopole spectrum, 2) cross-power between FIRAS/Planck and public galaxy survey catalogs from BOSS and the 2MASS redshift surveys, 3) auto-power of the FIRAS/Planck data itself. FIRAS is unique in its spectral range and all-sky coverage, provided by the space-borne FTS architecture. In addition to sensitivity to a particular emission line, intensity mapping is sensitive to all other contributions to surface brightness. We will remove CMB and foreground spatial and spectral templates using models from WMAP and Planck data. Interlopers and residual foregrounds additively bias the auto-power and monopole, but both can still be used to provide rigorous upper bounds. The cross-power with galaxy surveys directly constrains the redshifted line emission. Residual foregrounds and interlopers increase errors but do not add bias. There are 300 resolution elements of the 7 degree FIRAS top-hat inside the BOSS quasar survey, spanning 66 spectral pixels to z 2. While FIRAS noise per voxel is 200 times brighter than the expected peak cosmological CII emission, strt-N averaging of spatial and spectral modes above results in a gain of 140. Intensity mapping is in its infancy, with predictions for surface brightness of line emission ranging over an order of magnitude, and limited knowledge of the intensity-weighted bias. Even if only upper bounds are possible, they complement existing measurements of individual galaxies, which can constitute a lower bound because they measure only a portion of the luminosity function. FIRAS and Planck provide unique opportunities to pursue CII and CO intensity mapping with well-characterized instruments that overlap with galaxy surveys in angular coverage and redshift. We will re-analyze the FIRAS data to optimize sensitivity and robustness, developing a spectral line response model, splitting the data into sub-missions to isolate noise properties, and re- evaluating data cuts. The tools and results here will support future survey concepts with significantly lower noise, such as PIXIE, PRISM, SPHEREX and proposed suborbital experiments designed specifically for intensity mapping. There is a growing appreciation that many phenomena could lie just below the published FIRAS bounds. The proposed work is an early step toward this new science.

  10. Do Postpartum Levels of Apolipoproteins Prospectively Predict the Development of Type 2 Diabetes in Women with Previous Gestational Diabetes Mellitus?

    PubMed

    Lappas, Martha; Georgiou, Harry M; Velagic, Anida; Willcox, Jane C; Permezel, Michael; Shub, Alexis

    2018-03-12

    The risk of developing type 2 diabetes is greater in women with previous gestational diabetes mellitus (GDM). Apolipoprotein (Apo) species have been associated with the development of type 2 diabetes in the general population. The aim of this study was to determine if circulating levels of Apo species can predict development of type 2 diabetes in women with previous GDM. Apo AI, Apo AII, Apo B, Apo CII, Apo CIII and Apo E levels were measured in 95 women with normal glucose tolerance, 12 weeks following an index GDM pregnancy. Women were assessed for up to 10 years for the development of type 2 diabetes. Postpartum Apo CIII levels, and Apo CIII/Apo AI, Apo CIII/Apo AII, Apo CIII/Apo CII, Apo CIII/Apo E and Apo E/Apo CIII ratios were significantly and positively associated with the development of type 2 diabetes. After controlling for age and BMI, these associations, except for the Apo E/Apo CIII ratio, remained significant. In a clinical model of prediction of type 2 diabetes that included age, BMI, and pregnancy and postnatal fasting glucose, the addition of Apo CIII levels, Apo CIII/Apo AI, Apo CIII/Apo AII, Apo CIII/Apo CII, and Apo CIII/Apo E resulted in a net reclassification improvement of 16.2%. High Apo CIII levels and the Apo CIII/Apo AI, Apo CIII/Apo AII, Apo CIII/Apo CII, and Apo CIII/Apo E ratios are all significant risk factors for the development of type 2 diabetes in women with a previous GDM pregnancy. © Georg Thieme Verlag KG Stuttgart · New York.

  11. Dynamics of the CMZ - Giant Magnetic Loops Connection in the Galactic Center

    NASA Astrophysics Data System (ADS)

    Langer, William

    2012-10-01

    Understanding the mass transfer and dynamics among the Galactic Center, the disk, and the halo of the Milky Way is fundamental to the study of the evolution of galaxies and star formation. Several giant molecular loops (GML), detected in CO maps of the Galactic Center, are likely the result of the magnetic Parker instability. We have new evidence of a possible dynamical connection between these loops and the Central Molecular Zone (CMZ) from a sparse [CII] sampling from our Herschel Open Time Key Project GOT C+. The CMZ-GML region is dynamically active and is likely to have a significant ionized component. However, we have no information on the distribution and dynamics of the ionized gas. The fine-structure lines of [NII] are key probes of the warm ionized medium (WIM) and along with the [CII] can isolate the different ionization components. We have a Herschel OT2 Priority 1 program to map the GML and the CMZ-GML connection in [CII] in more detail. However, we did not propose needed [NII] observations due to an incomplete analysis of our limited GOT C+ data at the time. Here we propose to observe with the SOFIA/GREAT instrument, [NII] in the CMZ-GML interface region using the L1b band, and serendipitously CO (16-15) using band L2. With this data, combined with our Herschel HIFI [CII], Mopra 12CO (1-0) and 13CO (1-0), and HI, we will characterize these important ISM components and their motions in these Galactic Center features. These observations of the nearest such regions of galactic center activity, also have bearing on the dynamics of other galactic nuclei.

  12. Rapidly star-forming galaxies adjacent to quasars at redshifts exceeding 6

    PubMed Central

    Decarli, R.; Walter, F.; Venemans, B.P.; Bañados, E.; Bertoldi, F.; Carilli, C.; Fan, X.; Farina, E.P.; Mazzucchelli, C.; Riechers, D.; Rix, H.-W.; Strauss, M.A.; Wang, R.; Yang, Y.

    2017-01-01

    The existence of massive (1011 Msun) elliptical galaxies by redshift z~4[1,2,3] (when the Universe was 1.5 billion years old) necessitates the presence of galaxies with star formation rates SFR>100 Msun/yr at z>6 (corresponding to an age of the Universe of less than 1 billion years). Surveys have discovered hundreds of galaxies at these early cosmic epochs, but their star formation rates are more than an order of magnitude lower[4]. The only known examples of very high rate galaxies at z>6 are, with only one exception[5], quasar host galaxies[6,7,8,9], i.e. galaxies that host an accreting supermassive (~109 Msun) black hole that likely affects the host properties. Here we report observations of the [CII] 158 μm line in 4 galaxies that are companions of quasars, with velocity offsets of less than 600 kilometres per second and linear offsets of less than 100 kiloparsecs. The discovery of these four galaxies was serendipitous; they are close to their companion quasars and appear bright in the far-infrared. Based upon the [CII] measurements, we estimate star formation rates of >100 Msun/yr. These sources are similar to the quasar hosts in [CII] brightness, line width and implied dynamical masses, but do not show evidence for accreting supermassive black holes. Similar systems have previously been found at lower redshift[10,11,12]. We find such close companions in 4 out of 25 z>6 quasars surveyed, a fraction that needs to be accounted for in simulations[13,14]. If representative of the bright end of the [CII] luminosity function, they can account for the population of massive elliptical galaxies at z~4 in terms of cosmic space density. PMID:28541326

  13. Physical interactions between bacteriophage and Escherichia coli proteins required for initiation of lambda DNA replication.

    PubMed

    Liberek, K; Osipiuk, J; Zylicz, M; Ang, D; Skorko, J; Georgopoulos, C

    1990-02-25

    The process of initiation of lambda DNA replication requires the assembly of the proper nucleoprotein complex at the origin of replication, ori lambda. The complex is composed of both phage and host-coded proteins. The lambda O initiator protein binds specifically to ori lambda. The lambda P initiator protein binds to both lambda O and the host-coded dnaB helicase, giving rise to an ori lambda DNA.lambda O.lambda P.dnaB structure. The dnaK and dnaJ heat shock proteins have been shown capable of dissociating this complex. The thus freed dnaB helicase unwinds the duplex DNA template at the replication fork. In this report, through cross-linking, size chromatography, and protein affinity chromatography, we document some of the protein-protein interactions occurring at ori lambda. Our results show that the dnaK protein specifically interacts with both lambda O and lambda P, and that the dnaJ protein specifically interacts with the dnaB helicase.

  14. The Th1/Th2 paradigm in lambda cyhalothrin-induced spleen toxicity: The role of thymoquinone.

    PubMed

    Hussein, Mohamed M A; Ahmed, Mona M

    2016-01-01

    This study investigates the retrofitted role of thymoquinone (TQ) in the Th1/Th2 paradigm imbalance in lambda-cyhalothrin (LCT) treated rats. Four groups of male Wistar rats were formed: Group I served as control. Group II received 5 mg TQ/(kg bw) daily. Group III received 0.6 mg LCT/(kg bw). Group IV was treated with TQ and LCT. All treatments were given orally for 10 weeks. The LCT-treated group elicited a significant increase in MDA and NO levels with up-regulation of NF-κB/p65 and pro-inflammatory genes expression and their levels. Meanwhile, GSH and immunoglobulins concentrations were markedly decreased concomitant with lessening the activities of antioxidant enzymes and anti-inflammatory cytokine genes mRNA levels. The co-administration of TQ and LCT improved the altered antioxidant enzymes activities and concentration of cytokines with attenuation of NF-κB/p65 mRNA. These data support the antioxidant role of TQ in the Th1/Th2 imbalance paradigm during LCT toxicity. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. ArgO145, a Stx2a prophage of a bovine O145:H- STEC strain, is closely related to phages of virulent human strains.

    PubMed

    Krüger, A; Burgán, J; Friedrich, A W; Rossen, J W A; Lucchesi, P M A

    2018-06-01

    Shiga toxins (Stx) are the main virulence factor of a pathogroup of Escherichia coli strains that cause severe human diseases. These toxins are encoded in prophages (Stx prophages), and generally their expression depends on prophage induction. Several studies have reported high diversity among both Stx prophages and Stx. In particular, the toxin subtype Stx2a is associated with high virulence and HUS. Here, we report the genome of ArgO145, an inducible Stx2a prophage identified in a bovine O145:H- strain which produced high levels of Shiga toxin and Stx phage particles. The ArgO145 genome shared lambda phage organization, with recombination, regulation, replication, lysis, and head and tail structural gene regions, although some lambda genes encoding regulatory proteins could not be identified. Remarkably, some Stx2a phages of strains isolated from patients in other countries showed high similarity to ArgO145. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Thermoresistant revertants of an Escherichia coli strain carrying tif-1 and ruv mutations: non-suppressibility of ruv by sfi.

    PubMed Central

    Otsuji, N; Iyehara-Ogawa, H

    1979-01-01

    Spontaneous thermoresistant revertants were isolated from Tif1 Ruv- and Tif1 Ruv+ strains of Escherichia coli K-12. They were divided into five groups; backmutants to tif+ and recA structural gene mutants accounted for at least two of these groups. Mutations with an unconditional RecA- phenyotype were detected at a higher frequency in the Tif1 Ruv- strains (65%) than in the Tif1 Ruv+ strains (25%). A third group consisted of revertants exhibiting a RecA- phenotype at low temperature. Revertants with normal recombination ability and UV resistance, but with a thermosensitive defect in propagating lambda bio11 phage, were also isolated (group 4). The alleles responsible for this property were cotransducible with the srl gene, suggesting that they are located at the recA locus. Other revertants, which might carry lex, LEXB, or zab mutations, were UV sensitive and were able to propagate lambda bio11 phage (group 5). The sfi mutation, which suppresses filamentation in the Tif1 and UV-sensitive Lon- strains, does not restore UV resistance of the Ruv- mutant. PMID:374356

  17. Tables of Transition Probabilities and Branching Ratios for Electric Dipole Transitions Between Arbitrary Levels of Hydrogen-Like Atoms

    NASA Technical Reports Server (NTRS)

    Omidvar, K.

    1980-01-01

    Branching ratios in hydrogen-like atoms due to electric-dipole transitions are tabulated for the initial principal and angular momentum quantum number n, lambda, and final principal and angular momentum quantum numbers n, lambda. In table 1, transition probabilities are given for transitions n, lambda, yields n, where sums have been made with respect to lambda. In this table, 2 or = n' or = 10, o or = lambda' or = n'-1, and 1 or = n or = n'-1. In addition, averages with respect to lambda' and sums with respect to n, and lifetimes are given. In table 2, branching ratios are given for transitions n' lambda' yields ni, where sums have been made with respect to lambda. In these tables, 2 or = n' or = 10, 0 or = lambda', n'-1, and 1 or = n or = n'-1. Averages with respect to lambda' are also given. In table 3, branching ratios are given for transitions n' lambda' yields in lambda, where 1 or = n or = 5, 0 or = lambda or = n-1, n n' or = 15, and 0 or = lambda' or = n(s), where n(s), is the smaller of the two numbers n'-1 and 6. Averages with respect to lambda' are given.

  18. Measurement of the Λ b cross section and the Λ ¯ b to Λ b ratio with J / ψ Λ decays in pp collisions at s = 7 TeV

    DOE PAGES

    Chatrchyan, S.; Khachatryan, V.; Sirunyan, A. M.; ...

    2012-05-31

    The Lambda(b) differential production cross section and the cross section ratio anti-Lambda(b)/Lambda(b) are measured as functions of transverse momentum pt(Lambda(b)) and rapidity abs(y(Lambda(b))) in pp collisions at sqrt(s) = 7 TeV using data collected by the CMS experiment at the LHC. The measurements are based on Lambda(b) decays reconstructed in the exclusive final state J/Psi Lambda, with the subsequent decays J/Psi to an opposite-sign muon pair and Lambda to proton pion, using a data sample corresponding to an integrated luminosity of 1.9 inverse femtobarns. The product of the cross section times the branching ratio for Lambda(b) to J/Psi Lambda versusmore » pt(Lambda(b)) falls faster than that of b mesons. The measured value of the cross section times the branching ratio for pt(Lambda(b)) > 10 GeV and abs(y(Lambda(b))) < 2.0 is 1.06 +/- 0.06 +/- 0.12 nb, and the integrated cross section ratio for anti-Lambda(b)/Lambda(b) is 1.02 +/- 0.07 +/- 0.09, where the uncertainties are statistical and systematic, respectively.« less

  19. {lambda}{sub b}{yields}p, {lambda} transition form factors from QCD light-cone sum rules

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wang Yuming; Lue Caidian; Shen Yuelong

    2009-10-01

    Light-cone sum rules for the {lambda}{sub b}{yields}p, {lambda} transition form factors are derived from the correlation functions expanded by the twist of the distribution amplitudes of the {lambda}{sub b} baryon. In terms of the {lambda}{sub b} three-quark distribution amplitude models constrained by the QCD theory, we calculate the form factors at small momentum transfers and compare the results with those estimated in the conventional light-cone sum rules (LCSR) and perturbative QCD approaches. Our results indicate that the two different versions of sum rules can lead to the consistent numbers of form factors responsible for {lambda}{sub b}{yields}p transition. The {lambda}{sub b}{yields}{lambda}more » transition form factors from LCSR with the asymptotic {lambda} baryon distribution amplitudes are found to be almost 1 order larger than those obtained in the {lambda}{sub b}-baryon LCSR, implying that the preasymptotic corrections to the baryonic distribution amplitudes are of great importance. Moreover, the SU(3) symmetry breaking effects between the form factors f{sub 1}{sup {lambda}{sub b}}{sup {yields}}{sup p} and f{sub 1}{sup {lambda}{sub b}}{sup {yields}}{sup {lambda}} are computed as 28{sub -8}{sup +14}% in the framework of {lambda}{sub b}-baryon LCSR.« less

  20. First observation and measurement of the resonant structure of the lambda_b->lambda_c pi-pi+pi- decay mode

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Azzurri, P.; Barria, P.; Ciocci, M.A.

    The authors present the first observation of the {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -} decay using data from an integrated luminosity of approximately 2.4 fb{sup -1} of p{bar p} collisions at {radical}s = 1.96 TeV, collected with the CDF II detector at the Fermilab Tevatron. They also present the first observation of the resonant decays {Lambda}{sub b}{sup 0} {yields} {Sigma}{sub c}(2455){sup 0} {pi}{sup +}{pi}{sup -} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -}, {Lambda}{sub b}{sup 0} {yields} {Sigma}{sub c}(2455){sup ++}{pi}{sup -}{pi}{sup -} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -}, {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}(2595){sup +}{pi}{sup -}more » {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -} and {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}(2625){sup +}{pi}{sup -} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -}, and measure their relative branching ratios.« less

  1. Spin correlations in the {Lambda}{Lambda} and {Lambda}{Lambda}-bar systems generated in relativistic heavy-ion collisions

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lyuboshitz, V. L.; Lyuboshitz, V. V., E-mail: Valery.Lyuboshitz@jinr.r

    2010-05-15

    Spin correlations for the {Lambda}{Lambda} and {Lambda}{Lambda}-bar pairs, generated in relativistic heavy-ion collisions, and related angular correlations at the joint registration of hadronic decays of two hyperons, in which space parity is not conserved, are analyzed. The correlation tensor components can be derived from the double angular distribution of products of two decays by the method of 'moments'. The properties of the 'trace' of the correlation tensor (a sum of three diagonal components), determining the relative fractions of the triplet states and singlet state of respective pairs, are discussed. Spin correlations for two identical particles ({Lambda}{Lambda}) and two nonidentical particlesmore » ({Lambda}{Lambda}-bar) are considered from the viewpoint of the conventional model of one-particle sources. In the framework of this model, correlations vanish at sufficiently large relative momenta. However, under these conditions, in the case of two nonidentical particles ({Lambda}{Lambda}-bar) a noticeable role is played by two-particle annihilation (two-quark, two-gluon) sources, which lead to the difference of the correlation tensor from zero. In particular, such a situation may arise when the system passes through the 'mixed phase.'« less

  2. Probing the Epoch of Reionization via CII Tomography with TIME-Pilot

    NASA Astrophysics Data System (ADS)

    Bradford, Matt; Crites, Abigail; Hunacek, Jonathon; Hailey-Dunsheath, Steve; Zemcov, Michael B.; Bock, James; Cooray, Asantha R.; Chang, Tzu-Ching; Li, Chao-Te; Bumble, Bruce; Shirokoff, Erik; Staniszewski, Zachary; O'Brient, Roger; Shiu, Corwin; Cheng, Yun-Ting; Uzgil, Bade

    2016-01-01

    Deep UV dropout surveys in small fields shown that the EoR galaxies are intrinsically faint, even on the scale of the deepest Hubble, JWST, and ALMA surveys. The luminosity functions show steep and/or uncertain faint-end slopes, so that the total light integral is poorly constrained. 3-D tomographic intensity mapping of a bright spectral line can probe the nature of the EoR galaxies in aggregate via their imprint on large-scale structure. Specifically, the 2-halo clustering signal on ~degree scales is sensitive to the luminosity function integral.TIME-Pilot is designed for a first measurement of EoR clustering via the 158-micron [CII] transition redshifted into the millimeter band. 32 waveguide spectrometers disperse the 183-326 GHz band (z=5.5-9 for [CII]) at resolving power of 100 to arrays totaling 1840 TES bolometers, all cooled to below 300 mK. TIME-Pilot will be deployed to the JCMT, and the survey volume will consist of an on-sky footprint of 1 degree (~150 cmlc) by 1 beam (~0.8 cMpc), with depth ~1200 cMpc provided by the spectral coverage. Our models indicate that the raw sensitivity of TIME-Pilot is sufficient to provide a detection of the [CII] clustering signal in a couple of hundred hours on sky. However, the dominant signal in the experiment will be the CO-emitting galaxies at z~0.5 to 3. This signal is interesting in its own right, but will need to be measured and removed to reveal the [CII].TIME-Pilot is also ideally suited to measure the kSZ effect due to peculiar velocities in galaxy clusters. While previous kSZ surveys have been limited by imperfect atmospheric subtraction, TIME-Pilot will use a unique atmospheric subtraction technique demonstrated with Z-Spec, in which the water vapor fluctuations are monitored via total power measurements at the spectrometer band edges, and removed from the science dataset. Finally, the instrument includes 11 broad-band 150-GHz photometers to measure the tSZ effect in the decrement. TIME-Pilot has a kSZ sensitivity of 500 km/s in an 8 hour observation, 5 times improved over previous experiments and sufficient to enable the first cosmological kSZ surveys.

  3. UTILIZING SYNTHETIC UV SPECTRA TO EXPLORE THE PHYSICAL BASIS FOR THE CLASSIFICATION OF LAMBDA BOÖTIS STARS

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.

    2016-04-15

    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates usmore » to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.« less

  4. Clinical features and genetic analysis of three patients with severe hypertriglyceridaemia.

    PubMed

    Hooper, Amanda J; Kurtkoti, Jagadeesh; Hamilton-Craig, Ian; Burnett, John R

    2014-07-01

    Hypertriglyceridaemia is a common biochemical abnormality that can be due to primary causes or, more commonly, secondary causes. Moderate hypertriglyceridaemia is a risk factor for cardiovascular disease and can develop into severe hypertriglyceridaemia which is a risk factor for acute pancreatitis. Familial chylomicronaemia is a rare autosomal recessive disorder, usually diagnosed in childhood and is characterized by marked hypertriglyceridaemia and biochemical deficiency of lipoprotein lipase (LPL), apolipoprotein (apo) C-II, homozygous (or compound heterozygous) gene mutations in LPL or more rarely, APOC2. Recently, loss-of-function mutations in the APOA5 gene have been reported in patients with severe hypertriglyceridaemia in whom LPL or APOC2 mutations were not found. We describe the clinical features and genetic analysis of three patients with severe hypertriglyceridaemia including novel mutations LPL c.464T>C (p.Leu155Pro) and APOA5 c.823C>T (p.Gln275*). © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  5. Bivariate- distribution for transition matrix elements in Breit-Wigner to Gaussian domains of interacting particle systems.

    PubMed

    Kota, V K B; Chavda, N D; Sahu, R

    2006-04-01

    Interacting many-particle systems with a mean-field one-body part plus a chaos generating random two-body interaction having strength lambda exhibit Poisson to Gaussian orthogonal ensemble and Breit-Wigner (BW) to Gaussian transitions in level fluctuations and strength functions with transition points marked by lambda = lambda c and lambda = lambda F, respectively; lambda F > lambda c. For these systems a theory for the matrix elements of one-body transition operators is available, as valid in the Gaussian domain, with lambda > lambda F, in terms of orbital occupation numbers, level densities, and an integral involving a bivariate Gaussian in the initial and final energies. Here we show that, using a bivariate-t distribution, the theory extends below from the Gaussian regime to the BW regime up to lambda = lambda c. This is well tested in numerical calculations for 6 spinless fermions in 12 single-particle states.

  6. Correlation Measurement of Lambda-anti-Lambda, Lambda-Lambda and anti-Lambda-anti-Lambda with the ATLAS detector at s=7 TeV

    NASA Astrophysics Data System (ADS)

    Cheng, Hok-Chuen

    This thesis summaries the measurements of correlations between Lambda 0Lambda0, Lambda0Lambda 0, and Lambda0Lambda 0 hyperon pairs produced inclusively at the LHC, which are useful for a better understanding of the quark-antiquark pair production and jet fragmentation and hadronization processes. The analysis is based on hyperon pairs selected using the muon and minimum bias data samples collected at the ATLAS experiment from proton-proton collisions at a center-of-mass energy of 7 TeV in 2010. Excess Lambda0Lambda 0 are observed near the production threshold and are identified to be originated from the parton system in the string model in the MC sample, decaying either directly or through heavy strange resonances such as Sigma0 and Sigma*(1385). Dynamical correlations have been explored through a correlation function defined as the ratio of two-particle to single-particle densities. Positive correlation is observed for Lambda0Lambda0 and anticorrelation is observed for Lambda0Lambda 0 and Lambda0Lambda 0 for Q in [0,2] GeV. The structure replicates similar correlations in pp, pp, and pppp events in PYTHIA generator as predicted by the Lund string fragmentation model. Parameters of the "popcorn" mechanism implemented in the PYTHIA generator are tuned and are found to have little impact on the structure observed. The spin composition of the sample is extracted using a data-driven reference sample built by event mixing. Appropriate corrections have been made to the kinematic distributions in the reference sample by kinematic weighting to make sure that the detector effects are well modeled. A modified Pearson's chi2 test statistics is calculated for the costheta* distribution to determine the best-fitted A-value for data. The results are consistent with zero for both like-type and unlike-type hyperon pairs in Q ∈ [0,10] GeV and Q ∈ [1,10] GeV respectively. The data statistics in the range of Q ∈ [0, 1] GeV is currently too low for the estimation of the emitter size for Fermi-Dirac correlation.

  7. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Akaishi, Yoshinori; College of Science and Technology, Nihon University, Funabashi 274-8501; Myint, Khin Swe

    The overbinding problem of {sub {lambda}}{sup 5}He is solved by introducing a concept of coherent {lambda}-{sigma} coupling which is equivalent to a {lambda}NN three-body force. This three-body force is coherently enhanced in the 0{sup +} states of {sub {lambda}}{sup 4}H and {sub {lambda}}{sup 4}He. The 0{sup +}-1{sup +} splitting in these hypernuclei is mainly due to coherent {lambda}-{sigma} coupling and partly due to the {lambda}N spin-spin interaction. A {lambda}NN three-body potential is derived from the coupled-channel treatment. The origin of the repulsive and attractive nature of the three-body force is discussed. Coherent {lambda}-{sigma} coupling becomes more important in neutron-rich hypernucleimore » and especially in neutron-star matter at high densities. The possible existence of ''hyperheavy hydrogen'', {sub {lambda}}{sup 6}H, is suggested.« less

  8. Tamoxifen mutagenesis and carcinogenesis in livers of lambda/lacI transgenic rats: selective influence of phenobarbital promotion.

    PubMed

    Styles, J A; Davies, R; Fenwick, S; Walker, J; White, I N; Smith, L L

    2001-01-10

    Administration of tamoxifen (TAM) (20 mg/kg per day p.o.) for 6 weeks to female lambda/lacI transgenic rats caused a 4-fold increase in mutation frequency (MF) at the lacI gene locus in the livers of dosed animals compared with controls. After cessation of dosing, the MF showed a further increase with time at 2, 12 and 24 weeks, respectively. Phenobarbital promotion of similarly treated animals resulted in no increase in mutation frequency compared with TAM alone. Treatment with phenobarbital or TAM+phenobarbital resulted in time-dependent increases in liver weight compared with the corresponding controls. There was an increase in cell proliferation in the phenobarbital and TAM+phenobarbital groups, and at 24 weeks in the TAM dosed animals compared with controls. There was also a progressive increase in the number of GST-P expressing foci in the livers of TAM and TAM + phenobarbital rats compared with controls. The induction of cell proliferation and GSTP foci in the rat liver by phenobarbital is consistent with its ability to promote tamoxifen-initiated liver tumours in the rat. If the lacI gene is regarded as being representative of the rat genome in general (albeit that the gene is bacterial) the above observations suggest that promotion by tamoxifen confers selective advantage on mutated genes at loci that contribute to the tumour phenotype and that promotion of rat liver tumours by tamoxifen is not dependent simply upon the enhancement of cellular proliferation.

  9. Role of the Escherichia coli grpE heat shock protein in the initiation of bacteriophage lambda DNA replication.

    PubMed

    Osipiuk, J; Zylicz, M

    1991-01-01

    Initiation of replication of lambda DNA requires assembly of the proper nucleoprotein complex consisting of the lambda origin of replication-lambda O-lambda P-dnaB proteins. The dnaJ, dnaK and grpE heat shock proteins destabilize the lambda P-dnaB interaction in this complex permitting dnaB helicase to unwind lambda DNA near ori lambda sequence. First step of this disassembling reaction is the binding of dnaK protein to lambda P protein. In this report we examined the influence of dnaJ and grpE proteins on stability of the lambda P-dnaK complex. Our results show that grpE alone dissociates this complex, but both grpE and dnaJ together do not. These results suggest that, in the presence of grpE protein, dnaK protein has a higher affinity for lambda P protein complexed with dnaJ protein than in the situation where grpE protein is not used.

  10. Measurement of sigma Lambda b0/sigma B0 x B(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-) in pp collisions at square root s=1.96 TeV.

    PubMed

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Le, Y; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tseng, J; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-03-23

    We present the first observation of the baryon decay Lambda b0-->Lambda c+pi- followed by Lambda c+-->pK-pi+ in 106 pb-1 pp collisions at square root s=1.96 TeV in the CDF experiment. In order to reduce systematic error, the measured rate for Lambda b0 decay is normalized to the kinematically similar meson decay B0-->D+pi- followed by D+-->pi+K-pi+. We report the ratio of production cross sections (sigma) times the ratio of branching fractions (B) for the momentum region integrated above pT>6 GeV/c and pseudorapidity range |eta|<1.3: sigma(pp-->Lambda b0X)/sigma(pp-->B0X)xB(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-)=0.82+/-0.08(stat)+/-0.11(syst)+/-0.22[B(Lambda c+-->pK-pi+)].

  11. Stable carbon isotope fractionation during the biodegradation of lambda-cyhalothrin.

    PubMed

    Shen, Xiaoli; Xu, Zemin; Zhang, Xichang; Yang, Fangxing

    2015-11-01

    In this study, the microbial degradation of lambda-cyhalothrin in soil was investigated using compound-specific stable isotope analysis. The results revealed that lambda-cyhalothrin was biodegraded in soil under laboratory conditions. The half-lives of lambda-cyhalothrin were determined to be 49 and 161 days in non-sterile and sterile soils spiked with 2mg/kg lambda-cyhalothrin and 84 and 154 days in non-sterile and sterile soils spiked with 10mg/kg lambda-cyhalothrin, respectively. The biodegradation of lambda-cyhalothrin resulted in carbon isotope fractionation, which shifted from -29.0‰ to -26.5‰ in soil spiked with 2mg/kg lambda-cyhalothrin, and to -27.5‰ with 10mg/kg lambda-cyhalothrin. A relationship was established between the stable carbon isotope fraction and the residual concentrations of lambda-cyhalothrin by the Rayleigh equation in which the carbon isotope enrichment factor ε of the microbial degradation of lambda-cyhalothrin in the soil was calculated as -2.53‰. This study provides an approach to quantitatively evaluate the biodegradation of lambda-cyhalothrin in soil in field studies. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Dynamics of a family of transcendental meromorphic functions having rational Schwarzian derivative

    NASA Astrophysics Data System (ADS)

    Sajid, M.; Kapoor, G. P.

    2007-02-01

    In the present paper, a class of critically finite transcendental meromorphic functions having rational Schwarzian derivative is introduced and the dynamics of functions in one parameter family is investigated. It is found that there exist two parameter values [lambda]*=[phi](0)>0 and , where and is the real root of [phi]'(x)=0, such that the Fatou sets of f[lambda](z) for [lambda]=[lambda]* and [lambda]=[lambda]** contain parabolic domains. A computationally useful characterization of the Julia set of the function f[lambda](z) as the complement of the basin of attraction of an attracting real fixed point of f[lambda](z) is established and applied for the generation of the images of the Julia sets of f[lambda](z). Further, it is observed that the Julia set of explodes to whole complex plane for [lambda]>[lambda]**. Finally, our results found in the present paper are compared with the recent results on dynamics of one parameter families [lambda]tanz, [R.L. Devaney, L. Keen, Dynamics of meromorphic maps: Maps with polynomial Schwarzian derivative, Ann. Sci. Ecole Norm. Sup. 22 (4) (1989) 55-79; L. Keen, J. Kotus, Dynamics of the family [lambda]tan(z), Conform. Geom. Dynam. 1 (1997) 28-57; G.M. Stallard, The Hausdorff dimension of Julia sets of meromorphic functions, J. London Math. Soc. 49 (1994) 281-295] and , [lambda]>0 [G.P. Kapoor, M. Guru Prem Prasad, Dynamics of : The Julia set and bifurcation, Ergodic Theory Dynam. Systems 18 (1998) 1363-1383].

  13. Jovian Chromophore Characteristics from Multispectral HST Images

    NASA Technical Reports Server (NTRS)

    Strycker, Paul D.; Chanover, Nancy J.; Simon-Miller, Amy A.; Banfield, Don; Gierasch, Peter J.

    2011-01-01

    The chromophores responsible for coloring the jovian atmosphere are embedded within Jupiter's vertical aerosol structure. Sunlight propagates through this vertical distribution of aerosol particles, whose colors are defined by omega-bar (sub 0)(lambda), and we remotely observe the culmination of the radiative transfer as I/F(lambda). In this study, we employed a radiative transfer code to retrieve omega-bar (sub 0)(lambda) for particles in Jupiter's tropospheric haze at seven wavelengths in the near-UV and visible regimes. The data consisted of images of the 2008 passage of Oval BA to the south of the Great Red Spot obtained by the Wide Field Planetary Camera 2 on-board the Hubble Space Telescope. We present derived particle colors for locations that were selected from 14 weather regions, which spanned a large range of observed colors. All omega-bar (sub 0)(lambda) curves were absorbing in the blue, and omega-bar (sub 0)(lambda) increased monotonically to approximately unity as wavelength increased. We found accurate fits to all omega-bar (sub 0)(lambda) curves using an empirically derived functional form: omega-bar (sub 0)(lambda) = 1 A exp(-B lambda). The best-fit parameters for the mean omega-bar (sub 0)(lambda) curve were A = 25.4 and B = 0.0149 for lambda in units of nm. We performed a principal component analysis (PCA) on our omega-bar (sub 0)(lambda) results and found that one or two independent chromophores were sufficient to produce the variations in omega-bar (sub 0)(lambda). A PCA of I/F(lambda) for the same jovian locations resulted in principal components (PCs) with roughly the same variances as the omega-bar (sub 0)(lambda) PCA, but they did not result in a one-to-one mapping of PC amplitudes between the omega-bar (sub 0)(lambda) PCA and I/F(lambda) PCA. We suggest that statistical analyses performed on I/ F(lambda) image cubes have limited applicability to the characterization of chromophores in the jovian atmosphere due to the sensitivity of 1/ F(lambda) to horizontal variations in the vertical aerosol distribution.

  14. Stability engineering of anti-EGFR scFv antibodies by rational design of a lambda-to-kappa swap of the VL framework using a structure-guided approach.

    PubMed

    Lehmann, Andreas; Wixted, Josephine H F; Shapovalov, Maxim V; Roder, Heinrich; Dunbrack, Roland L; Robinson, Matthew K

    2015-01-01

    Phage-display technology facilitates rapid selection of antigen-specific single-chain variable fragment (scFv) antibodies from large recombinant libraries. ScFv antibodies, composed of a VH and VL domain, are readily engineered into multimeric formats for the development of diagnostics and targeted therapies. However, the recombinant nature of the selection strategy can result in VH and VL domains with sub-optimal biophysical properties, such as reduced thermodynamic stability and enhanced aggregation propensity, which lead to poor production and limited application. We found that the C10 anti-epidermal growth factor receptor (EGFR) scFv, and its affinity mutant, P2224, exhibit weak production from E. coli. Interestingly, these scFv contain a fusion of lambda3 and lambda1 V-region (LV3 and LV1) genes, most likely the result of a PCR aberration during library construction. To enhance the biophysical properties of these scFvs, we utilized a structure-based approach to replace and redesign the pre-existing framework of the VL domain to one that best pairs with the existing VH. We describe a method to exchange lambda sequences with a more stable kappa3 framework (KV3) within the VL domain that incorporates the original lambda DE-loop. The resulting scFvs, C10KV3_LV1DE and P2224KV3_LV1DE, are more thermodynamically stable and easier to produce from bacterial culture. Additionally, C10KV3_LV1DE and P2224KV3_LV1DE retain binding affinity to EGFR, suggesting that such a dramatic framework swap does not significantly affect scFv binding. We provide here a novel strategy for redesigning the light chain of problematic scFvs to enhance their stability and therapeutic applicability.

  15. Mechanisms of Hyperbilirubinemia During Peginterferon Lambda-1a Therapy for Chronic Hepatitis C Infection: A Retrospective Investigation.

    PubMed

    Zwirtes, Ricardo; Narasimhan, Premkumar; Wind-Rotolo, Megan M; Xu, Dong; Hruska, Matthew W; Kishnani, Narendra; Colston, Elizabeth M; Srinivasan, Subasree

    2016-11-01

    The phase 2b EMERGE study compared the efficacy/safety of peginterferon lambda-1a (Lambda) and peginterferon alfa-2a (Alfa), both with ribavirin (RBV), for treatment of chronic hepatitis C virus (HCV) infection. A key safety finding was a higher frequency of hyperbilirubinemia with Lambda/RBV versus Alfa/RBV. To characterize mechanisms of hyperbilirubinemia associated with Lambda/RBV, we conducted a retrospective analysis of safety data from the HCV genotype 1 and genotype 4 cohort of the EMERGE study. Subjects were randomized to once-weekly Lambda (120/180/240 μg) or Alfa (180 μg), with daily RBV, for 48 weeks. Early-onset Lambda/RBV-related hyperbilirubinemia events (6-12 weeks) resulted mostly from RBV-induced hemolysis evidenced by sustained reticulocytosis and a predominantly unconjugated pattern of hyperbilirubinemia. The higher hyperbilirubinemia frequency with Lambda/RBV versus Alfa/RBV was attributed to bone marrow suppression known to occur with Alfa but not Lambda. Late-onset (>12 weeks) Lambda/RBV-related hyperbilirubinemia events occurred most frequently with higher Lambda doses and were associated with increased levels of hepatic transaminase and direct bilirubin fractions compared with early events. This dual pattern of hyperbilirubinemia observed while on Lambda/RBV treatment is thought to be caused by exaggerated RBV-induced hemolysis in early-onset events compared with possible direct Lambda-induced hepatocellular toxicity in late-onset events.

  16. Existence and non-uniqueness of similarity solutions of a boundary-layer problem

    NASA Technical Reports Server (NTRS)

    Hussaini, M. Y.; Lakin, W. D.

    1986-01-01

    A Blasius boundary value problem with inhomogeneous lower boundary conditions f(0) = 0 and f'(0) = - lambda with lambda strictly positive was considered. The Crocco variable formulation of this problem has a key term which changes sign in the interval of interest. It is shown that solutions of the boundary value problem do not exist for values of lambda larger than a positive critical value lambda. The existence of solutions is proven for 0 lambda lambda by considering an equivalent initial value problem. It is found however that for 0 lambda lambda, solutions of the boundary value problem are nonunique. Physically, this nonuniqueness is related to multiple values of the skin friction.

  17. Existence and non-uniqueness of similarity solutions of a boundary layer problem

    NASA Technical Reports Server (NTRS)

    Hussaini, M. Y.; Lakin, W. D.

    1984-01-01

    A Blasius boundary value problem with inhomogeneous lower boundary conditions f(0) = 0 and f'(0) = - lambda with lambda strictly positive was considered. The Crocco variable formulation of this problem has a key term which changes sign in the interval of interest. It is shown that solutions of the boundary value problem do not exist for values of lambda larger than a positive critical value lambda. The existence of solutions is proven for 0 lambda lambda by considering an equivalent initial value problem. It is found however that for 0 lambda lambda, solutions of the boundary value problem are nonunique. Physically, this nonuniqueness is related to multiple values of the skin friction.

  18. Measurement of the Lambda b0 lifetime in Lambda b0-->J/psi Lambda 0 in pp collisions at square root s=1.96 TeV.

    PubMed

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carrillo, S; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Labarga, L; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Liss, T M; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nahn, S; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prokoshin, F; Pronko, A; Proudfoot, J; Ptochos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Tesarek, R J; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-03-23

    We report a measurement of the Lambda b0 lifetime in the exclusive decay Lambda b0-->J/psi Lambda 0 in pp collisions at square root s=1.96 TeV using an integrated luminosity of 1.0 fb-1 of data collected by the CDF II detector at the Fermilab Tevatron. Using fully reconstructed decays, we measure tau(Lambda b0)=1.593(-0.078)(+0.083)(stat)+/-0.033(syst) ps. This is the single most precise measurement of tau(Lambda b0) and is 3.2sigma higher than the current world average.

  19. Observation of the baryonic B decay B{sup 0}{yields}{Lambda}{sub c}{sup +}{Lambda}K{sup -}

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lees, J. P.; Poireau, V.; Tisserand, V.

    2011-10-01

    We report the observation of the baryonic B decay B{sup 0}{yields}{Lambda}{sub c}{sup +}{Lambda}K{sup -} with a significance larger than 7 standard deviations based on 471x10{sup 6} BB pairs collected with the BABAR detector at the PEP-II storage ring at SLAC. We measure the branching fraction for the decay B{sup 0}{yields}{Lambda}{sub c}{sup +}{Lambda}K{sup -} to be (3.8{+-}0.8{sub stat}{+-}0.2{sub sys}{+-}1.0{sub {Lambda}}{sub c}{sup +})x10{sup -5}. The uncertainties are statistical, systematic, and due to the uncertainty in the {Lambda}{sub c}{sup +} branching fraction. We find that the {Lambda}{sub c}{sup +}K{sup -} invariant-mass distribution shows an enhancement above 3.5 GeV/c{sup 2}.

  20. Detection of XerC and XerD recombinases in gram-negative bacteria of the family Enterobacteriaceae.

    PubMed Central

    Sirois, S; Szatmari, G

    1995-01-01

    XerC and XerD are site-specific recombinases of the lambda integrase family which resolve multimeric replicons to monomers by acting at specific sites such as cer, ckr, nmr, parB, and psi, which are found in plasmids, or at the dif site found in the Escherichia coli chromosome. By using Southern hybridizations to cloned E. coli xerC and xerD genes and a cer-nmr plasmid-based resolution assay, the presence of these genes in several species of Enterobacteriaceae is shown. PMID:7608100

  1. Bruton's tyrosine kinase and SLP-65 regulate pre-B cell differentiation and the induction of Ig light chain gene rearrangement.

    PubMed

    Kersseboom, Rogier; Ta, Van B T; Zijlstra, A J Esther; Middendorp, Sabine; Jumaa, Hassan; van Loo, Pieter Fokko; Hendriks, Rudolf W

    2006-04-15

    Bruton's tyrosine kinase (Btk) and the adapter protein SLP-65 (Src homology 2 domain-containing leukocyte-specific phosphoprotein of 65 kDa) transmit precursor BCR (pre-BCR) signals that are essential for efficient developmental progression of large cycling into small resting pre-B cells. We show that Btk- and SLP-65-deficient pre-B cells have a specific defect in Ig lambda L chain germline transcription. In Btk/SLP-65 double-deficient pre-B cells, both kappa and lambda germline transcripts are severely reduced. Although these observations point to an important role for Btk and SLP-65 in the initiation of L chain gene rearrangement, the possibility remained that these signaling molecules are only required for termination of pre-B cell proliferation or for pre-B cell survival, whereby differentiation and L chain rearrangement is subsequently initiated in a Btk/SLP-65-independent fashion. Because transgenic expression of the antiapoptotic protein Bcl-2 did not rescue the developmental arrest of Btk/SLP-65 double-deficient pre-B cells, we conclude that defective L chain opening in Btk/SLP-65-deficient small resting pre-B cells is not due to their reduced survival. Next, we analyzed transgenic mice expressing the constitutively active Btk mutant E41K. The expression of E41K-Btk in Ig H chain-negative pro-B cells induced 1) surface marker changes that signify cellular differentiation, including down-regulation of surrogate L chain and up-regulation of CD2, CD25, and MHC class II; and 2) premature rearrangement and expression of kappa and lambda light chains. These findings demonstrate that Btk and SLP-65 transmit signals that induce cellular maturation and Ig L chain rearrangement independently of their role in termination of pre-B cell expansion.

  2. Transient and Prolonged Response of Chicken Cecum Mucosa to Colonization with Different Gut Microbiota

    PubMed Central

    Volf, Jiri; Polansky, Ondrej; Varmuzova, Karolina; Gerzova, Lenka; Sekelova, Zuzana; Faldynova, Marcela; Babak, Vladimir; Medvecky, Matej; Smith, Adrian L.; Kaspers, Bernd; Velge, Philippe; Rychlik, Ivan

    2016-01-01

    In this study we determined protein and gene expression in the caeca of newly hatched chickens inoculated with cecal contents sourced from hens of different ages. Over 250 proteins exhibited modified expression levels in response to microbiota inoculation. The most significant inductions were observed for ISG12-2, OASL, ES1, LYG2, DMBT1-L, CDD, ANGPTL6, B2M, CUZD1, IgM and Ig lambda chain. Of these, ISG12-2, ES1 and both immunoglobulins were expressed at lower levels in germ-free chickens compared to conventional chickens. In contrast, CELA2A, BRT-2, ALDH1A1, ADH1C, AKR1B1L, HEXB, ALDH2, ALDOB, CALB1 and TTR were expressed at lower levels following inoculation of microbiota. When chicks were given microbiota preparations from different age donors, the recipients mounted differential responses to the inoculation which also differed from the response profile in naturally colonised birds. For example, B2M, CUZD1 and CELA2A responded differently to the inoculation with microbiota of 4- or 40-week-old hens. The increased or decreased gene expression could be recorded 6 weeks after the inoculation of newly hatched chickens. To characterise the proteins that may directly interact with the microbiota we characterised chicken proteins that co-purified with the microbiota and identified a range of host proteins including CDD, ANGPTL6, DMBT1-L, MEP1A and Ig lambda. We propose that induction of ISG12-2 results in reduced apoptosis of host cells exposed to the colonizing commensal microbiota and that CDD, ANGPTL6, DMBT1-L, MEP1A and Ig lambda reduce contact of luminal microbiota with the gut epithelium thereby reducing the inflammatory response. PMID:27685470

  3. Hematopoiesis In The Equine Fetal Liver Suggests Immune Preparedness

    PubMed Central

    Battista, JM; Tallmadge, RL; Stokol, T; Felippe, MJB

    2014-01-01

    We investigated how the equine fetus prepares its pre-immune humoral repertoire for an imminent exposure to pathogens in the neonatal period, particularly how the primary hematopoietic organs are equipped to support B cell hematopoiesis and immunoglobulin (Ig) diversity. We demonstrated that the liver and the bone marrow at approximately 100 days of gestation (DG) are active sites of hematopoiesis based on the expression of signature mRNA (c-KIT, CD34, IL7R, CXCL12, IRF8, PU.1, PAX5, NOTCH1, GATA1, CEBPA) and protein markers (CD34, CD19, IgM, CD3, CD4, CD5, CD8, CD11b, CD172A) of hematopoietic development and leukocyte differentiation molecules, respectively. To verify Ig diversity achieved during the production of B cells, V(D)J segments were sequenced in primary lymphoid organs of the equine fetus and adult horse, revealing that similar heavy chain VDJ segments and CDR3 lengths were most frequently used independent of life stage. In contrast, different lambda light chain segments were predominant in equine fetal compared to adult stage and, surprisingly, the fetus had less restricted use of variable gene segments to construct the lambda chain. Fetal Igs also contained elements of sequence diversity, albeit to a smaller degree than that of the adult horse. Our data suggest that the B cells produced in the liver and bone marrow of the equine fetus generate a wide repertoire of pre-immune Igs for protection, and the more diverse use of different lambda variable gene segments in fetal life may provide the neonate an opportunity to respond to a wider range of antigens at birth. PMID:25179685

  4. tif-1 mutation alters polynucleotide recognition by the recA protein of Escherichia coli.

    PubMed Central

    McEntee, K; Weinstock, G M

    1981-01-01

    The requirements for polynucleotide-dependent hydrolysis of ATP and for proteolytic cleavage of phage lambda repressor have been examined for both the wild-type (recA+ protein) and the tif-1 mutant form [tif(recA) protein] of the recA gene product. The recA+ and tif(recA) proteins catalyze both reactions in the presence of long single-stranded DNAs or certain deoxyhomopolymers. However, short oligonucleotides [(dT)12, (dA)14] stimulate neither the protease nor the ATPase activities of the recA+ protein. In contrast, these short oligonucleotides activate tif(recA) protein to cleave lambda repressor without stimulating its ATPase activity. Moreover, both the ATPase and protease activities of the tif(recA) protein are stimulated by poly(rU) and poly(rC) whereas the recA+ protein does not respond to these ribopolymers. We have purified the recA protein from a strain in which the tif mutation is intragenically suppressed. This mutant protein (recA629) is inactive in the presence of (dT)12, (dA)14, poly(rU), and poly(rC) for lambda repressor cleavage and ATP hydrolysis. These results argue that the tif-1 mutation (or mutations) alters the DNA binding site of the recA protein. We suggest that in vivo the tif(recA) protein is activated for cleaving repressors of SOS genes by complex formation with short single-stranded regions or gaps that normally occur near the growing fork of replicating chromosomes and are too short for activating the recA+ enzyme. This mechanism can account for the expression of SOS functions in the absence of DNA damage in tif mutant strains. Images PMID:7031642

  5. Doublet-spacing enhancement caused by {Lambda}N-{Sigma}N coupling in {sub {Lambda}L}i hypernuclear isotopes

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Umeya, Atsushi; Harada, Toru; Research Center for Physics and Mathematics, Osaka Electro-Communication University, Neyagawa, Osaka 572-8530

    2011-03-15

    We theoretically investigate energy spacings of doublets in {sub {Lambda}L}i hypernuclear isotopes with A=7-10 in shell-model calculations with a {Lambda}N-{Sigma}N coupling effect. The calculated results show that the energy shifts are {Delta}{epsilon}=0.09-0.28 MeV and the {Sigma}-mixing probabilities are P{sub {Sigma}}=0.10%-0.34% in {Lambda} ground states for the isotopes because of the {Lambda}N-{Sigma}N coupling in the first-order perturbation. It is found that the energy spacing of the doublet is enhanced as a neutron number N increases; the contribution of the {Lambda}N-{Sigma}N coupling interaction is comparable to that of the {Lambda}N interaction in the neutron-rich {Lambda} hypernuclei. The coherent mechanism of this doublet-spacingmore » enhancement is also discussed in terms of Fermi-type and Gamow-Teller-type {Lambda}N-{Sigma}N couplings.« less

  6. The role of template superhelicity in the initiation of bacteriophage lambda DNA replication.

    PubMed Central

    Alfano, C; McMacken, R

    1988-01-01

    The prepriming steps in the initiation of bacteriophage lambda DNA replication depend on the action of the lambda O and P proteins and on the DnaB helicase, single-stranded DNA binding protein (SSB), and DnaJ and DnaK heat shock proteins of the E. coli host. The binding of multiple copies of the lambda O protein to the phage replication origin (ori lambda) initiates the ordered assembly of a series of nucleoprotein structures that form at ori lambda prior to DNA unwinding, priming and DNA synthesis steps. Since the initiation of lambda DNA replication is known to occur only on supercoiled templates in vivo and in vitro, we examined how the early steps in lambda DNA replication are influenced by superhelical tension. All initiation complexes formed prior to helicase-mediated DNA-unwinding form with high efficiency on relaxed ori lambda DNA. Nonetheless, the DNA templates in these structures must be negatively supertwisted before they can be replicated. Once DNA helicase unwinding is initiated at ori lambda, however, later steps in lambda DNA replication proceed efficiently in the absence of superhelical tension. We conclude that supercoiling is required during the initiation of lambda DNA replication to facilitate entry of a DNA helicase, presumably the DnaB protein, between the DNA strands. Images PMID:2847118

  7. Escherichia coli mutants impaired in maltodextrin transport.

    PubMed

    Wandersman, C; Schwartz, M; Ferenci, T

    1979-10-01

    Wild-type Escherichia coli K-12 was found to grow equally well on maltose and on maltodextrins containing up to seven glucose residues. Three classes of mutants unable to grow on maltodextrins, but still able to grow on maltose, were investigated in detail. The first class, already known, was composed of phage lambda-resistant mutants, which lack the outer membrane protein coded by gene lamB. These mutants grow on maltose and maltotriose but not at all on maltotetraose and longer maltodextrins which cannot cross the outer membrane. A second class of mutants were affected in malE, the structural gene of the periplasmic maltose binding protein. The maltose binding proteins isolated from the new mutants were altered in their substrate binding properties, but not in a way that could account for the mutant phenotypes. Rather, the results of growth experiments and transport studies suggest that these malE mutants are impaired in their ability to transport maltodextrins across the outer membrane. This implies that the maltose binding protein (in wild-type strains) cooperates with the lambda receptor in permeation through the outer membrane. The last class of mutants described in this paper were affected in malG, or perhaps in an as yet undetected gene close to malG. They were defective in the transfer of maltodextrins from the periplasmic space to the cytoplasm but only slightly affected in the transport of maltose.

  8. Dose and temporal evaluation of ethylene oxide-induced mutagenicity in the lungs of male big blue mice following inhalation exposure to carcinogenic concentrations.

    PubMed

    Manjanatha, Mugimane G; Shelton, Sharon D; Chen, Ying; Parsons, Barbara L; Myers, Meagan B; McKim, Karen L; Gollapudi, B Bhaskar; Moore, Nigel P; Haber, Lynne T; Allen, Bruce; Moore, Martha M

    2017-04-01

    Ethylene oxide (EO) is a direct acting alkylating agent; in vitro and in vivo studies indicate that it is both a mutagen and a carcinogen. However, it remains unclear whether the mode of action (MOA) for cancer for EO is a mutagenic MOA, specifically via point mutation. To investigate the MOA for EO-induced mouse lung tumors, male Big Blue (BB) B6C3F1 mice (10/group) were exposed to EO by inhalation, 6 hr/day, 5 days/week for 4 (0, 10, 50, 100, or 200 ppm EO), 8, or 12 weeks (0, 100, or 200 ppm EO). Lung DNA samples were analyzed for cII mutant frequency (MF) at 4, 8 and 12 weeks of exposure; the mutation spectrum was analyzed for mutants from control and 200 ppm EO treatments. Although EO-induced cII MFs were 1.5- to 2.7-fold higher than the concurrent controls at 4 weeks, statistically significant increases in the cII MF were found only after 8 and 12 weeks of exposure and only at 200 ppm EO (P ≤ 0.05), which is twice the highest concentration used in the cancer bioassay. Consistent with the positive response, DNA sequencing of cII mutants showed a significant shift in the mutational spectra between control and 200 ppm EO following 8 and 12 week exposures (P ≤ 0.035), but not at 4 weeks. Thus, EO mutagenic activity in vivo was relatively weak and required higher than tumorigenic concentrations and longer than 4 weeks exposure durations. These data do not follow the classical patterns for a MOA mediated by point mutations. Environ. Mol. Mutagen. 58:122-134, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  9. A thermodynamically consistent model of the post-translational Kai circadian clock

    PubMed Central

    Lubensky, David K.; ten Wolde, Pieter Rein

    2017-01-01

    The principal pacemaker of the circadian clock of the cyanobacterium S. elongatus is a protein phosphorylation cycle consisting of three proteins, KaiA, KaiB and KaiC. KaiC forms a homohexamer, with each monomer consisting of two domains, CI and CII. Both domains can bind and hydrolyze ATP, but only the CII domain can be phosphorylated, at two residues, in a well-defined sequence. While this system has been studied extensively, how the clock is driven thermodynamically has remained elusive. Inspired by recent experimental observations and building on ideas from previous mathematical models, we present a new, thermodynamically consistent, statistical-mechanical model of the clock. At its heart are two main ideas: i) ATP hydrolysis in the CI domain provides the thermodynamic driving force for the clock, switching KaiC between an active conformational state in which its phosphorylation level tends to rise and an inactive one in which it tends to fall; ii) phosphorylation of the CII domain provides the timer for the hydrolysis in the CI domain. The model also naturally explains how KaiA, by acting as a nucleotide exchange factor, can stimulate phosphorylation of KaiC, and how the differential affinity of KaiA for the different KaiC phosphoforms generates the characteristic temporal order of KaiC phosphorylation. As the phosphorylation level in the CII domain rises, the release of ADP from CI slows down, making the inactive conformational state of KaiC more stable. In the inactive state, KaiC binds KaiB, which not only stabilizes this state further, but also leads to the sequestration of KaiA, and hence to KaiC dephosphorylation. Using a dedicated kinetic Monte Carlo algorithm, which makes it possible to efficiently simulate this system consisting of more than a billion reactions, we show that the model can describe a wealth of experimental data. PMID:28296888

  10. Palmitoylethanolamide and luteolin ameliorate development of arthritis caused by injection of collagen type II in mice.

    PubMed

    Impellizzeri, Daniela; Esposito, Emanuela; Di Paola, Rosanna; Ahmad, Akbar; Campolo, Michela; Peli, Angelo; Morittu, Valeria Maria; Britti, Domenico; Cuzzocrea, Salvatore

    2013-01-01

    N-palmitoylethanolamine (PEA) is an endogenous fatty acid amide belonging to the family of the N-acylethanolamines (NAEs). Recently, several studies demonstrated that PEA is an important analgesic, antiinflammatory, and neuroprotective mediator. The aim of this study was to investigate the effect of co-ultramicronized PEA + luteolin formulation on the modulation of the inflammatory response in mice subjected to collagen-induced arthritis (CIA). CIA was induced by an intradermally injection of 100 μl of the emulsion (containing 100 μg of bovine type II collagen (CII)) and complete Freund adjuvant (CFA) at the base of the tail. On day 21, a second injection of CII in CFA was administered. Mice subjected to CIA were administered PEA (10 mg/kg 10% ethanol, intraperitoneally (i.p.)) or co-ultramicronized PEA + luteolin (1 mg/kg, i.p.) every 24 hours, starting from day 25 to 35. Mice developed erosive hind-paw arthritis when immunized with CII in CFA. Macroscopic clinical evidence of CIA first appeared as periarticular erythema and edema in the hindpaws. The incidence of CIA was 100% by day 28 in the CII-challenged mice, and the severity of CIA progressed over a 35-day period with a resorption of bone. The histopathology of CIA included erosion of the cartilage at the joint. Treatment with PEA or PEA + luteolin ameliorated the clinical signs at days 26 to 35 and improved histologic status in the joint and paw. The degree of oxidative and nitrosative damage was significantly reduced in PEA + luteolin-treated mice, as indicated by nitrotyrosine and malondialdehyde (MDA) levels. Plasma levels of the proinflammatory cytokines and chemokines were significantly reduced by PEA + luteolin treatment. We demonstrated that PEA co-ultramicronized with luteolin exerts an antiinflammatory effect during chronic inflammation and ameliorates CIA.

  11. Palmitoylethanolamide and luteolin ameliorate development of arthritis caused by injection of collagen type II in mice

    PubMed Central

    2013-01-01

    Introduction N-palmitoylethanolamine (PEA) is an endogenous fatty acid amide belonging to the family of the N-acylethanolamines (NAEs). Recently, several studies demonstrated that PEA is an important analgesic, antiinflammatory, and neuroprotective mediator. The aim of this study was to investigate the effect of co-ultramicronized PEA + luteolin formulation on the modulation of the inflammatory response in mice subjected to collagen-induced arthritis (CIA). Methods CIA was induced by an intradermally injection of 100 μl of the emulsion (containing 100 μg of bovine type II collagen (CII)) and complete Freund adjuvant (CFA) at the base of the tail. On day 21, a second injection of CII in CFA was administered. Mice subjected to CIA were administered PEA (10 mg/kg 10% ethanol, intraperitoneally (i.p.)) or co-ultramicronized PEA + luteolin (1 mg/kg, i.p.) every 24 hours, starting from day 25 to 35. Results Mice developed erosive hind-paw arthritis when immunized with CII in CFA. Macroscopic clinical evidence of CIA first appeared as periarticular erythema and edema in the hindpaws. The incidence of CIA was 100% by day 28 in the CII-challenged mice, and the severity of CIA progressed over a 35-day period with a resorption of bone. The histopathology of CIA included erosion of the cartilage at the joint. Treatment with PEA or PEA + luteolin ameliorated the clinical signs at days 26 to 35 and improved histologic status in the joint and paw. The degree of oxidative and nitrosative damage was significantly reduced in PEA + luteolin-treated mice, as indicated by nitrotyrosine and malondialdehyde (MDA) levels. Plasma levels of the proinflammatory cytokines and chemokines were significantly reduced by PEA + luteolin treatment. Conclusions We demonstrated that PEA co-ultramicronized with luteolin exerts an antiinflammatory effect during chronic inflammation and ameliorates CIA. PMID:24246048

  12. KPOT_wlanger_1: State of the Diffuse ISM: Galactic Observations of the Terahertz CII Line (GOT CPlus)

    NASA Astrophysics Data System (ADS)

    Langer, W.

    2007-10-01

    Star formation activity throughout the Galactic disk depends on the thermal and dynamical state of the interstellar gas, which in turn depends on heating and cooling rates, modulated by the gravitational potential and shock and turbulent pressures. Molecular cloud formation, and thus the star formation, may be regulated by pressures in the interstellar medium (ISM). To understand these processes we need information about the properties of the diffuse atomic and diffuse molecular gas clouds, and Photon Dominated Regions (PDR). An important tracer of these regions is the CII line at 158 microns (1900.5 GHz). We propose a "pencil-beam" survey of CII with HIFI band 7b, based on deep integrations and systematic sparse sampling of the Galactic disk plus selected targets, totaling over 900 lines of sight. We will detect both emission and, against the bright inner Galaxy and selected continuum sources, absorption lines. These spectra will provide the astronomical community with a large rich statistical database of the diffuse cloud properties throughout the Galaxy for understanding the Milky Way ISM and, by extension, other galaxies. It will be extremely valuable for determining the properties of the atomic gas, the role of barometric pressure and turbulence in cloud evolution, and the properties of the interface between the atomic and molecular clouds. The CII line is one of the major ISM cooling lines and is present throughout the Galactic plane. It is the strongest far-IR emission line in the Galaxy, with a total luminosity about a 1000 times that of the CO J=1-0 line. Combined with other data, it can be used to determine density, pressure, and radiation environment in gas clouds, and PDRs, and their dynamics via velocity fields. HSO is the best opportunity over the next several years to probe the ISM in this tracer and will provide a template for large-scale surveys with dedicated small telescopes and future surveys of other important ISM tracers.

  13. GOT C+: A Herschel Space Observatory Key Program to Study the Diffuse ISM

    NASA Astrophysics Data System (ADS)

    Langer, William; Velusamy, T.; Goldsmith, P. F.; Li, D.; Pineda, J.; Yorke, H.

    2010-01-01

    Star formation activity is regulated by pressures in the interstellar medium, which in turn depend on heating and cooling rates, modulated by the gravitational potential, and shock and turbulent pressures. To understand these processes we need information about the diffuse atomic and diffuse molecular gas cloud properties. The ionized carbon CII fine structure line at 1.9 THz is an important tracer of the atomic gas in the diffuse regions and the atomic to molecular cloud transformation. Furthermore, C+ is a major ISM coolant, the Galaxy's strongest emission line, with a total luminosity about a 1000 times that of CO J=1-0. Galactic Observations of the Terahertz C+ Line (GOT C+) is a Herschel Space Observatory Open Time Key Program to study the diffuse interstellar medium by sampling CII line emission throughout the Galactic disk. GOT C+ will obtain high spectral resolution CII using the Heterodyne Instrument for the Far Infrared (HIFI) instrument. It employees deep integrations, wide velocity coverage (350 km s-1) with 0.22 km s-1 resolution, and systematic sparse sampling of the Galactic disk together with observations of selected targets, of over 900 lines of sight. It will be a resource of the atomic gas properties, in the (a) Galactic disk, (b) Galaxy's central 300pc, (c) Galactic warp, (d) high latitude HI clouds, and (e) Photon Dominated Regions (PDRs). Along with HI, CO isotopes, and CI spectra, our C+ data will provide the astronomical community with a rich statistical database of diffuse cloud properties, for understanding the role of barometric pressure and turbulence in cloud evolution in the Galactic ISM and, by extension, other galaxies. The GOT C+ project will provide a template for future even larger-scale CII surveys. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology and is supported by a NASA grant.

  14. Herschel HIFI GOT C+ Survey: CII, HI, and CO Emissions in a Sample of Transition Clouds and Star-Forming regions in the Inner Galaxy

    NASA Astrophysics Data System (ADS)

    Pineda, Jorge; Velusamy, Thangasamy; Langer, William D.; Goldsmith, Paul; Li, Di; Yorke, Harold

    The GOT C+ a HIFI Herschel Key Project, studies the diffuse ISM throughout the Galactic Plane, using C+ as cloud tracer. The C+ line at 1.9 THz traces a so-far poorly studied stage in ISM cloud evolution -the transitional clouds going from atomic HI to molecular H2. This transition cloud phase, which is difficult to observe in HI and CO alone, may be best characterized via CII emission or absorption. The C+ line is also an excellent tracer of the warm diffuse gas and the warm, dense gas in the Photon Dominated Regions (PDRs). We can, therefore, use the CII emission as a probe to understand the effects of star formation on their interstellar environment. We present our first results on the transition between dense and hot gas (traced by CII) and dense and cold gas (traced by 12CO and 13CO) along a few representative lines of sight in the inner Galaxy from longitude 325 degrees to 25 degrees, taken during the HIFI Priority Science Phase. Comparisons of the high spectral resolution ( 1 km/s) HIFI data on C+ with HI, 12CO, and 13CO spectra allow us to separate out the different ISM components along each line of sight. Our results provide detailed information about the transition of diffuse atomic to molecular gas clouds needed to understand star formation and the lifecycle of the interstellar gas. These observations are being carried out with the Herschel Space Observatory, which is an ESA cornerstone mission, with contributions from NASA. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration. JLP was supported under the NASA Postdoctoral Program at JPL, Caltech, administered by Oak Ridge Associated Universities through a contract with NASA, and is currently supported as a Caltech-JPL Postdoctoral associate.

  15. SDP_wlanger_3: State of the Diffuse ISM: Galactic Observations of the Terahertz CII Line (GOT CPlus)

    NASA Astrophysics Data System (ADS)

    Langer, W.

    2011-09-01

    Star formation activity throughout the Galactic disk depends on the thermal and dynamical state of the interstellar gas, which in turn depends on heating and cooling rates, modulated by the gravitational potential and shock and turbulent pressures. Molecular cloud formation, and thus the star formation, may be regulated by pressures in the interstellar medium (ISM). To understand these processes we need information about the properties of the diffuse atomic and diffuse molecular gas clouds, and Photon Dominated Regions (PDR). An important tracer of these regions is the CII line at 158 microns (1900.5 GHz). We propose a "pencil-beam" survey of CII with HIFI band 7b, based on deep integrations and systematic sparse sampling of the Galactic disk plus selected targets, totaling over 900 lines of sight. We will detect both emission and, against the bright inner Galaxy and selected continuum sources, absorption lines. These spectra will provide the astronomical community with a large rich statistical database of the diffuse cloud properties throughout the Galaxy for understanding the Milky Way ISM and, by extension, other galaxies. It will be extremely valuable for determining the properties of the atomic gas, the role of barometric pressure and turbulence in cloud evolution, and the properties of the interface between the atomic and molecular clouds. The CII line is one of the major ISM cooling lines and is present throughout the Galactic plane. It is the strongest far-IR emission line in the Galaxy, with a total luminosity about a 1000 times that of the CO J=1-0 line. Combined with other data, it can be used to determine density, pressure, and radiation environment in gas clouds, and PDRs, and their dynamics via velocity fields. HSO is the best opportunity over the next several years to probe the ISM in this tracer and will provide a template for large-scale surveys with dedicated small telescopes and future surveys of other important ISM tracers.

  16. Detector modules and spectrometers for the TIME-Pilot [CII] intensity mapping experiment

    NASA Astrophysics Data System (ADS)

    Hunacek, Jonathon; Bock, James; Bradford, C. Matt; Bumble, Bruce; Chang, Tzu-Ching; Cheng, Yun-Ting; Cooray, Asantha; Crites, Abigail; Hailey-Dunsheath, Steven; Gong, Yan; Li, Chao-Te; O'Brient, Roger; Shirokoff, Erik; Shiu, Corwin; Sun, Jason; Staniszewski, Zachary; Uzgil, Bade; Zemcov, Michael

    2016-07-01

    This proceeding presents the current TIME-Pilot instrument design and status with a focus on the close-packed modular detector arrays and spectrometers. Results of laboratory tests with prototype detectors and spectrometers are discussed. TIME-Pilot is a new mm-wavelength grating spectrometer array under development that will study the Epoch of Reionization (the period of time when the first stars and galaxies ionized the intergalactic medium) by mapping the fluctuations of the redshifted 157:7 μm emission line of singly ionized carbon ([CII]) from redshift z 5:2 to 8:5. As a tracer of star formation, the [CII] power spectrum can provide information on the sources driving reionization and complements 21 cm data (which traces neutral hydrogen in the intergalactic medium). Intensity mapping provides a measure of the mean [CII] intensity without the need to resolve and detect faint sources individually. We plan to target a 1 degree by 0.35 arcminute field on the sky and a spectral range of 199-305 GHz, producing a spatial-spectral slab which is 140 Mpc by 0.9 Mpc on-end and 1230 Mpc in the redshift direction. With careful removal of intermediate-redshift CO sources, we anticipate a detection of the halo-halo clustering term in the [CII] power spectrum consistent with current models for star formation history in 240 hours on the JCMT. TIME-Pilot will use two stacks of 16 parallel-plate waveguide spectrometers (one stack per polarization) with a resolving power R 100 and a spectral range of 183 to 326 GHz. The range is divided into 60 spectral channels, of which 16 at the band edges on each spectrometer serve as atmospheric monitors. The diffraction gratings are curved to produce a compact instrument, each focusing the diffracted light onto an output arc sampled by the 60 bolometers. The bolometers are built in buttable dies of 8 (low freqeuency) or 12 (high frequency) spectral channels by 8 spatial channels and are mated to the spectrometer stacks. Each detector consists of a gold micro-mesh absorber and a titanium transition edge sensor (TES). The detectors (1920 total) are designed to operate from a 250 mK base temperature in an existing cryostat with a photon-noise-dominated NEP of 2 * 10-17 WHz-1-2. A set of flexible superconducting cables connect the detectors to a time-domain multiplexing SQUID readout system.

  17. Assignment of the human type I IMP dehydrogenase gene (IMPDH1) to chromosome 7q31.3-q32

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Gu, Jing Jin; Kaiser-Rogers, K.; Rao, K.

    Two phage {lambda} clones that contain 5{prime} portion of the human type I inosine 5{prime}-monophosphate dehydrogenase (IMPDH, EC 1.1.1.205) gene were isolated. Both polymerase chain reaction analysis of a panel of human-mouse and human-hamster cell somatic hybrids using primers specific for the type I IMPDH gene and fluorescence in situ hybridization with metaphase human chromosome using type I IMPDH genomic DNA as probes indicate that the type I IMPDH gene (symbol IMPDH1) is located on chromosome 7. Sequential GTG-banding was performed to assign the band location of the type I IMPDH gene to chromosome 7q31.3-q32. 16 refs., 1 fig., 1more » tab.« less

  18. Galaxy formation in Lambda greater than 0 Friedmann models: Consequences for the number counts versus redshift test

    NASA Technical Reports Server (NTRS)

    Martel, Hugo

    1994-01-01

    We study the effect of the cosmological constant Lambda on galaxy formation using a simple spherical top-hat overdensity model. We consider models with Omega(sub 0) = 0.2, lambda(sub 0) = 0, and Omega(sub 0) = 0.2, lambda(sub 0) = 0.8 (where Omega(sub 0) is the density parameter, and lambda(sub 0) identically equal Lambda/3 H(sub 0 exp 2) where H(sub 0) is the Hubble constant). We adjust the initial power spectrum amplitude so that both models reproduce the same large-scale structures. The galaxy formation era in the lambda(sub 0) = 0 model occurs early (z approximately 6) and is very short, whereas in the lambda(sub 0) = 0.8 model the galaxy formation era starts later (z approximately 4), and last much longer, possibly all the way to the present. Consequently, galaxies at low redshift (z less than 1) are significantly more evolved in the lambda(sub 0) = 0 model than in the lambda(sub 0) = 0.8 model. This result implies that previous attempts to determine Lambda using the number counts versus redshift test are probably unreliable.

  19. Enhanced detection and identification of Shiga toxin 1 and 2 from pathogenic bacteria by MALDI-TOF-TOF-MS/MS-PSD and top-down proteomic analysis

    USDA-ARS?s Scientific Manuscript database

    Shiga toxin producing Escherichia coli (STEC) represent a continuing threat to the Nation’s food supply and public health. Shiga toxin genes (stx) are encoded in lambda-like bacteriophages whose genome is inserted into the bacterial DNA. Environmental stress can trigger bacteriophage replication a...

  20. Analysis of noise in quorum sensing.

    PubMed

    Cox, Chris D; Peterson, Gregory D; Allen, Michael S; Lancaster, Joseph M; McCollum, James M; Austin, Derek; Yan, Ling; Sayler, Gary S; Simpson, Michael L

    2003-01-01

    Noise may play a pivotal role in gene circuit functionality, as demonstrated for the genetic switch in the bacterial phage lambda. Like the lambda switch, bacterial quorum sensing (QS) systems operate within a population and contain a bistable switching element, making it likely that noise plays a functional role in QS circuit operation. Therefore, a detailed analysis of the noise behavior of QS systems is needed. We have developed a set of tools generally applicable to the analysis of gene circuits, with an emphasis on investigations in the frequency domain (FD), that we apply here to the QS system in the marine bacterium Vibrio fischeri. We demonstrate that a tight coupling between exact stochastic simulation and FD analysis provides insights into the structure/function relationships in the QS circuit. Furthermore, we argue that a noise analysis is incomplete without consideration of the power spectral densities (PSDs) of the important molecular output signals. As an example we consider reversible reactions in the QS circuit, and show through analysis and exact stochastic simulation that these circuits make significant and dynamic modifications to the noise spectra. In particular, we demonstrate a "whitening" effect, which occurs as the noise is processed through these reversible reactions.

  1. Green fluorescent protein as a reporter of gene expression and protein localization.

    PubMed

    Kain, S R; Adams, M; Kondepudi, A; Yang, T T; Ward, W W; Kitts, P

    1995-10-01

    The green fluorescent protein (GFP) from the jellyfish Aequorea victoria is rapidly becoming an important reporter molecule for monitoring gene expression and protein localization in vivo, in situ and in real time. GFP emits bright green light (lambda max = 509 nm) when excited with UV or blue light (lambda max = 395 nm, minor peak at 470 nm). The fluorescence excitation and emission spectra of GFP are similar to those of fluorescein, and the conditions used to visualize this fluorophore are also suitable for GFP. Unlike other bioluminescent reporters, the chromophore in GFP is intrinsic to the primary structure of the protein, and GFP fluorescence does not require a substrate or cofactor. GFP fluorescence is stable, species-independent and can be monitored non-invasively in living cells and, in the case of transparent organisms, whole animals. Here we demonstrate GFP fluorescence in bacterial and mammalian cells and introduce our Living Colors line of GFP reporter vectors, GFP protein and anti-GFP antiserum. The reporter vectors for GFP include a promoterless GFP vector for monitoring the expression of cloned promoters/enhancers in mammalian cells and a series of six vectors for creating fusion protein to either the N or C terminus of GFP.

  2. Development of in-vitro models to elucidate mechanisms of intrinsic cellular and tissue fluorescence

    NASA Astrophysics Data System (ADS)

    Savage, Howard E.; Kolli, Venkateswara; Saha, Sanjoy; Zhang, Jian C.; Glasgold, Mark; Sacks, Peter G.; Alfano, Robert R.; Schantz, Stimson P.

    1995-04-01

    In vitro cell model systems have been used to study the mechanisms of intrinsic cellular and tissue fluorescence as a potential biomarker for cancer. Phenotypic characteristics of cancer that are different from normal tissue include changes in histoarchitecture, proliferation rates and differentiation. a nitrosmethlybenzylamine (NMBA)/rat esophageal carcinogenesis model (NMBA), a transforming growth factor beta (TGF- (beta) )/normal epithelial cell model, and a retinoic acid (RA)/multicellular tumor spheroid model (RAMTS) were used to assess fluorescence changes associated respectively with changes in histoarchitecture, proliferation rates and differentiation. A xenon based fluorescence spectrophotometer (Mediscience Corp.) was used to collect excitation and emission spectra. Two excitation scans ((lambda) Ex 200-360 nm, (lambda) Em 380 nm; (lambda) Ex 240-430 nm, (lambda) Em 450 nm) and two emission scans ((lambda) Ex 300 nm, (lambda) Em 320-580 nm; (lambda) Ex 340 nm, (lambda) Em 360-660 nm) were used to analyze the three model systems. Using the NMBA model. Differences were seen in the excitation scan ((lambda) Ex 200-360 nm, (lambda) Em 380 nm) and the emission scan ((lambda) Ex 340 nm, (lambda) Em 360-660 nm) when normal rat esophageal tissue was compared to hyperplastic and tumor tissue. In the (TGF-(beta) ) model, differences were seen in the excitation scan ((lambda) Ex 240-430 nm, (lambda) Em 450 nm) when comparing proliferation slowed (TGF-(beta) treated) epithelial cells to their untreated controls. In the RAMTS model, differences were seen with all four scans when RA treated multicellular tumor spheroids (nondifferentiating) were compared to untreated control cells (differentiating). The data indicate that fluorescence changes seen in these model systems may relate to changes in histoarchitecture, proliferation rates and differentiation. Their relationship to in vivo fluorescence changes seen in cancer patients remains to be elucidated.

  3. First measurement of the ratio of branching fractions B({lambda}{sub b}{sup 0}{yields}{lambda}{sub c}{sup +}{mu}{sup -}{nu}{sub {mu}})/B({lambda}{sub b}{sup 0}{yields}{lambda}{sub c}{sup +}{pi}{sup -})

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Aaltonen, T.; Maki, T.; Mehtala, P.

    2009-02-01

    This article presents the first measurement of the ratio of branching fractions B({lambda}{sub b}{sup 0}{yields}{lambda}{sub c}{sup +}{mu}{sup -}{nu}{sub {mu}})/B({lambda}{sub b}{sup 0}{yields}{lambda}{sub c}{sup +}{pi}{sup -}). Measurements in two control samples using the same technique B(B{sup 0}{yields}D{sup +}{mu}{sup -}{nu}{sub {mu}})/B(B{sup 0}{yields}D{sup +}{pi}{sup -}) and B(B{sup 0}{yields}D*(2010){sup +}{mu}{sup -}{nu}{sub {mu}})/B(B{sup 0}{yields}D*(2010){sup +}{pi}{sup -}) are also reported. The analysis uses data from an integrated luminosity of approximately 172 pb{sup -1} of pp collisions at {radical}(s)=1.96 TeV, collected with the CDF II detector at the Fermilab Tevatron. The relative branching fractions are measured to be (B({lambda}{sub b}{sup 0}{yields}{lambda}{sub c}{sup +}{mu}{sup -}{nu}{sub {mu}})/B({lambda}{sub b}{sup 0}{yields}{lambda}{sub c}{supmore » +}{pi}{sup -}))=16.6{+-}3.0(stat){+-}1.0(syst)(+2.6/-3.4)(PDG){+-}0.3 (EBR), (B(B{sup 0}{yields}D{sup +}{mu}{sup -}{nu}{sub {mu}})/B(B{sup 0}{yields}D{sup +}{pi}{sup -}))9.9{+-}1.0(stat){+-}0.6(syst){+-}0.4(PDG){+-}0.5(EBR), and (B(B{sup 0}{yields}D*(2010){sup +}{mu}{sup -}{nu}{sub {mu}})/B(B{sup 0}{yields}D*(2010){sup +}{pi}{sup -}))=16.5{+-}2.3(stat){+-} 0.6(syst){+-}0.5(PDG){+-}0.8(EBR). The uncertainties are from statistics (stat), internal systematics (syst), world averages of measurements published by the Particle Data Group or subsidiary measurements in this analysis (PDG), and unmeasured branching fractions estimated from theory (EBR), respectively. This article also presents measurements of the branching fractions of four new {lambda}{sub b}{sup 0} semileptonic decays: {lambda}{sub b}{sup 0}{yields}{lambda}{sub c}(2595){sup +}{mu}{sup -}{nu}{sub {mu}}, {lambda}{sub b}{sup 0}{yields}{lambda}{sub c}(2625){sup +}{mu}{sup -}{nu}{sub {mu}}, {lambda}{sub b}{sup 0}{yields}{sigma}{sub c}(2455){sup 0}{pi}{sup +}{mu}{sup -}{nu}{sub {mu}}, and {lambda}{sub b}{sup 0}{yields}{sigma}{sub c}(2455){sup ++}{pi}{sup -}{mu}{sup -}{nu}{sub {mu}}, relative to the branching fraction of the {lambda}{sub b}{sup 0}{yields}{lambda}{sub c}{sup +}{mu}{sup -}{nu}{sub {mu}} decay. Finally, the transverse-momentum distribution of {lambda}{sub b}{sup 0} baryons produced in pp collisions is measured and found to be significantly different from that of B{sup 0} mesons, which results in a modification in the production cross-section ratio {sigma}{sub {lambda}{sub b}{sup 0}}/{sigma}{sub B{sup 0}} with respect to the CDF I measurement.« less

  4. Insecticide-Mediated Up-Regulation of Cytochrome P450 Genes in the Red Flour Beetle (Tribolium castaneum)

    PubMed Central

    Liang, Xiao; Xiao, Da; He, Yanping; Yao, Jianxiu; Zhu, Guonian; Zhu, Kun Yan

    2015-01-01

    Some cytochrome P450 (CYP) genes are known for their rapid up-regulation in response to insecticide exposures in insects. To date, however, limited information is available with respect to the relationships among the insecticide type, insecticide concentration, exposure duration and the up-regulated CYP genes. In this study, we examined the transcriptional response of eight selected CYP genes, including CYP4G7, CYP4Q4, CYP4BR3, CYP12H1, CYP6BK11, CYP9D4, CYP9Z5 and CYP345A1, to each of four insecticides in the red flour beetle, Tribolium castaneum. Reverse transcription quantitative PCR (RT-qPCR) revealed that CYP4G7 and CYP345A1 can be significantly up-regulated by cypermethrin (1.97- and 2.06-fold, respectively), permethrin (2.00- and 2.03-fold) and lambda-cyhalothrin (1.73- and 1.81-fold), whereas CYP4BR3 and CYP345A1 can be significantly up-regulated by imidacloprid (1.99- and 1.83-fold) when 20-day larvae were exposed to each of these insecticides at the concentration of LC20 for 24 h. Our studies also showed that similar levels of up-regulation can be achieved for CYP4G7, CYP4BR3 and CYP345A1 by cypermethrin, permethrin, lambda-cyhalothrin or imidacloprid with approximately one fourth of LC20 in 6 h. Our study demonstrated that up-regulation of these CYP genes was rapid and only required low concentrations of insecticides, and the up-regulation not only depended on the CYP genes but also the type of insecticides. Our results along with those from previous studies also indicated that there were no specific patterns for predicting the up-regulation of specific CYP gene families based on the insecticide classification. PMID:25607733

  5. On the nature of the nova-like variable CD-42 deg 14462

    NASA Technical Reports Server (NTRS)

    Guinan, E. F.; Sion, E. M.

    1981-01-01

    Low dispersion long and short wavelength IUE spectra of the nova like system CD-42 deg 14462 were obtained on August 24 U.T. The short wave spectrum exhibits absorption features due to C III (lambda 1175), Lalpha 1216), NV (lambda1240), HeII (lambda 1640), SiIV (lambda1394), NIV (lambda1875) with CIV (lambda1550) as a P Cygni feature with blue shifted absorption suggesting the presence of material leaving the system. Possible interpretations of this object are discussed.

  6. Anti p and anti Lambda production in Si + Au collisions at the AGS

    NASA Technical Reports Server (NTRS)

    Wu, Yue-Dong

    1996-01-01

    (anti (ital p)) and (anti (Lambda)) production in central Si + Au collisions has been measured by E589 at the BNL-AGS. Preliminary (ital m)(sub (perpendicular)) spectra are presented for (anti (ital p))'s and (anti (Lambda))'s. The (ital dn/dy) distribution for (anti (ital p))'s is also presented. Based on the (anti (ital p)) and (anti (Lambda)) measurements, (anti (Lambda))/(anti (ital p)) ratios are calculated in the rapidity range of 1.1-1.5.

  7. ASYMMETRIC ABSORPTION PROFILES OF Ly{alpha} AND Ly{beta} IN DAMPED Ly{alpha} SYSTEMS

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lee, Hee-Won, E-mail: hwlee@sejong.ac.kr

    2013-08-01

    Damped Ly{alpha} systems observed in the quasar spectra are characterized by a high neutral hydrogen column density, N{sub HI} > 2 x 10{sup 20} cm{sup -2}. The absorption wing profiles are often fitted using the Voigt function due to the fact that the scattering cross section near the resonant line center is approximately described by the Lorentzian function. Since a hydrogen atom has infinitely many p states that participate in the electric dipole interaction, the cross section starts to deviate from the Lorentzian in an asymmetric way in the line wing regions. We investigate this asymmetry in the absorption linemore » profiles around Ly{alpha} and Ly{beta} as a function of the neutral hydrogen column density N{sub HI}. In terms of {Delta}{lambda} {identical_to} {lambda} - {lambda}{sub {alpha}}, we expand the Kramers-Heisenberg formula around Ly{alpha} to find {sigma}({lambda}) {approx_equal} (0.5f{sub 12}){sup 2}{sigma}{sub T}({Delta}{lambda}/{lambda}{sub {alpha}}){sup -2}[1 + 3.792({Delta}{lambda}/{lambda}{sub {alpha}})], where f{sub 12} and {sigma}{sub T} are the oscillator strength of Ly{alpha} and the Thomson scattering cross section, respectively. In terms of {Delta}{lambda}{sub 2} {identical_to} {lambda} - {lambda}{sub {beta}} in the vicinity of Ly{beta}, the total scattering cross section, given as the sum of cross sections for Rayleigh and Raman scattering, is shown to be {sigma}({lambda}) {approx_equal} {sigma}{sub T}(0.5f{sub 13}){sup 2}(1 + R{sub 0})({Delta}{lambda}{sub 2}/{lambda}{sub {beta}}){sup -2}[1 - 24.68({Delta}{lambda}{sub 2}/{lambda}{sub {beta}})] with f{sub 13} and the factor R{sub 0} = 0.1342 being the oscillator strength for Ly{beta} and the ratio of the Raman cross section to Rayleigh cross section, respectively. A redward asymmetry develops around Ly{alpha}, whereas a blue asymmetry is obtained for Ly{beta}. The absorption center shifts are found to be almost proportional to the neutral hydrogen column density.« less

  8. Genes encoding Xenopus laevis Ig L chains: Implications for the evolution of [kappa] and [lambda] chains

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Zezza, D.J.; Stewart, S.E.; Steiner, L.A.

    1992-12-15

    Xenopus laevis Ig contain two distinct types of L chains, designated [rho] or L1 and [sigma] or L2. The authors have analyzed Xenopus genomic DNA by Southern blotting with cDNA probes specific for L1 V and C regions. Many fragments hybridized to the V probe, but only one or two fragments hybridized to the C probe. Corresponding C, J, and V gene segments were identified on clones isolated from a genomic library prepared from the same DNA. One clone contains a C gene segment separated from a J gene segment by an intron of 3.4 kb. The J and Cmore » gene segments are nearly identical in sequence to cDNA clones analyzed previously. The C segment is somewhat more similar and the J segment considerably more similar in sequence to the corresponding segments of mammalian [kappa] chains than to those of mammalian [lambda] chains. Upstream of the J segment is a typical recombination signal sequence with a spacer of 23 bp, as in J[kappa]. A second clone from the library contains four V gene segments, separated by 2.1 to 3.6 kb. Two of these, V1 and V3, have the expected structural and regulatory features of V genes, and are very similar in sequence to each other and to mammalian V[kappa]. A third gene segment, V2, resembles V1 and V3 in its coding region and nearby 5[prime]-flanking region, but diverges in sequence 5[prime] to position [minus]95 with loss of the octamer promoter element. The fourth V-like segment is similar to the others at the 3[prime]-end, but upstream of codon 64 bears no resemblance in sequence to any Ig V region. All four V segments have typical recombination signal sequences with 12-bp spacers at their 3[prime]-ends, as in V[kappa]. Taken together, the data suggest that Xenopus L1 L chain genes are members of the [kappa] gene family. 80 refs., 9 figs.« less

  9. Measurement of sigma(Lambda(b)0) / sigma(anti-B 0) x B(Lambda0(b) ---> Lambda+(c) pi-) / B(anti-B0 ---> D+ pi-) in p anti-p collisions at S**(1/2) = 1.96-TeV

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Abulencia, A.; Acosta, D.; Adelman, Jahred A.

    2006-01-01

    The authors present the first observation of the baryon decay {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +} {pi}{sup -} followed by {Lambda}{sub c}{sup +} {yields} pK{sup -} {pi}{sup +} in 106 pb{sup -1} p{bar p} collisions at {radical}s = 1.96 TeV in the CDF experiment. IN order to reduce systematic error, the measured rate for {Lambda}{sub b}{sup 0} decay is normalized to the kinematically similar meson decay {bar B}{sup 0} {yields} D{sup +}{pi}{sup -} followed by D{sup +} {yields} {pi}{sup +}K{sup -}{pi}{sup +}. They report the ratio of production cross sections ({sigma}) times the ratio of branching fractions ({Beta}) formore » the momentum region integrated above p{sub T} > 6 GeV/c and pseudorapidity range |{eta}| < 1.3: {sigma}(p{bar p} {yields} {Lambda}{sub b}{sup 0}X)/{sigma}(p{bar p} {yields} {bar B}{sup 0} X) x {Beta}({Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -})/{Beta}({bar B}{sup 0} {yields} D{sup +}{pi}{sup -}) = 0.82 {+-} 0.08(stat) {+-} 0.11(syst) {+-} 0.22 ({Beta}({Lambda}{sub c}{sup +} {yields} pK{sup -} {pi}{sup +})).« less

  10. Inhibitory effect of tocotrienol on eukaryotic DNA polymerase {lambda} and angiogenesis

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Mizushina, Yoshiyuki; Nakagawa, Kiyotaka; Shibata, Akira

    2006-01-20

    Tocotrienols, vitamin E compounds that have an unsaturated side chain with three double bonds, selectively inhibited the activity of mammalian DNA polymerase {lambda} (pol {lambda}) in vitro. These compounds did not influence the activities of replicative pols such as {alpha}, {delta}, and {epsilon}, or even the activity of pol {beta} which is thought to have a very similar three-dimensional structure to the pol {beta}-like region of pol {lambda}. Since {delta}-tocotrienol had the strongest inhibitory effect among the four ({alpha}- to {delta}-) tocotrienols, the isomer's structure might be an important factor in the inhibition of pol {lambda}. The inhibitory effect ofmore » {delta}-tocotrienol on both intact pol {lambda} (residues 1-575) and a truncated pol {lambda} lacking the N-terminal BRCA1 C-terminus (BRCT) domain (residues 133-575, del-1 pol {lambda}) was dose-dependent, with 50% inhibition observed at a concentration of 18.4 and 90.1 {mu}M, respectively. However, del-2 pol {lambda} (residues 245-575) containing the C-terminal pol {beta}-like region was unaffected. Tocotrienols also inhibited the proliferation of and formation of tubes by bovine aortic endothelial cells, with {delta}-tocotrienol having the greatest effect. These results indicated that tocotrienols targeted both pol {lambda} and angiogenesis as anti-cancer agents. The relationship between the inhibition of pol {lambda} and anti-angiogenesis by {delta}-tocotrienol was discussed.« less

  11. The formation of low-ionization emission in the halo of NGC 891

    NASA Technical Reports Server (NTRS)

    Sokolowski, James; Bland-Hawthorn, Jonathan

    1993-01-01

    Imaging and Spectroscopic study first revealed the presence of a diffuse ionized medium (DIM), having unusual excitation, pervading the lower halo of the edge-on spiral galaxy NGC 891. Emission from this DIM is strongest northeast of the nucleus, at radii between 2 and 8 kpc (hereafter region 1). The (N2)(lambda)6583/H(alpha) and (S2)(lambda) (lambda)6716,6731/H(alpha) ratios increase dramatically with z in region 1, from 0.6 and 0.5 respectively at z is approximately equal to 500 pc to 1.1 and 1.0 at z is approximately equal to 1 kpc, while nondetections of (O1)(lambda)6300 and (O3)(lambda)5007 emission yield upper limits of (O1)(lambda)6300/H(alpha) less than or equal to 0.05 and (O3)(lambda)5007/H(alpha) less than or equal to 0.15 for z less than 1 kpc. Previous photoionization models, using the radiation field from disk O and B stars, have been successful in reproducing the elevated (N2)(lambda)6583/H(alpha) and (S2)(lambda)(lambda)6716.6731/H(alpha) ratios observed. However, these radiation bounded models also produce significant (O3)(lambda)5007 emission, in conflict with the observed upper limit. Here, we report the results of new, matter bounded models for the photoionization of the DIM in region 1 of NGC 891.

  12. Measurement of the Lambda(0)(b) lifetime in the exclusive decay Lambda(0)(b) -> J/psi Lambda(0) in p(p)over-bar collisions at root s=1.96 TeV

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Abazov V. M.; Abbott, B.; Acharya, B. S.

    2012-06-07

    We measure the {Lambda}{sub b}{sup 0} lifetime in the fully reconstructed decay {Lambda}{sub b}{sup 0} {yields} J/{psi}{Lambda}{sup 0} using 10.4 fb{sup -1} of p{bar p} collisions collected with the D0 detector at {radical}s = 1.96 TeV. The lifetime of the topologically similar decay channel B{sup 0} {yields} J/{psi}K{sub S}{sup 0} is also measured. We obtain {tau}({Lambda}{sub b}{sup 0}) = 1.303 {+-} 0.075(stat) {+-} 0.035(syst) ps and {tau}(B{sup 0}) = 1.508 {+-} 0.025(stat) {+-} 0.043(syst) ps. Using these measurements, we determine the lifetime ratio of {tau}({Lambda}{sub b}{sup 0})/{tau}(B{sup 0}) = 0.864 {+-} 0.052(stat) {+-} 0.033(syst).

  13. Cognitive dysfunction in antiphospholipid antibody (aPL)-negative systemic lupus erythematosus (SLE) versus aPL-positive non-SLE patients.

    PubMed

    Kozora, Elizabeth; Erkan, Doruk; Zhang, Lening; Zimmerman, Robert; Ramon, Glendalee; Ulug, Aziz M; Lockshin, Michael D

    2014-01-01

    The aim of this study was to compare the cognitive function of antiphospholipid antibody (aPL)-negative systemic lupus erythematosus (SLE) and aPL-positive non-SLE patients. Twenty aPL-negative SLE and 20 aPL-positive non-SLE female patients with no history of overt neuropsychiatric manifestations took standardised cognitive tests of learning and memory, attention and working memory, executive functions, verbal fluency, visuoconstruction, and motor function. The primary outcome measure was an established global cognitive impairment index (CII). Cranial magnetic resonance imaging (MRI) was also obtained on all patients. Twelve of 20 (60%) of the SLE and 8/20 (40%) of the aPL-positive patients had global cognitive impairment on CII; there were no group differences on CII or on individual measures. Cognitive impairment was not associated with duration of disease, level of disease activity, or prednisone use. No correlations were found between clinical disease factors and cognitive impairment, and neither group showed an association between incidental or major MRI abnormalities and cognitive dysfunction. Both aPL-negative SLE and aPL-positive non-SLE patients, without other overt neuropsychiatric disease, demonstrated high levels of cognitive impairment. No clinical, serologic, or radiologic characteristics were associated with cognitive impairment. Cognitive dysfunction is common in APS and in SLE, but its mechanisms remain unknown.

  14. The Italian validation of the minimal assessment of cognitive function in multiple sclerosis (MACFIMS) and the application of the Cognitive Impairment Index scoring procedure in MS patients.

    PubMed

    Argento, Ornella; Incerti, Chiara C; Quartuccio, Maria E; Magistrale, Giuseppe; Francia, Ada; Caltagirone, Carlo; Pisani, Valerio; Nocentini, Ugo

    2018-04-27

    Cognitive dysfunction occurs in almost 50-60% of patients with multiple sclerosis (MS) even in early stages of the disease and affects different aspects of patient's life. Aims of the present study were (1) to introduce and validate an Italian version of the minimal assessment of cognitive functions in MS (MACFIMS) battery and (2) to propose the use of the Cognitive Impairment Index (CII) as a scoring procedure to define the degree of impairment in relapsing-remitting (RRMS) and secondary-progressive (SPMS) patients. A total of 240 HC and 123 MS patients performed the Italian version of the MACFIMS composed by the same tests as the original except for the Paced Auditory Serial Addition Test. The CII was derived for each score of the 11 scales for participants of both groups. The results of the study show that cognitive impairment affects around 50% of our sample of MS patients. In RRMS group, only the 15.7% of patients reported a severe impairment, while in the group of SPMS, the 51.4% of patients felt in the "severely impaired" group. Results are in line with previously reported percentages of impairment in MS patients, showing that the calculation of the CII applied to the Italian version of the MACFIMS is sensitive and reliable in detecting different degrees of impairment in MS patients.

  15. Utility of the Conners' Adult ADHD Rating Scale validity scales in identifying simulated attention-deficit hyperactivity disorder and random responding.

    PubMed

    Walls, Brittany D; Wallace, Elizabeth R; Brothers, Stacey L; Berry, David T R

    2017-12-01

    Recent concern about malingered self-report of symptoms of attention-deficit hyperactivity disorder (ADHD) in college students has resulted in an urgent need for scales that can detect feigning of this disorder. The present study provided further validation data for a recently developed validity scale for the Conners' Adult ADHD Rating Scale (CAARS), the CAARS Infrequency Index (CII), as well as for the Inconsistency Index (INC). The sample included 139 undergraduate students: 21 individuals with diagnoses of ADHD, 29 individuals responding honestly, 54 individuals responding randomly (full or half), and 35 individuals instructed to feign. Overall, the INC showed moderate sensitivity to random responding (.44-.63) and fairly high specificity to ADHD (.86-.91). The CII demonstrated modest sensitivity to feigning (.31-.46) and excellent specificity to ADHD (.91-.95). Sequential application of validity scales had correct classification rates of honest (93.1%), ADHD (81.0%), feigning (57.1%), half random (42.3%), and full random (92.9%). The present study suggests that the CII is modestly sensitive (true positive rate) to feigned ADHD symptoms, and highly specific (true negative rate) to ADHD. Additionally, this study highlights the utility of applying the CAARS validity scales in a sequential manner for identifying feigning. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  16. Detection of the 158 Micrometers[CII] Transition at z=1.3: Evidence for a Galaxy-Wide Starburst

    NASA Technical Reports Server (NTRS)

    Hailey-Dunsheath, S.; Nikola, T.; Oberst, T. E.; Parshley, S. C.; Benford, D. J.; Staguhn, J. G.; Tucker, C. E.

    2010-01-01

    We report the detection of 158 micron [C II] fine-structure line emission from MIPS J142824.0+352619, a hyperluminous ( L(sub IR) approximates 10(exp 13) L (sub solar)) starburst galaxy at z = 1.3. The line is bright, corresponding to a fraction L(sub [Cu II] L(sub Fir) approximates 2 x 10(exp -3) of the far-IR (FIR) continuum. The [C II], CO, and FIR continuum emission may be modeled as arising from photodissociation regions (PDRs) that have a characteristic gas density of n approximates 10(exp 4.2) /cm(exp 3) , and that are illuminated by a far-UV radiation field approximately 10(exp 3.2) times more intense than the local interstellar radiation field. The mass in these PDRs accounts for approximately half of the molecular gas mass in this galaxy. The L(sub [CII])/L(sub FIR) ratio is higher than observed in local ultralummous infrared galaxies or in the few high-redshift QSOs detected in [C II], but the L(sub [CII])/L(sub FIR) and L(sub CO)/L(sub FIR) ratios are similar to the values seen in nearby starburst galaxies. This suggests that MIPS J142824.0+352619 is a scaled-up version of a starburst nucleus, with the burst extended over several kiloparsecs.

  17. Use of RecA protein to enrich for homologous genes in a genomic library

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Taidi-Laskowski, B.; Grumet, F.C.; Tyan, D.

    1988-08-25

    RecA protein-coated probe has been utilized to enrich genomic digests for desired genes in order to facilitate cloning from genomic libraries. Using a previously cloned HLA-B27 gene as the recA-coated enrichment probe, the authors obtained a mean 108x increase in the ratio of specific to nonspecific plaques in lambda libraries screened for B27 variant alleles of estimated 99% homology to the probe. Class I genes of lesser homology were less enriched. Loss of genomic DNA during the enrichment procedure can, however, restrict application of this technique whenever starting genomic DNA is very limited. Nevertheless, the impressive reduction in cloning effortmore » and material makes recA enrichment a useful new tool for cloning homologous genes from genomic DNA.« less

  18. Determination of transcriptional units and gene products from the ftsA region of Escherichia coli.

    PubMed Central

    Lutkenhaus, J F; Wu, H C

    1980-01-01

    Lambda transducing phage gamma 16-2 carries the genes envA, ftsZ, ftsA, ddl, and murC and directs the synthesis of six unique proteins in ultraviolet-irradiated cells. Various derivatives of gamma 16-2 carrying smaller segments of the bacterial deoxyribonucleic acid have also been analyzed for their capacity to direct protein synthesis in ultraviolet-irradiated cells. These results, in combination with genetic results, have allowed the gene product of each of these genes to be assigned. In addition, an unidentified gene was located counterclockwise to murC between murC and murF. Analysis of the direction of transcription indicates that murC, ddl, ftsA, and ftsZ are transcribed clockwise on the Escherichia coli genetic map, and envA is transcribed counterclockwise. In addition, it is shown that each of the genes envA, ftsZ, and ftsA can be expressed independently. Images PMID:6447690

  19. A Randomized Study of Peginterferon Lambda-1a Compared to Peginterferon Alfa-2a in Combination with Ribavirin and Telaprevir in Patients with Genotype-1 Chronic Hepatitis C.

    PubMed

    Flisiak, Robert; Shiffman, Mitchell; Arenas, Juan; Cheinquer, Hugo; Nikitin, Igor; Dong, Yuping; Rana, Khurram; Srinivasan, Subasree

    2016-01-01

    A randomized, double-blind, multinational, phase 3 study was conducted comparing the efficacy and safety of peginterferon lambda-1a (Lambda)/ribavirin (RBV)/telaprevir (TVR) vs. peginterferon alfa-2a (Alfa)/RBV/TVR in patients with chronic hepatitis C virus (HCV) genotype-1 (GT-1) infection. Patients (treatment-naïve or relapsers on prior Alfa/RBV treatment) were randomly assigned in a 2:1 ratio to receive Lambda/RBV/TVR or Alfa/RBV/TVR. Total duration of treatment was either 24 or 48 weeks (response-guided treatment), with TVR administered for the first 12 weeks. The primary endpoint was the proportion of patients who achieved a sustained virologic response at post treatment week 12 (SVR12), which was tested for noninferiority of Lambda/RBV/TVR. A total of 838 patients were enrolled, and 617 were treated; 411 and 206 patients received Lambda/RBV/TVR and Alfa/RBV/TVR, respectively. The majority of patients were treatment-naïve, with HCV GT-1b and a high baseline viral load (≥800,000 IU/mL). Less than 10% of patients had cirrhosis (Lambda, 7.5%; Alfa, 6.8%). Lambda/RBV/TVR did not meet the criterion for noninferiority (lower bound of the treatment difference interval was -12.3%); the SVR12 in all patients (modified intent-to-treat) was 76.2% in the Lambda arm and 82.0% in the Alfa arm. Overall, the frequency of adverse events in each arm was comparable (Lambda, 91.7%; Alfa, 97.1%). As expected based on the safety profile of the 2 interferons, there were more hepatobiliary events observed in the Lambda arm and more hematologic events in the Alfa arm. In this comparison of Lambda/RBV/TVR and Alfa/RBV/TVR in patients who were treatment-naïve or had relapsed on prior Alfa/RBV treatment, Lambda failed to demonstrate noninferiority based on SVR12 results. Treatment with Lambda/RBV/TVR was associated with a higher incidence of relapse. More patients discontinued Lambda/RBV/TVR treatment during the first 4 weeks of study treatment, mainly due to hepatobiliary-related events, and more Lambda patients were lost to follow-up.

  20. Apparatus and method for closed-loop control of reactor power in minimum time

    DOEpatents

    Bernard, Jr., John A.

    1988-11-01

    Closed-loop control law for altering the power level of nuclear reactors in a safe manner and without overshoot and in minimum time. Apparatus is provided for moving a fast-acting control element such as a control rod or a control drum for altering the nuclear reactor power level. A computer computes at short time intervals either the function: .rho.=(.beta.-.rho.).omega.-.lambda..sub.e '.rho.-.SIGMA..beta..sub.i (.lambda..sub.i -.lambda..sub.e ')+l* .omega.+l* [.omega..sup.2 +.lambda..sub.e '.omega.] or the function: .rho.=(.beta.-.rho.).omega.-.lambda..sub.e .rho.-(.lambda..sub.e /.lambda..sub.e)(.beta.-.rho.)+l* .omega.+l* [.omega..sup.2 +.lambda..sub.e .omega.-(.lambda..sub.e /.lambda..sub.e).omega.] These functions each specify the rate of change of reactivity that is necessary to achieve a specified rate of change of reactor power. The direction and speed of motion of the control element is altered so as to provide the rate of reactivity change calculated using either or both of these functions thereby resulting in the attainment of a new power level without overshoot and in minimum time. These functions are computed at intervals of approximately 0.01-1.0 seconds depending on the specific application.

  1. Apolipoprotein CII

    MedlinePlus

    ... improve treatment. Because of this, most health insurance companies will not pay for the test. If you ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  2. Consistent response of bird populations to climate change on two continents

    USGS Publications Warehouse

    Stephens, Philip A.; Mason, Lucy R.; Green, Rhys E.; Gregory, Richard D.; Sauer, John R.; Alison, Jamie; Aunins, Ainars; Brotons, Lluís; Butchart, Stuart H.M.; Campedelli, Tommaso; Chodkiewicz, Tomasz; Chylarecki, Przemyslaw; Crowe, Olivia; Elts, Jaanus; Escandell, Virginia; Foppen, Ruud P.B.; Heldbjerg, Henning; Herrando, Sergi; Husby, Magne; Jiguet, Frédéric; Lehikoinen, Aleksi; Lindström, Åke; Noble, David G.; Paquet, Jean-Yves; Reif, Jiri; Sattler, Thomas; Szép, Tibor; Teufelbauer, Norbert; Trautmann, Sven; Van Strien, Arco; van Turnhout, Chris A.M.; Vorisek, Petr; Willis, Stephen G.

    2016-01-01

    Global climate change is a major threat to biodiversity. Large-scale analyses have generally focused on the impacts of climate change on the geographic ranges of species and on phenology, the timing of ecological phenomena. We used long-term monitoring of the abundance of breeding birds across Europe and the United States to produce, for both regions, composite population indices for two groups of species: those for which climate suitability has been either improving or declining since 1980. The ratio of these composite indices, the climate impact indicator (CII), reflects the divergent fates of species favored or disadvantaged by climate change. The trend in CII is positive and similar in the two regions. On both continents, interspecific and spatial variation in population abundance trends are well predicted by climate suitability trends.

  3. On Spectral Invariance of Single Scattering Albedo for Weakly Absorbing Wavelengths

    NASA Technical Reports Server (NTRS)

    Marshak, Alexander; Knyazikhin, Yuri; Chiu, J. Christine; Wiscombe, Warren J.

    2011-01-01

    This note shows that for water droplets at weakly absorbing wavelengths, the ratio omega(sub O lambda(r))/omega(sub O lambda(r(sub O)) of two single scattering albedo spectra, omega(sub O lambda(r) and omega(sub O lambda(r (sub O)), is a linear function of omega(sub O lambda(r). The slope and intercept of the linear function are wavelength independent and sum to unity. This relationship allows for a representation of any single scattering albedo omega(sub O lambda(r) via one known spectrum omega(sub O lambda(r(sub O)). The note provides a simple physical explanation of the discovered relationship. In addition to water droplets, similar linear relationships were found for the single scattering albedo of non-spherical ice crystals.

  4. Environmental chemistry, ecotoxicity, and fate of lambda-cyhalothrin.

    PubMed

    He, Li-Ming; Troiano, John; Wang, Albert; Goh, Kean

    2008-01-01

    Lambda-cyhalothrin is a pyrethroid insecticide used for controlling pest insects in agriculture, public health, and in construction and households. Lambda-cyhalothrin is characterized by low vapor pressure and a low Henry's law constant but by a high octanol-water partition coefficient (K(ow)) and high water-solid-organic carbon partition coefficient (K(oc)) values. Lambda-cyhalothrin is quite stable in water at pH < 8, whereas it hydrolyzes to form HCN and aldehyde under alkaline conditions. Although lambda-cyhalothrin is relatively photostable under natural irradiation, with a half-life > 3 wk, its photolysis process is fast under UV irradiation, with a half-life < 10 min. The fate of lambda-cyhalothrin in aquatic ecosystems depends on the nature of system components such as suspended solids (mineral and organic particulates) and aquatic organisms (algae, macrophytes, or aquatic animals). Lambda-cyhalothrin residues dissolved in water decrease rapidly if suspended solids and/or aquatic organisms are present because lambda-cyhalothrin molecules are strongly adsorbed by particulates and plants. Adsorbed lambda-cyhalothrin molecules show decreased degradation rates because they are less accessible to breakdown than free molecules in the water column. On the other hand, lambda-cyhalothrin adsorbed to suspended solids or bottom sediments may provide a mechanism to mitigate its acute toxicity to aquatic organisms by reducing their short-term bioavailability in the water column. The widespread use of lambda-cyhalothrin has resulted in residues in sediment, which have been found to be toxic to aquatic organisms including fish and amphipods. Mitigation measures have been used to reduce the adverse impact of lambda-cyhalothrin contributed from agricultural or urban runoff. Mitigation may be achieved by reducing the quantity of runoff and suspended solid content in runoff through wetlands, detention ponds, or vegetated ditches.

  5. Exploring star formation in high-z galaxies using atomic and molecular emission lines

    NASA Astrophysics Data System (ADS)

    Gullberg, Bitten

    2016-03-01

    The conditions under which stars are formed and the reasons for triggering and quenching of starburst events in high-z galaxies, are still not well understood. Studying the interstellar medium (ISM) and the morphology of high-z galaxies are therefore key points in order to understand galaxy evolution. The cosmic star formation rate density peaks between 1>1, and low to moderate [CII] optical depth tau(CII)<1. Combining millimetre/sub-millimetre and optical data cubes for the high-z radio galaxy (HzRG) MRC0943-242, has revealed a much more complicated morphology than seen in the individual data sets. The millimetre/sub-millimetre observations data have allowed us to spatially separate of the AGN and starburst dominated components, which ~65 kpc apart. The optical data reveal structures of emitting and absorbing gas at multiple wavelengths. A deep high resolution millimetre/sub-millimetre study of the HzRG MRC1138-262, shows emission from water (H2O) and an unusually large amount of neutral atomic carbon ([CI]) relative to highly excited CO compared to lensed DSFGs. The detection of water (H2O) emission, which is not associated with the 246GHz continuum emission, suggests excitation by shocks. The uncommon line ratio between [CI]2-1 and CO(7-6) might be due special conditions of the ISM in MRC1138-262 dominated by cosmic rays or differential lensing in other DSFGs thereby not representing the intrinsic ratio. These three studies of the physical conditions of the ISM and morphology of high-z galaxies at z>2, pave the road for future investigations of the star-forming ISM in high-z galaxies, by illustrating the importance of multi-wavelength, fine structure- and molecular line studies.

  6. Non-LTE radiative transfer with lambda-acceleration - Convergence properties using exact full and diagonal lambda-operators

    NASA Technical Reports Server (NTRS)

    Macfarlane, J. J.

    1992-01-01

    We investigate the convergence properties of Lambda-acceleration methods for non-LTE radiative transfer problems in planar and spherical geometry. Matrix elements of the 'exact' A-operator are used to accelerate convergence to a solution in which both the radiative transfer and atomic rate equations are simultaneously satisfied. Convergence properties of two-level and multilevel atomic systems are investigated for methods using: (1) the complete Lambda-operator, and (2) the diagonal of the Lambda-operator. We find that the convergence properties for the method utilizing the complete Lambda-operator are significantly better than those of the diagonal Lambda-operator method, often reducing the number of iterations needed for convergence by a factor of between two and seven. However, the overall computational time required for large scale calculations - that is, those with many atomic levels and spatial zones - is typically a factor of a few larger for the complete Lambda-operator method, suggesting that the approach should be best applied to problems in which convergence is especially difficult.

  7. Mass and K{lambda} Coupling of the N*(1535)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Liu, B.C.; Graduate School of the Chinese Academy of Sciences, Beijing 100049; Zou, B.S.

    2006-02-03

    Using a resonance isobar model and an effective Lagrangian approach, from recent BES results on J/{psi}{yields}pp{eta} and {psi}{yields}pK{sup +}{lambda}, we deduce the ratio between effective coupling constants of N*(1535) to K{lambda} and p{eta} to be R{identical_to}g{sub N*(1535)K{lambda}}/g{sub N*(1535)p{eta}}=1.3{+-}0.3. With the previous known value of g{sub N*(1535)p{eta}}, the obtained new value of g{sub N*(1535)K{lambda}} is shown to reproduce recent pp{yields}pK{sup +}{lambda} near-threshold cross section data as well. Taking into account this large N*K{lambda} coupling in the coupled channel Breit-Wigner formula for the N*(1535), its Breit-Wigner mass is found to be around 1400 MeV, much smaller than the previous value of aboutmore » 1535 MeV obtained without including its coupling to K{lambda}. The implication on the nature of N*(1535) is discussed.« less

  8. Peginterferon lambda for the treatment of HBeAg-positive chronic hepatitis B: A randomized phase 2b study (LIRA-B).

    PubMed

    Chan, Henry L Y; Ahn, Sang Hoon; Chang, Ting-Tsung; Peng, Cheng-Yuan; Wong, David; Coffin, Carla S; Lim, Seng Gee; Chen, Pei-Jer; Janssen, Harry L A; Marcellin, Patrick; Serfaty, Lawrence; Zeuzem, Stefan; Cohen, David; Critelli, Linda; Xu, Dong; Wind-Rotolo, Megan; Cooney, Elizabeth

    2016-05-01

    Peginterferon lambda-1a (lambda) is a Type-III interferon, which, like alfa interferons, has antiviral activity in vitro against hepatitis B virus (HBV) and hepatitis C virus (HCV); however, lambda has a more limited extra-hepatic receptor distribution. This phase 2b study (LIRA-B) evaluated lambda in patients with chronic HBV infection. Adult HBeAg+ interferon-naive patients were randomized (1:1) to weekly lambda (180 μg) or peginterferon alfa-2a (alfa) for 48 weeks. The primary efficacy endpoint was HBeAg seroconversion at week 24 post-treatment; lambda non-inferiority was demonstrated if the 80% confidence interval (80% CI) lower bound was >-15%. Baseline characteristics were balanced across groups (lambda N=80; alfa N=83). Early on-treatment declines in HBV-DNA and qHBsAg through week 24 were greater with lambda. HBeAg seroconversion rates were comparable for lambda and alfa at week 48 (17.5% vs. 16.9%, respectively); however lambda non-inferiority was not met at week 24 post-treatment (13.8% vs. 30.1%, respectively; lambda vs. alfa 80% CI lower bound -24%). Results for other key secondary endpoints (virologic, serologic, biochemical) and post hoc combined endpoints (HBV-DNA <2000 IU/ml plus HBeAg seroconversion or ALT normalization) mostly favored alfa. Overall adverse events (AE), serious AE, and AE-discontinuation rates were comparable between arms but AE-spectra differed (more cytopenias, flu-like, and musculoskeletal symptoms observed with alfa, more ALT flares and bilirubin elevations seen with lambda). Most on-treatment flares occurred early (weeks 4-12), associated with HBV-DNA decline; all post-treatment flares were preceded by HBV-DNA rise. On-treatment, lambda showed greater early effects on HBV-DNA and qHBsAg, and comparable serologic/virologic responses at end-of-treatment. However, post-treatment, alfa-associated HBeAg seroconversion rates were higher, and key secondary results mostly favored alfa. ClinicalTrials.gov number: NCT01204762. Copyright © 2016 European Association for the Study of the Liver. Published by Elsevier B.V. All rights reserved.

  9. First Observation of Charmed Resonances in the $$\\Lambda^0_b \\to \\Lambda^+_c \\pi^- \\pi^+ \\pi^-$$ Inclusive Decay and Measurement of Their Relative Branching Ratios at CDF

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Barria, Patrizia

    2012-01-01

    We present the observation of themore » $$\\Lambda^0_b$$ decay into a $$\\Lambda^+_c \\pi^- \\pi^+ \\pi^-$$ final state, in $$p\\bar{p}$$ collisions at $$\\sqrt{s}$$ = 1:96 TeV. The data analyzed were collected by the CDF II detector at the Fermilab Tevatron collider, and correspond to 2:4 $$fb^{-1}$$ of integrated luminosity. We fit the invariant mass distribution of the reconstructed candidates to extract a signal yield of 848 $$\\pm$$ 93 $$\\Lambda^0_b$$ into $$\\Lambda^+_c \\pi^- \\pi^+ \\pi^-$$....« less

  10. Further observations of the lambda 10830 He line in stars and their significance as a measure of stellar activity

    NASA Technical Reports Server (NTRS)

    Zirin, H.

    1975-01-01

    Measurements of the lambda 1030 He line in 198 stars are given along with data on other features in that spectral range. Nearly 80% of all G and K stars show some lambda 10830; of these, half are variable and 1/4 show emission. It was confirmed that lambda 10830 is not found in M stars, is weak in F stars, and is particularly strong in close binaries. The line is found in emission in extremely late M and S stars, along with P gamma, but P gamma is not in emission in G and K stars with lambda 10830 emissions. Variable He emission and Ti I emission are found in the RV Tauri variables R Scuti and U Mon. In R Aqr the Fe XIII coronal line lambda 10747 and a line at lambda 11012 which may be singlet He or La II are found, as well as lambda 10830 and P gamma. The nature of coronas or hot chromospheres in the various stars is discussed. It was concluded that the lambda 10830 intensity must be more or less proportional to the energy deposited in the chromosphere corona by non-thermal processes.

  11. A photon spectrometric dose-rate constant determination for the Advantage Pd-103 brachytherapy source

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chen, Zhe Jay; Bongiorni, Paul; Nath, Ravinder

    Purpose: Although several dosimetric characterizations using Monte Carlo simulation and thermoluminescent dosimetry (TLD) have been reported for the new Advantage Pd-103 source (IsoAid, LLC, Port Richey, FL), no AAPM consensus value has been established for the dosimetric parameters of the source. The aim of this work was to perform an additional dose-rate constant ({Lambda}) determination using a recently established photon spectrometry technique (PST) that is independent of the published TLD and Monte Carlo techniques. Methods: Three Model IAPD-103A Advantage Pd-103 sources were used in this study. The relative photon energy spectrum emitted by each source along the transverse axis wasmore » measured using a high-resolution germanium spectrometer designed for low-energy photons. For each source, the dose-rate constant was determined from its emitted energy spectrum. The PST-determined dose-rate constant ({sub PST}{Lambda}) was then compared to those determined by TLD ({sub TLD}{Lambda}) and Monte Carlo ({sub MC}{Lambda}) techniques. A likely consensus {Lambda} value was estimated as the arithmetic mean of the average {Lambda} values determined by each of three different techniques. Results: The average {sub PST}{Lambda} value for the three Advantage sources was found to be (0.676{+-}0.026) cGyh{sup -1} U{sup -1}. Intersource variation in {sub PST}{Lambda} was less than 0.01%. The {sub PST}{Lambda} was within 2% of the reported {sub MC}{Lambda} values determined by PTRAN, EGSnrc, and MCNP5 codes. It was 3.4% lower than the reported {sub TLD}{Lambda}. A likely consensus {Lambda} value was estimated to be (0.688{+-}0.026) cGyh{sup -1} U{sup -1}, similar to the AAPM consensus values recommended currently for the Theragenics (Buford, GA) Model 200 (0.686{+-}0.033) cGyh{sup -1} U{sup -1}, the NASI (Chatsworth, CA) Model MED3633 (0.688{+-}0.033) cGyh{sup -1} U{sup -1}, and the Best Medical (Springfield, VA) Model 2335 (0.685{+-}0.033) cGyh{sup -1} U{sup -1} {sup 103}Pd sources. Conclusions: An independent {Lambda} determination has been performed for the Advantage Pd-103 source. The {sub PST}{Lambda} obtained in this work provides additional information needed for establishing a more accurate consensus {Lambda} value for the Advantage Pd-103 source.« less

  12. 78 FR 71609 - Methiocarb, Lambda-Cyhalothrin, Permethrin and Prodiamine; Notice of Receipt of Requests To...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-11-29

    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-OPP-2009-1017; FRL-9902-77] Methiocarb, Lambda-Cyhalothrin... receipt of requests by the registrants to voluntarily amend their Methiocarb, Lambda- Cyhalothrin... Willowood Lambda Cyhalothrin LLC, Gowan Company, Farnam Companies, Inc., Pyxis Regulatory Consulting, Inc...

  13. Differing patterns of genetic instability in mice deficient in the mismatch repair genes Pms2, Mlh1, Msh2, Msh3 and Msh6.

    PubMed

    Hegan, Denise Campisi; Narayanan, Latha; Jirik, Frank R; Edelmann, Winfried; Liskay, R Michael; Glazer, Peter M

    2006-12-01

    Defects in genes associated with DNA mismatch repair (MMR) have been linked to hereditary colon cancer. Because the MMR pathway includes multiple factors with both overlapping and divergent functions, we sought to compare the impact of deficiencies in each of several MMR genes on genetic instability using a collection of knock-out mouse models. We investigated mutation frequencies and patterns in MMR-deficient mice using two transgenic reporter genes, supFG1 and cII, in the context of mice deficient for Pms2, Mlh1, Msh2, Msh3 or Msh6 or both Msh2 and Msh3 or both Msh3 and Msh6. We found that the mean mutation frequencies of all of the MMR-deficient mice were significantly higher than the mean mutation frequencies of wild-type mice. Mlh1-deficient mice and Msh2-deficient mice had the highest mutation frequencies in a comparison of the single nullizygous mice. Of all the mice studied, mice nullizygous for both Msh2 and Msh3 and those nullizygous for both Msh3 and Msh6 displayed the greatest overall increases in mutation frequencies compared with wild-type mice. Sequence analysis of the mutated reporter genes revealed significant differences between the individual groups of MMR-deficient mice. Taken together, our results further characterize the functions of the MMR factors in mutation avoidance and provide in vivo correlation to biochemical models of the MMR pathway.

  14. Structural relationship of curcumin derivatives binding to the BRCT domain of human DNA polymerase lambda.

    PubMed

    Takeuchi, Toshifumi; Ishidoh, Tomomi; Iijima, Hiroshi; Kuriyama, Isoko; Shimazaki, Noriko; Koiwai, Osamu; Kuramochi, Kouji; Kobayashi, Susumu; Sugawara, Fumio; Sakaguchi, Kengo; Yoshida, Hiromi; Mizushina, Yoshiyuki

    2006-03-01

    We previously reported that phenolic compounds, petasiphenol and curcumin (diferuloylmethane), were a selective inhibitor of DNA polymerase lambda (pol lambda) in vitro. The purpose of this study was to investigate the molecular structural relationship of curcumin and 13 chemically synthesized derivatives of curcumin. The inhibitory effect on pol lambda (full-length, i.e. intact pol lambda including the BRCA1 C- terminal [BRCT] domain) by some derivatives was stronger than that by curcumin, and monoacetylcurcumin (compound 13) was the strongest pol lambda inhibitor of all the compounds tested, achieving 50% inhibition at a concentration of 3.9 microm. The compound did not influence the activities of replicative pols such as alpha, delta, and epsilon. It had no effect on pol beta activity either, although the three-dimensional structure of pol beta is thought to be highly similar to that of pol lambda. Compound 13 did not inhibit the activity of the C-terminal catalytic domain of pol lambda including the pol beta-like core, in which the BRCT motif was deleted from its N-terminal region. MALDI-TOF MS analysis demonstrated that compound 13 bound selectively to the N-terminal domain of pol lambda, but did not bind to the C-terminal region. Based on these results, the pol lambda-inhibitory mechanism of compound 13 is discussed.

  15. Herschel Galactic plane survey of ionized gas traced by [NII

    NASA Astrophysics Data System (ADS)

    Yildiz, Umut; Goldsmith, Paul; Pineda, Jorge; Langer, William

    2015-01-01

    Far infrared and sub-/millimeter atomic & ionic fine structure and molecular rotational lines are powerful tracers of star formation on both Galactic and extragalactic scales. Although CO lines trace cool to moderately warm molecular gas, ionized carbon [CII] produces the strongest lines, which arise from almost all reasonably warm (T>50 K) parts of the ISM. However, [CII] alone cannot distinguish highly ionized gas from weakly ionized gas. [NII] plays a significant role in star formation as it is produced only in ionized regions; in [HII] regions as well as diffuse ionized gas. The ionization potential of nitrogen (14.5 eV) is greater than that of hydrogen (13.6 eV), therefore the ionized nitrogen [NII] lines reflect the effects of massive stars, with possible enhancement from X-ray and shock heating from the surroundings. Two far-infrared 122 um and 205 um [NII] fine structure spectral lines are targeted via Photodetector Array Camera and Spectrometer (PACS) onboard Herschel Space Observatory. The sample consists of 149 line-of-sight (LOS) positions in the Galactic plane. These positions overlap with the [CII] 158 um observations obtained with the GOT C+ survey. With a reasonable assumption that the emission from both 122 um and 205 um lines originate in the same gas; [NII] 122/205 um line ratio indicates the a good measure of the electron density of each of the LOS positions. [NII] detections are mainly toward the Galactic center direction and the [NII] electron densities are found between 7-50 cm^-3, which is enhanced WIM (Warm Ionized Medium). WIM densities are expected to be much lower (~1 cm-3), therefore non-detections toward the opposite side of the Galactic Center shows abundant of this gas. The pixel to pixel variation of the emission within a single Herschel pointing is relatively small, which is interpreted as the [NII] emission comes from an extended gas. It is important to quantify what fraction of [CII] emission arises in the ionized gas. Thus, with the present work of [NII] observations, it will be possible to resolve the different parts of the ISM leading to determine the total mass of the ISM.

  16. Serum Free Light Chains in Neoplastic Monoclonal Gammopathies: Relative Under-Detection of Lambda Dominant Kappa/Lambda Ratio, and Underproduction of Free Lambda Light Chains, as Compared to Kappa Light Chains, in Patients With Neoplastic Monoclonal Gammopathies.

    PubMed

    Lee, Won Sok; Singh, Gurmukh

    2018-07-01

    Quantitative evaluation of serum free light chains is recommended for the work up of monoclonal gammopathies. Immunoglobulin light chains are generally produced in excess of heavy chains. In patients with monoclonal gammopathy, κ/λ ratio is abnormal less frequently with lambda chain lesions. This study was undertaken to ascertain if the levels of overproduction of the two light chain types and their detection rates are different in patients with neoplastic monoclonal gammopathies. Results of serum protein electrophoresis (SPEP), serum protein immunofixation electrophoresis (SIFE), urine protein electrophoresis (UPEP), urine protein immunofixation electrophoresis (UIFE), and serum free light chain assay (SFLCA) in patients with monoclonal gammopathies were examined retrospectively. The κ/λ ratios were appropriately abnormal more often in kappa chain lesions. Ratios of κ/λ were normal in about 25% of patients with lambda chain lesions in whom free homogenous lambda light chains were detectable in urine. An illustrative case suggests underproduction of free lambda light chains, in some instances. The lower prevalence of lambda dominant κ/λ ratio in lesions with lambda light chains is estimated to be due to relative under-detection of lambda dominant κ/λ ratio in about 25% of the patients and because lambda chains are not produced in as much excess of heavy chains as are kappa chains, in about 5% of the patients. The results question the medical necessity and clinical usefulness of the serum free light chain assay. UPEP/UIFE is under-utilized.

  17. Synergistic suppression of autoimmune arthritis through concurrent treatment with tolerogenic DC and MSC

    PubMed Central

    Li, Rong; Zhang, Yujuan; Zheng, Xiufen; Peng, Shanshan; Yuan, Keng; Zhang, Xusheng; Min, Weiping

    2017-01-01

    Rheumatoid arthritis (RA) is an autoimmune disease characterized by progressive immune-mediated joint deterioration. Current treatments are not antigen specific and are associated with various adverse. We have previously demonstrated that tolerogenic dendritic cells (Tol-DC) are potent antigen-specific immune regulators, which hold great promise in immunotherapy of autoimmune diseases. In this study, we aimed to develop new immunotherapy by combining Tol-DC and mesenchymal stem cells (MSC). We demonstrated that RelB gene silencing resulted in generation of Tol-DC that suppressed T cell responses and selectively promoted Treg generation. The combination of MSC synergized the tolerogenic capacity of Tol-DC in inhibition of T cell responses. In murine collagen-induced arthritis (CIA) model, we demonstrated that progression of arthritis was inhibited with administration of RelB gene-silenced Tol-DC or MSC. This therapeutic effect was remarkably enhanced with concurrent treatment of combination Tol-DC and MSC as demonstrated by improved clinical symptoms, decreased clinical scores and attenuated joint damage. These therapeutic effects were associated with suppression of CII-specific T cell responses, polarization of Th and inhibition of proinflammatory cytokines, and reduced cartilage degeneration. This study for the first time demonstrates a new approach to treat autoimmune inflammatory joint disease with concurrent treatment of RelB gene-silenced Tol-DC and MSC. PMID:28230210

  18. Search for CP Violation in Hyperon Decay: $$\\Xi^- / \\bar{\\Xi}^+$$ and $$\\Lambda / \\bar{\\Lambda}$$ (in French)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Leros, Nicolas

    2001-06-01

    The HyperCP(EB71) experiment, performed at the Fermi National Accelerator Laboratory in the United States, provides a primary search for direct OP violation in the decays ofmore » $$\\Xi^-/\\bar{\\Xi}^+$$ and $$\\Lambda/ \\bar{\\Lambda}$$ hyperons....« less

  19. New SPUDT cell structures.

    PubMed

    Martin, Guenter; Schmidt, Hagen; Wall, Bert

    2004-07-01

    The present paper describes single-phase unidirectional transducers (SPUDT) cells with all fingers wider than lambda/8 while maintaining the unidirectional effect. The first solution is related to a SPUDT consisting of lambda/4 and lambda/2 wide fingers arranged in two tracks. Each track has no significant unidirectional effect. Both tracks form a waveguide, and the waveguide coupling generates the interaction of the tracks. As a result of that interaction, a unidirectional effect arises as verified by experiment. This transducer type is called double-track (DT) SPUDT. A second solution is suggested that includes, in contrast to distributed acoustic reflection transducer (DART), electrode width control (EWC), and Hunsinger cells, SPUDT cell fingers with one and the same width only. Cell types with lambda/6, lambda/5, and lambda/3 wide fingers called uniform width electrode (UWE) cells are considered. One of these cell types, including exclusively lambda/5 wide fingers, is experimentally investigated and a unidirectional effect is found. Moreover, a filter example using the lambda/5 cell type has been designed for reducing SPUDT reflections. The echo suppression expected could be verified experimentally. No waveguide coupling is required for this cell type.

  20. Recombination between bacteriophage lambda and plasmid pBR322 in Escherichia coli.

    PubMed Central

    Pogue-Geile, K L; Dassarma, S; King, S R; Jaskunas, S R

    1980-01-01

    Recombinant lambda phages were isolated that resulted from recombination between the lambda genome and plasmid pBR322 in Escherichia coli, even though these deoxyribonucleic acids (DNAs) did not share extensive regions of homology. The characterization of these recombinant DNAs by heteroduplex analysis and restriction endonucleases is described. All but one of the recombinants appeared to have resulted from reciprocal recombination between a site on lambda DNA and a site on the plasmid. In general, there were two classes of recombinants. One class appeared to have resulted from recombination at the phage attachment site that probably resulted from lambda integration into secondary attachment sites on the plasmid. Seven different secondary attachment sites on pBR322 were found. The other class resulted from plasmid integration at other sites that were widely scattered on the lambda genome. For this second class of recombinants, more than one site on the plasmid could recombine with lambda DNA. Thus, the recombination did not appear to be site specific with respect to lambda or the plasmid. Possible mechanisms for generating these recombinants are discussed. Images PMID:6247334

  1. The risk of renal disease is increased in lambda myeloma with bone marrow amyloid deposits.

    PubMed

    Kozlowski, Piotr; Montgomery, Scott; Befekadu, Rahel; Hahn-Strömberg, Victoria

    2017-01-01

    Light chain amyloidosis (AL) is a rare deposition disease and is present in 10-15% of patients with myeloma (MM). In contrast to symptomatic AL in MM, presence of bone marrow (BM) amyloid deposits (AD) in MM is not connected to kidney damage. Renal AD but not BM-AD occur mostly in MM with lambda paraprotein (lambda MM). We investigated amyloid presence in BM clots taken at diagnosis in 84 patients with symptomatic MM and compared disease characteristics in MM with kappa paraprotein (kappa MM)/lambda MM with and without BM-AD. Lambda MM with BM-AD was compared with kappa MM without BM-AD, kappa MM with BM-AD, and lambda MM without BM-AD: lambda MM with BM-AD patients had a significantly higher mean creatinine level (4.23 mg/dL vs 1.69, 1.14, and 1.28 mg/dL, respectively) and a higher proportion presented with severe kidney failure (6/11 [55%] vs 6/32 [19%], 1/22 [5%], and 3/19 [16%], respectively). Proteinuria was more common in lambda MM with BM-AD patients compared with kappa MM without BM-AD patients (8/11 [73%] vs 5/32 [16%], respectively). Kidney damage was more common in lambda MM with BM-AD indicating presence of renal AD.

  2. Elevated carboxylesterase activity contributes to the lambda-cyhalothrin insensitivity in quercetin fed Helicoverpa armigera (Hübner).

    PubMed

    Chen, Chengyu; Liu, Ying; Shi, Xueyan; Desneux, Nicolas; Han, Peng; Gao, Xiwu

    2017-01-01

    Quercetin as one of the key plant secondary metabolite flavonol is ubiquitous in terrestrial plants. In this study, the decrease in sensitivity to lambda-cyhalothrin was observed in quercetin-fed Helicoverpa armigera larvae. In order to figure out the mechanisms underlying the decreased sensitivity of H. armigera larvae to lambda-cyhalothrin by quercetin induction, the changes in carboxylesterase activity and in-vitro hydrolytic metabolic capacity to lambda-cyhalothrin were examined. The LC50 value of quercetin-fed H. armigera larvae to lambda-cyhalothrin showed 2.41-fold higher than that of the control. S, S, S-Tributyl phosphorotrithioate (DEF) treatment showed a synergism effect on lambda-cyhalothrin toxicity to quercetin-fed H. armigera. Moreover, the activity of carboxylesterase was significantly higher in quercetin-fed H. armigera larvae after fed on quercetin for 48 h. The in-vitro hydrolytic metabolic capacity to lambda-cyhalothrin in quercetin-fed H. armigera larvae midgut was 289.82 nmol 3-PBA/mg protein/min, which is significant higher than that in the control group (149.60 nmol 3-PBA/mg protein/min). The elevated CarE enzyme activity and corresponding increased hydrolytic metabolic capacity to lambda-cyhalothrin in quercetin-fed H. armigera contributed to the enhanced tolerance to lambda-cyhalothrin.

  3. Elevated carboxylesterase activity contributes to the lambda-cyhalothrin insensitivity in quercetin fed Helicoverpa armigera (Hübner)

    PubMed Central

    Chen, Chengyu; Liu, Ying; Desneux, Nicolas; Han, Peng; Gao, Xiwu

    2017-01-01

    Quercetin as one of the key plant secondary metabolite flavonol is ubiquitous in terrestrial plants. In this study, the decrease in sensitivity to lambda-cyhalothrin was observed in quercetin-fed Helicoverpa armigera larvae. In order to figure out the mechanisms underlying the decreased sensitivity of H. armigera larvae to lambda-cyhalothrin by quercetin induction, the changes in carboxylesterase activity and in-vitro hydrolytic metabolic capacity to lambda-cyhalothrin were examined. The LC50 value of quercetin-fed H. armigera larvae to lambda-cyhalothrin showed 2.41-fold higher than that of the control. S, S, S-Tributyl phosphorotrithioate (DEF) treatment showed a synergism effect on lambda-cyhalothrin toxicity to quercetin-fed H. armigera. Moreover, the activity of carboxylesterase was significantly higher in quercetin-fed H. armigera larvae after fed on quercetin for 48 h. The in-vitro hydrolytic metabolic capacity to lambda-cyhalothrin in quercetin-fed H. armigera larvae midgut was 289.82 nmol 3-PBA/mg protein/min, which is significant higher than that in the control group (149.60 nmol 3-PBA/mg protein/min). The elevated CarE enzyme activity and corresponding increased hydrolytic metabolic capacity to lambda-cyhalothrin in quercetin-fed H. armigera contributed to the enhanced tolerance to lambda-cyhalothrin. PMID:28817718

  4. Quadrupole deformation ({beta},{gamma}) of light {Lambda} hypernuclei in a constrained relativistic mean field model: Shape evolution and shape polarization effect of the {Lambda} hyperon

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lu Bingnan; Zhao Enguang; Center of Theoretical Nuclear Physics, National Laboratory of Heavy Ion Accelerator, Lanzhou 730000

    2011-07-15

    The shapes of light normal nuclei and {Lambda} hypernuclei are investigated in the ({beta},{gamma}) deformation plane by using a newly developed constrained relativistic mean field (RMF) model. As examples, the results of some C, Mg, and Si nuclei are presented and discussed in details. We found that for normal nuclei the present RMF calculations and previous Skyrme-Hartree-Fock models predict similar trends of the shape evolution with the neutron number increasing. But some quantitative aspects from these two approaches, such as the depth of the minimum and the softness in the {gamma} direction, differ a lot for several nuclei. For {Lambda}more » hypernuclei, in most cases, the addition of a {Lambda} hyperon alters slightly the location of the ground state minimum toward the direction of smaller {beta} and softer {gamma} in the potential energy surface E{approx}({beta},{gamma}). There are three exceptions, namely, {sub {Lambda}}{sup 13}C, {sub {Lambda}}{sup 23}C, and {sub {Lambda}}{sup 31}Si in which the polarization effect of the additional {Lambda} is so strong that the shapes of these three hypernuclei are drastically different from their corresponding core nuclei.« less

  5. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Leong, JoAnn Ching

    A prototype subunit vaccine to IHN virus is being developed by recombinant DNA techniques. The techniques involve the isolation and characterization of the glycoprotein gene, which encodes the viral protein responsible for inducing a protective immune response in fish. The viral glycoprotein gene has been cloned and a restriction map of the cloned gene has been prepared. Preliminary DNA sequence analysis of the cloned gene has been initiated so that manipulation of the gene for maximum expression in appropriate plasmid vectors is possible. A recombinant plasmid containing the viral gene inserted in the proper orientation adjacent to a very strongmore » lambda promoter and ribosome binding site has been constructed. Evaluation of this recombinant plasmid for gene expression is being conducted. Immunization trials with purified viral glycoprotein indicate that fish are protected against lethal doses of IHNV after immersion and intraperitoneal methods of immunization. In addition, cross protection immunization trials indicate that Type 2 and Type 1 IHN virus produce glycoproteins that are cross-protective.« less

  6. Serum Free Light Chains in Neoplastic Monoclonal Gammopathies: Relative Under-Detection of Lambda Dominant Kappa/Lambda Ratio, and Underproduction of Free Lambda Light Chains, as Compared to Kappa Light Chains, in Patients With Neoplastic Monoclonal Gammopathies

    PubMed Central

    Lee, Won Sok; Singh, Gurmukh

    2018-01-01

    Background Quantitative evaluation of serum free light chains is recommended for the work up of monoclonal gammopathies. Immunoglobulin light chains are generally produced in excess of heavy chains. In patients with monoclonal gammopathy, κ/λ ratio is abnormal less frequently with lambda chain lesions. This study was undertaken to ascertain if the levels of overproduction of the two light chain types and their detection rates are different in patients with neoplastic monoclonal gammopathies. Methods Results of serum protein electrophoresis (SPEP), serum protein immunofixation electrophoresis (SIFE), urine protein electrophoresis (UPEP), urine protein immunofixation electrophoresis (UIFE), and serum free light chain assay (SFLCA) in patients with monoclonal gammopathies were examined retrospectively. Results The κ/λ ratios were appropriately abnormal more often in kappa chain lesions. Ratios of κ/λ were normal in about 25% of patients with lambda chain lesions in whom free homogenous lambda light chains were detectable in urine. An illustrative case suggests underproduction of free lambda light chains, in some instances. Conclusions The lower prevalence of lambda dominant κ/λ ratio in lesions with lambda light chains is estimated to be due to relative under-detection of lambda dominant κ/λ ratio in about 25% of the patients and because lambda chains are not produced in as much excess of heavy chains as are kappa chains, in about 5% of the patients. The results question the medical necessity and clinical usefulness of the serum free light chain assay. UPEP/UIFE is under-utilized. PMID:29904440

  7. 3D-DIVIMP-HC modeling analysis of methane injection into DIII-D using the DiMES porous plug injector

    NASA Astrophysics Data System (ADS)

    Mu, Y.; McLean, A. G.; Elder, J. D.; Stangeby, P. C.; Bray, B. D.; Brooks, N. H.; Davis, J. W.; Fenstermacher, M. E.; Groth, M.; Lasnier, C. J.; Rudakov, D. L.; Watkins, J. G.; West, W. P.; Wong, C. P. C.

    2009-06-01

    A self-contained gas injection system for the Divertor Material Evaluation System (DiMES) on DIII-D, the porous plug injector (PPI), has been employed for in situ study of chemical erosion in the tokamak divertor environment by injection of CH 4 [A.G. McLean et al., these Proceedings]. A new interpretive code, 3D-DIVIMP-HC, has been developed and applied to the interpretation of the CH, CI, and CII emissions. Particular emphasis is placed on the interpretation of 2D filtered-camera (TV) pictures in CH, CI and CII light taken from a view essentially straight down on the PPI. The code replicates sufficient measurements to conclude that most of the basic elements of the controlling physics and chemistry have been identified and incorporated in the code-model.

  8. The nonpsychoactive cannabis constituent cannabidiol is an oral anti-arthritic therapeutic in murine collagen-induced arthritis

    PubMed Central

    Malfait, A. M.; Gallily, R.; Sumariwalla, P. F.; Malik, A. S.; Andreakos, E.; Mechoulam, R.; Feldmann, M.

    2000-01-01

    The therapeutic potential of cannabidiol (CBD), the major nonpsychoactive component of cannabis, was explored in murine collagen-induced arthritis (CIA). CIA was elicited by immunizing DBA/1 mice with type II collagen (CII) in complete Freund's adjuvant. The CII used was either bovine or murine, resulting in classical acute CIA or in chronic relapsing CIA, respectively. CBD was administered after onset of clinical symptoms, and in both models of arthritis the treatment effectively blocked progression of arthritis. CBD was equally effective when administered i.p. or orally. The dose dependency showed a bell-shaped curve, with an optimal effect at 5 mg/kg per day i.p. or 25 mg/kg per day orally. Clinical improvement was associated with protection of the joints against severe damage. Ex vivo, draining lymph node cells from CBD-treated mice showed a diminished CII-specific proliferation and IFN-γ production, as well as a decreased release of tumor necrosis factor by knee synovial cells. In vitro effects of CBD included a dose-dependent suppression of lymphocyte proliferation, both mitogen-stimulated and antigen-specific, and the blockade of the Zymosan-triggered reactive oxygen burst by peritoneal granulocytes. It also was found that CBD administration was capable of blocking the lipopolysaccharide-induced rise in serum tumor necrosis factor in C57/BL mice. Taken together, these data show that CBD, through its combined immunosuppressive and anti-inflammatory actions, has a potent anti-arthritic effect in CIA. PMID:10920191

  9. Interstellar medium conditions in z 0.2 Lyman-break analogs

    NASA Astrophysics Data System (ADS)

    Contursi, A.; Baker, A. J.; Berta, S.; Magnelli, B.; Lutz, D.; Fischer, J.; Verma, A.; Nielbock, M.; Grácia Carpio, J.; Veilleux, S.; Sturm, E.; Davies, R.; Genzel, R.; Hailey-Dunsheath, S.; Herrera-Camus, R.; Janssen, A.; Poglitsch, A.; Sternberg, A.; Tacconi, L. J.

    2017-10-01

    We present an analysis of far-infrared (FIR) [CII] and [OI] fine structure line and continuum observations obtained with Herschel/PACS, and 12CO(1-0) observations obtained with the IRAM Plateau de Bure Interferometer, of Lyman-break analogs (LBAs) at z 0.2. The principal aim of this work is to determine the typical interstellar medium (ISM) properties of z 1-2 main sequence (MS) galaxies, with stellar masses between 109.5 and 1011M⊙, which are currently not easily detectable in all these lines even with ALMA and NOEMA. We perform PDR modeling and apply different infared diagnostics to derive the main physical parameters of the far-infrared (FIR)-emitting gas and dust and we compare the derived ISM properties to those of galaxies on and above the MS at different redshifts. We find that the ISM properties of LBAs are quite extreme (low gas temperature and high density and thermal pressure) with respect to those found in local normal spirals and more active local galaxies. LBAs have no [CII] deficit despite having the high specific star formation rates (sSFRs) typical of starbursts. Although LBAs lie above the local MS, we show that their ISM properties are more similar to those of high-redshift MS galaxies than of local galaxies above the main sequence. This data set represents an important reference for planning future ALMA [CII] observations of relatively low-mass MS galaxies at the epoch of the peak of the cosmic star formation.

  10. A randomized, controlled study of peginterferon lambda-1a/ribavirin ± daclatasvir for hepatitis C virus genotype 2 or 3.

    PubMed

    Foster, Graham R; Chayama, Kazuaki; Chuang, Wan-Long; Fainboim, Hugo; Farkkila, Martti; Gadano, Adrian; Gaeta, Giovanni B; Hézode, Christophe; Inada, Yukiko; Heo, Jeong; Kumada, Hiromitsu; Lu, Sheng-Nan; Marcellin, Patrick; Moreno, Christophe; Roberts, Stuart K; Strasser, Simone I; Thompson, Alexander J; Toyota, Joji; Paik, Seung Woon; Vierling, John M; Zignego, Anna L; Cohen, David; McPhee, Fiona; Wind-Rotolo, Megan; Srinivasan, Subasree; Hruska, Matthew; Myler, Heather; Portsmouth, Simon D

    2016-01-01

    Peginterferon Lambda was being developed as an alternative to alfa interferon for the treatment of chronic hepatitis C virus (HCV) infection. We compared peginterferon Lambda-1a plus ribavirin (Lambda/RBV) and Lambda/RBV plus daclatasvir (DCV; pangenotypic NS5A inhibitor) with peginterferon alfa-2a plus RBV (alfa/RBV) in treatment-naive patients with HCV genotype 2 or 3 infection. In this multicenter, double-blind, phase 3 randomized controlled trial, patients were assigned 2:2:1 to receive 24 weeks of Lambda/RBV, 12 weeks of Lambda/RBV + DCV, or 24 weeks of alfa/RBV. The primary outcome measure was sustained virologic response at post-treatment Week 12 (SVR12). Overall, 874 patients were treated: Lambda/RBV, n = 353; Lambda/RBV + DCV, n = 349; alfa/RBV, n = 172. Patients were 65 % white and 33 % Asian, 57 % male, with a mean age of 47 years; 52 % were infected with genotype 2 (6 % cirrhotic) and 48 % with genotype 3 (9 % cirrhotic). In the Lambda/RBV + DCV group, 83 % (95 % confidence interval [CI] 78.5, 86.5) achieved SVR12 (90 % genotype 2, 75 % genotype 3) whereas SVR12 was achieved by 68 % (95 % CI 63.1, 72.9) with Lambda/RBV (72 % genotype 2, 64 % genotype 3) and 73 % (95 % CI 66.6, 79.9) with peginterferon alfa/RBV (74 % genotype 2, 73 % genotype 3). Lambda/RBV + DCV was associated with lower incidences of flu-like symptoms, hematological abnormalities, and discontinuations due to adverse events compared with alfa/RBV. The 12-week regimen of Lambda/RBV + DCV was superior to peginterferon alfa/RBV in the combined population of treatment-naive patients with genotype 2 or 3 infection, with an improved tolerability and safety profile compared with alfa/RBV.

  11. Dynamic processes in Be star atmospheres. 2: He I 2P-nD line formation in lambda Eridani (outburst)

    NASA Technical Reports Server (NTRS)

    Smith, Myron A.; Hubeny, Ivan; Lanz, Thierry; Meylan, Thomas

    1994-01-01

    The He I lambda 6678 line of early Be stars generally shows violet (V) and red (R) emission whenever hydrogen alpha emission is present, but its use as a diagnostic has been handicapped by a poor understanding of the processes that drive it into emission. In an attempt to address this problem we obtained three series of eschelle spectra of the first two members of the singlet and triplet 2P-nD series of lambda Eri (B2e) during 1992 November 3-5 at Kitt Peak. During these observations lambda 6678 showed substantial emission variability in both the wings and central profile, providing an opportunity to compare its behavior with that of the lambda 4922, lambda 5876, and lambda 4471 lines. We found that the responses of the lines were different in several respects. Whereas the emissions in the V wings of all four lines scaled together, the R wing of the lambda 4922 line invariably responded with increased absorption whenever the R wing of lambda 6678 line showed increased emission. These same trends occurred within the central photospheric profiles. The R-wing behavior shows that much, but not all of the emission in lambda 6678 is caused by matter projected against the stellar disk. The excitation temperatures of the neighboring 2(sup 1) P transitions, lambda 6678 and lambda 4922 must be greater than and less than the photospheric continuum temperature, respectively. We have investigated departures from local thermodynamic equilibrium (LTE) for the He I spectrum in a variety of ad hoc, perturbed model atmospheres. We have found only one way to cause the source function of lambda 6678 to increase so strongly, namely, by increasing the atmospheric temperature in the line formation region to 30,000 - 40,000 K. This effect was discovered by Auer and Mihalas for O3-O4 atmospheric models, but it has not been applied to active B stars. Our models suggest that lambda 6678 emission in Be stars can be used as a sensitive monitor of localized hot spots on these stars' surfaces. The energies involved in heating the active portions of the atmosphere are too high to be produced by gravitational infall. This leaves magnetically induced flares among the few known processes on the surfaces of stars capable of sustaining this energy level.

  12. Investigating molecular basis of lambda-cyhalothrin resistance in an Anopheles funestus population from Senegal.

    PubMed

    Samb, Badara; Konate, Lassana; Irving, Helen; Riveron, Jacob M; Dia, Ibrahima; Faye, Ousmane; Wondji, Charles S

    2016-08-12

    Anopheles funestus is one of the major malaria vectors in tropical Africa, notably in Senegal. The highly anthropophilic and endophilic behaviours of this mosquito make it a good target for vector control operations through the use of insecticide treated nets, long-lasting insecticide nets and indoor residual spraying. However, little is known about patterns of resistance to insecticides and the underlying resistance mechanisms in field populations of this vector in Senegal. Here, we assessed the susceptibility status of An. funestus populations from Gankette Balla, located in northern Senegal and investigated the potential resistance mechanisms. WHO bioassays indicated that An. funestus is resistant to lambda-cyhalothrin 0.05 % (74.64 % mortality), DDT 4 % (83.36 % mortality) and deltamethrin 0.05 % (88.53 % mortality). Suspected resistance was observed to permethrin 0.75 % (91.19 % mortality), bendiocarb 0.1 % (94.13 % mortality) and dieldrin 4 % (96.41 % mortality). However, this population is fully susceptible to malathion 5 % (100 % mortality) and fenitrothion 1 % (100 % mortality). The microarray and qRT-PCR analysis indicated that the lambda-cyhalothrin resistance in Gankette Balla is conferred by metabolic resistance mechanisms under the probable control of cytochrome P450 genes among which CYP6M7 is the most overexpressed. The absence of overexpression of the P450 gene, CYP6P9a, indicates that the resistance mechanism in Senegal is different to that observed in southern Africa. This study represents the first report of pyrethroid and DDT resistance in An. funestus from Senegal and shows that resistance to insecticides is not only confined to An. gambiae as previously thought. Therefore, urgent action should be taken to manage the resistance in this species to ensure the continued effectiveness of malaria control.

  13. Triple Immunoglobulin Gene Knockout Transchromosomic Cattle: Bovine Lambda Cluster Deletion and Its Effect on Fully Human Polyclonal Antibody Production

    PubMed Central

    Matsushita, Hiroaki; Sano, Akiko; Wu, Hua; Jiao, Jin-an; Kasinathan, Poothappillai; Sullivan, Eddie J.; Wang, Zhongde; Kuroiwa, Yoshimi

    2014-01-01

    Towards the goal of producing fully human polyclonal antibodies (hpAbs or hIgGs) in transchromosomic (Tc) cattle, we previously reported that Tc cattle carrying a human artificial chromosome (HAC) comprising the entire unrearranged human immunoglobulin (Ig) heavy-chain (hIGH), kappa-chain (hIGK), and lambda-chain (hIGL) germline loci produced physiological levels of hIgGs when both of the bovine immunoglobulin mu heavy-chains, bIGHM and bIGHML1, were homozygously inactivated (bIGHM−/−, bIGHML1−/−; double knockouts or DKO). However, because endogenous bovine immunoglobulin light chain loci are still intact, the light chains are produced both from the hIGK and hIGL genomic loci on the HAC and from the endogenous bovine kappa-chain (bIGK) and lambda-chain (bIGL) genomic loci, resulting in the production of fully hIgGs (both Ig heavy-chains and light-chains are of human origin: hIgG/hIgκ or hIgG/hIgλ) and chimeric hIgGs (Ig heavy-chains are of human origin while the Ig light-chains are of bovine origin: hIgG/bIgκ or hIgG/bIgλ). To improve fully hIgG production in Tc cattle, we here report the deletion of the entire bIGL joining (J) and constant (C) gene cluster (bIGLJ1-IGLC1 to bIGLJ5-IGLC5) by employing Cre/loxP mediated site-specific chromosome recombination and the production of triple knockout (bIGHM−/−, bIGHML1−/− and bIGL−/−; TKO) Tc cattle. We further demonstrate that bIGL cluster deletion greatly improves fully hIgGs production in the sera of TKO Tc cattle, with 51.3% fully hIgGs (hIgG/hIgκ plus hIgG/hIgλ). PMID:24603704

  14. [Excitation transfer between high-lying states in K2 in collisions with ground state K and H2 molecules].

    PubMed

    Shen, Xiao-Yan; Liu, Jing; Dai, Kang; Shen, Yi-Fan

    2010-02-01

    Pure potassium vapor or K-H2 mixture was irradiated in a glass fluorescence cell with pulses of 710 nm radiation from an OPO laser, populating K2 (1lambda(g)) state by two-photon absorption. Cross sections for 1lambda(g)-3lambda(g) transfer in K2 were determined using methods of molecular fluorescence. During the experiments with pure K vapor, the cell temperature was varied between 553 and 603 K. The K number density was determined spectroscopically by the white-light absorption measurement in the blue wing of the self-broadened resonance D2 line. The resulting fluorescence included a direct component emitted in the decay of the optically excitation and a sensitized component arising from the collisionally populated state. The decay signal of time-resolved fluorescence from1lambda(g) -->1 1sigma(u)+ transition was monitored. It was seen that just after the laser pulse the fluorescence of the photoexcited level decreased exponentially. The effective lifetimes of the 1lambda(g) state can be resolved. The plot of reciprocal of effective lifetimes of the 1lambda(g) state against K densities yielded the slope that indicated the total cross section for deactivation and the intercept that provided the radiative lifetime of the state. The radiative lifetime (20 +/- 2) ns was obtained. The cross section for deactivation of the K2(1lambda(g)) molecules by collisions with K is (2.5 +/- 0.3) x 10(-14) cm2. The time-resolved intensities of the K23lambda(g) --> 1 3sigma(u)+ (484 nm) line were measured. The radiative lifetime (16.0 +/- 3.2) ns and the total cross section (2.5 +/- 0.6) x 10(-14) cm2 for deactivation of the K2 (3lambda(g)) state can also be determined through the analogous procedure. The time-integrated intensities of 1lambda(g) --> 1 1sigma(u)+ and 3lambda(g) --> 1 3sigma(u)+ transitions were measured. The cross section (1.1 +/- 0.3) x10(-14) cm2 was obtained for K2 (1lambda(g))+ K --> K2 (3lambda(g)) + K collisions. During the experiments with K-H2 mixture, the cell temperature was kept constant at 553 K. The H2 pressure was varied between 40 and 400 Pa. The effects of K2-K collisions could not be neglected. These effects were subtracted out using the results of the pure K experiments. The cross section (2.7 +/- 1.1) x 10(-15) cm2 was obtained for K2 (1lambda(g)) + H2 --> K2 (3lambda(g))+H2 collisions. The cross section is (6.8 +/- 2.7) x 10(-15) cm2 for K2 (3lambda(g)) + H2 --> states out of K2 (3lambda(g)) + H2 collisions.

  15. Magnetic penetration depth of YBa2Cu3O(7-delta) thin films determined by the power transmission method

    NASA Technical Reports Server (NTRS)

    Heinen, Vernon O.; Miranda, Felix A.; Bhasin, Kul B.

    1992-01-01

    A power transmission measurement technique was used to determine the magnetic penetration depth (lambda) of YBa2Cu3O(7-delta) superconducting thin films on LaAlO3 within the 26.5 to 40.0 GHz frequency range, and at temperatures from 20 to 300 K. Values of lambda ranging from 1100 to 2500 A were obtained at low temperatures. The anisotropy of lambda was determined from measurements of c-axis and a-axis oriented films. An estimate of the intrinsic value of lambda of 90 +/- 30 nm was obtained from the dependence of lambda on film thickness. The advantage of this technique is that it allows lambda to be determined nondestructively.

  16. Measurement of the Branching Ratio Lambda_c+ -> p pi+ pi- (in Spanish)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lopez-Hinojosa, Guillermo; /San Luis Potosi U.

    2008-03-01

    The confirmation of the Cabibbo-suppressed charm baryon decay mode {Lambda}{sub c}{sup +} {yields} p{pi}{sup +}{pi}{sup -} is reported. All data analyzed are from SELEX, a fixed target experiment at Fermilab that took data during 1996 and 1997, mainly with a 600 GeV/c {Sigma}{sup -} beam. The branching ratio of the Cabibbo-suppressed decay mode {Lambda}{sub c}{sup +} {yields} p{pi}{sup +}{pi}{sup -} relative to the Cabibbo-favored mode {Lambda}{sub c}{sup +} {yields} pK{sup -}{pi}{sup +} is measured to be: {Gamma}({Lambda}{sub c}{sup +} {yields} p{pi}{sup +}{pi}{sup -})/{Gamma}({Lambda}{sub c}{sup +} {yields} pK{sup -}{pi}{sup +}) = 0.103 {+-} 0.022.

  17. Genes and Structural Proteins of the Phage Syn5 of the Marine Cyanobacteria Synechococcus

    DTIC Science & Technology

    2005-09-01

    typhimurium phage P22, a podoviridae, was shown to possess extensive genomic similarity to coliphage lambda, a siphoviridae (Botstein and Herskowitz...are found among cyanobacteria in the surface waters during the winter. Temperature influences the number of infectious particles produced during lytic...grids and stained with 1% uranyl acetate for 15 minutes, washed three times in double-distilled water , stained in 1% lead citrate for 4 minutes, and

  18. Autofluorescence spectroscopy of oral mucosa

    NASA Astrophysics Data System (ADS)

    Majumdar, S. K.; Uppal, A.; Gupta, P. K.

    1998-06-01

    We report the results of an in-vitro study on autofluorescence from pathologically characterized normal and malignant squamous tissues from the oral cavity. The study involved biopsy samples from 47 patients with oral cancer of which 11 patients had cancer of tongue, 17 of buccal mucosa and 19 of alveolus. The results of excitation and emission spectroscopy at several wavelengths (280 nm less than or equal to (lambda) exless than or equal to 460 nm; 340 nm less than or equal to (lambda) em less than or equal to 520 nm) showed that at (lambda) ex equals 337 nm and 400 nm the mean value for the spectrally integrated fluorescence intensity [(Sigma) (lambda ) IF((lambda) )] from the normal tissue sites was about a factor of 2 larger than that from the malignant tissue sites. At other excitation wavelengths the difference in (Sigma) (lambda ) IF((lambda) ) was not statistically significant. Similarly, for (lambda) em equals 390 nm and 460 nm, the intensity of the 340 nm band of the excitation spectra from normal tissues was observed to be a factor of 2 larger than that from malignant tissues. Analysis of these results suggests that NADH concentration is higher in normal oral tissues compared to the malignant. This contrasts with our earlier observation of an reduced NADH concentration in normal sites of breast tissues vis a vis malignant sites. For the 337 nm excited emission spectra a 10-variable MVLR score (using (Sigma) (lambda ) IF((lambda) ) and normalized intensities at nine wavelengths as input parameters) provided a sensitivity and specificity of 95.7% and 93.1% over the sample size investigated.

  19. Biological trait analysis and stability of lambda-cyhalothrin resistance in the house fly, Musca domestica L. (Diptera: Muscidae).

    PubMed

    Abbas, Naeem; Shah, Rizwan Mustafa; Shad, Sarfraz Ali; Iqbal, Naeem; Razaq, Muhammad

    2016-05-01

    House flies, Musca domestica L., (Diptera: Muscidae), are pests of poultry and have the ability to develop resistance to insecticides. To design a strategy for resistance management, life history traits based on laboratory observations were established for lambda-cyhalothrin-resistant, susceptible and reciprocal crosses of M. domestica strains. Bioassay results showed that the lambda-cyhalothrin-selected strain developed a resistance ratio of 98.34 compared to its susceptible strain. The lambda-cyhalothrin-selected strain had a relative fitness of 0.26 and lower fecundity, hatchability, lower number of next generation larvae, and net reproductive rate compared with its susceptible strain. Mean population growth rates, such as intrinsic rate of population increase, and biotic potential were lower for the lambda-cyhalothrin-selected strain compared to its susceptible strain. Resistance to lambda-cyhalothrin, indoxacarb, and abamectin was unstable while resistance to bifenthrin and methomyl was stable in the lambda-cyhalothrin-selected strain of M. domestica. Development of resistance can cost considerable fitness for the lambda-cyhalothrin-selected strain. The present study provided useful information for making potential management strategies to delay resistance development in M. domestica.

  20. Depolymerized products of lambda-carrageenan as a potent angiogenesis inhibitor.

    PubMed

    Chen, Haimin; Yan, Xiaojun; Lin, Jing; Wang, Feng; Xu, Weifeng

    2007-08-22

    Since angiogenesis is involved in initiating and promoting several diseases such as cancer and cardiovascular events, this study was designed to evaluate the anti-angiogenesis of low-molecular-weight (LMW), highly sulfated lambda-carrageenan oligosaccharides (lambda-CO) obtained by carrageenan depolymerization, by CAM (chick chorioallantoic membrane) model and human umbilical vein endothelial cells (HUVECs). Significant inhibition of vessel growth was observed at 200 microg/pellet. A histochemistry assay also revealed a decrease of capillary plexus and connective tissue in lambda-CO treated samples. lambda-CO inhibited the viability of cells at the high concentration of 1 mg/mL, whereas it affected the cell survival slightly (>95%) at a low concentration (<250 microg/mL), and HUVEC is the most sensitive to lambda-CO among three kinds of cells. Furthermore, the inhibitory action of lambda-CO was also observed in the endothelial cell invasion and migration at relatively low concentration (150-300 microg/mL), through down-regulation of intracellular matrix metalloproteinases (MMP-2) expression on endothelial cells. Taken together, these findings demonstrate that lambda-CO is a potential angiogenesis inhibitor with combined effects of inhibiting invasion, migration, and proliferation.

  1. Oxidative and apoptotic effects of lambda-cyhalothrin modulated by piperonyl butoxide in the liver of Oreochromis niloticus.

    PubMed

    Piner, Petek; Uner, Nevin

    2012-05-01

    The aim of this study was to investigate the toxic effects of pyrethroid pesticide lambda-cyhalothrin in the presence of piperonyl butoxide as a modulator in the liver of juvenile Oreochromis niloticus. LC(50) (96h) value of lambda-cyhalothrin was determined as 2.901μg/L for O. niloticus. The fish were exposed to 0.48μg/L (1/6 of the 96-h LC(50)) lambda-cyhalothrin and 10μg/L piperonyl butoxide for 96-h and 15-d. tGSH, GSH, GSSG, Hsp70 and TBARS contents, GPx, GR, GST and caspase-3 enzymes activities were determined. Lambda-cyhalothrin caused increases in tGSH, GSH, TBARS contents, and GST activity. Piperonyl butoxide treatment with lambda-cyhalothrin caused significant increases in tGSH GSH, Hsp70, TBARS contents, and GPx and GST activities while caspase-3 activity was decreased. The results of the present study revealed that lambda-cyhalothrin caused oxidative stress which upregulated GSH and GSH-related enzymes. Piperonyl butoxide increased the oxidative stress potential and apoptotic effects of lambda-cyhalothrin. Copyright © 2012 Elsevier B.V. All rights reserved.

  2. Long-depth imaging of specific gene expressions in whole-mount mouse embryos with single-photon excitation confocal fluorescence microscopy and FISH.

    PubMed

    Palmes-Saloma, C; Saloma, C

    2000-07-01

    Long-depth imaging of specific gene expression in the midgestation whole-mount mouse embryo (WME) is demonstrated with single-photon excitation (1PE) confocal fluorescence microscopy and fluorescence in situ hybridization. Expression domains of Pax-6 mRNA transcripts were labeled with an in situ hybridization probe that is a RNA sequence complementary to the cloned gene fragment and were rendered visible using two fluorochrome-conjugated antibodies that fluoresce at peak wavelengths of lambda(F) = 0.525 microm and lambda(F) = 0. 580 microm, respectively. Distributions of Pax-6 mRNA domains as deep as 1000 microm in the day 9.5 WME were imaged with a long-working-distance (13.6 mm) objective lens (magnification 5x). The scattering problem posed by the optically thick WME sample is alleviated by careful control of the detector pinhole size and the application of simple but fast postdetection image enhancement techniques, such as space and wavelength averaging to produce high-quality fluorescence images. A three-dimensional reconstruction that clearly shows the Pax-6 mRNA expression domains in the forebrain, diencephalon, optic cup, and spinal cord of the day 9.5 WME is obtained. The advantages of 1PE confocal fluorescence imaging over two-photon excitation fluorescence imaging are discussed for the case of long-depth imaging in highly scattering media. Imaging in midgestation WMEs at optical depths of more than 350 microm has not yet been realized with two-photon fluorescence excitation. Copyright 2000 Academic Press.

  3. A verotoxin 1 B subunit-lambda CRO chimeric protein specifically binds both DNA and globotriaosylceramide (Gb(3)) to effect nuclear targeting of exogenous DNA in Gb(3) positive cells.

    PubMed

    Facchini, L M; Lingwood, C A

    2001-09-10

    Inefficient nuclear incorporation of foreign DNA remains a critical roadblock in the development of effective nonviral gene delivery systems. DNA delivered by traditional protocols remains within endosomal/lysosomal vesicles, or is rapidly degraded in the cytoplasm. Verotoxin I (VT), an AB(5) subunit toxin produced by enterohaemorrhagic Escherichia coli, binds to the cell surface glycolipid, globotriaosylceramide (Gb(3)) and is internalized into preendosomes. VT is then retrograde transported to the Golgi, endoplasmic reticulum (ER), and nucleus of highly VT-sensitive cells. We have utilized this nuclear targeting of VT to design a unique delivery system which transports exogenous DNA via vesicular traffic to the nucleus. The nontoxic VT binding subunit (VTB) was fused to the lambda Cro DNA-binding repressor, generating a 14-kDa VTB-Cro chimera. VTB-Cro binds specifically via the Cro domain to a 25-bp DNA fragment containing the consensus Cro operator. VTB-Cro demonstrates simultaneous specific binding to Gb(3). Treatment of Vero cells with fluorescent-labeled Cro operator DNA in the presence of VTB-Cro, results in DNA internalization to the Golgi, ER, and nucleus, whereas fluorescent DNA alone is incorporated poorly and randomly within the cytoplasm. VTB-Cro mediated nuclear DNA transport is prevented by brefeldin A, consistent with Golgi/ER intracellular routing. Pretreatment with filipin had no effect, indicating that caveoli are not involved. This novel VTB-Cro shuttle protein may find practical applications in the fields of intracellular targeting, gene delivery, and gene therapy. Copyright 2001 Academic Press.

  4. Determination of $${{\\rm{\\Lambda }}}_{\\overline{{\\rm{MS}}}}$$ at five loops from holographic QCD

    DOE PAGES

    Deur, Alexandre; Brodsky, Stanley J.; de Téramond, Guy F.

    2017-08-25

    Here, the recent determination of themore » $$\\beta$$--function of the QCD running coupling $$\\alpha_{\\overline{MS}}(Q^2)$$ to five-loops, provides a verification of the convergence of a novel method for determining the fundamental QCD parameter $$\\Lambda_s$$ based on the Light-Front Holographic approach to nonperturbative QCD. The new 5-loop analysis, together with improvements in determining the holographic QCD nonperturbative scale parameter $$\\kappa$$ from hadronic spectroscopy, leads to an improved precision of the value of $$\\Lambda_s$$ in the $${\\overline{MS}}$$ scheme close to a factor of two; we find $$\\Lambda^{(3)}_{\\overline{MS}}=0.339\\pm0.019$$ GeV for $$n_{f}=3$$, in excellent agreement with the world average, $$\\Lambda_{\\overline{MS}}^{(3)}=0.332\\pm0.017$$ GeV. Lastly, we also discuss the constraints imposed on the scale dependence of the strong coupling in the nonperturbative domain by superconformal quantum mechanics and its holographic embedding in anti-de Sitter space.« less

  5. IUE and Einstein observations of the LINER galaxy NGC 4579

    NASA Technical Reports Server (NTRS)

    Reichert, G. A.; Puchnarewicz, E. M.; Mason, K. O.

    1990-01-01

    Results of International Ultraviolet Explorer (IUE) and Einstein observations of the LINER galaxy NGC 4579 are reported. Spatial profiles of the long wavelength IUE emission show a two component structure, with an unresolved core superimposed on broader underlying emission. The core spectrum shows strong C II lambda 2326 and broad Mg II lambda 2800 emission, and perhaps emission due to blends of Fe II multiplets (2300 to 23600 angstrom). The short wavelength emission is spatially unresolved, and shows C II lambda 1335, C III lambda 1909 broad C IV lambda 1550 emission, and a broad feature at approximately 1360 angstrom which may be due to 0.1 lambda 1356. Contrary to previous reports no evidence for He II lambda 1640 is found in the spectrum. An unresolved x ray source is detected at the location of the nucleus; its spectrum is well fitted by a power law of energy slope alpha approximately -0.5. These results further support the idea that NGC 4579 may contain a dwarf Seyfert nucleus.

  6. Segregated tandem filter for enhanced conversion efficiency in a thermophotovoltaic energy conversion system

    DOEpatents

    Brown, Edward J.; Baldasaro, Paul F.; Dziendziel, Randolph J.

    1997-01-01

    A filter system to transmit short wavelength radiation and reflect long wavelength radiation for a thermophotovoltaic energy conversion cell comprises an optically transparent substrate segregation layer with at least one coherent wavelength in optical thickness; a dielectric interference filter deposited on one side of the substrate segregation layer, the interference filter being disposed toward the source of radiation, the interference filter including a plurality of alternating layers of high and low optical index materials adapted to change from transmitting to reflecting at a nominal wavelength .lambda..sub.IF approximately equal to the bandgap wavelength .lambda..sub.g of the thermophotovoltaic cell, the interference filter being adapted to transmit incident radiation from about 0.5.lambda..sub.IF to .lambda..sub.IF and reflect from .lambda..sub.IF to about 2.lambda..sub.IF ; and a high mobility plasma filter deposited on the opposite side of the substrate segregation layer, the plasma filter being adapted to start to become reflecting at a wavelength of about 1.5.lambda..sub.IF.

  7. [In vitro anti-angiogenic action of lambda-carrageenan oligosaccharides].

    PubMed

    Chen, Hai-Min; Yan, Xiao-Jun; Wang, Feng; Lin, Jing; Xu, Wei-Feng

    2007-06-01

    This study was designed to evaluate the inhibition effect of lambda-carrageenan oligosaccharides on neovascularization in vitro by chick chorioallantoic membrane (CAM) model and human umbilical vein endothelial cell ( HUVEC). lambda-Carrageenan oligosaccharides caused a dose-dependent decrease of the vascular density of CAM, and adversely affected capillary plexus formation. At a high concentration of 1 mg x mL(-1), this compound inhibited the endothelial cell proliferation, while low concentration of lambda-carrageenan oligosaccharides (< 250 microg x mL(-1)) affected the cell survival slightly (> 95%). Different cytotoxic sensitivity of lambda-carrageenan oligosaccharides in three kinds of cells was observed, of which HUVEC is the most sensitive to this oligosaccharides. The inhibitory action of lambda-carrageenan oligosaccharides on the endothelial cell invasion and migration was also observed at relatively low concentration (150 - 300 microg x mL(-1)) through down-regulation of intracellular matrix metalloproteinases-2 (MMP-2) expression on endothelial cells. Current observations demonstrated that lambda-carrageenan oligosaccharides are potential angiogenesis inhibitor with combined effects of inhibiting invasion, migration and proliferation.

  8. Effect of atmospheric extinction on laser rangefinder performance at 1.54 and 0.6 microns

    NASA Technical Reports Server (NTRS)

    Hutt, D. L.; Theriault, J.-M.; Larochelle, V.; Bonnier, D.

    1992-01-01

    Extinction of laser rangefinder (LRF) pulses by the atmosphere depends on the wavelength, weather conditions, and aerosol concentration along the optical path. In the IR, extinction is due to absorption by molecular constituents and scattering and absorption by aerosols. The total atmospheric extinction alpha(lambda) is the sum of the molecular and aerosol contributions, alpha(sub m)(lambda)and Alpha(sub a)(lambda). We present simple expressions for alpha(sub m)(lambda) and alpha(sub a)(lambda) for two LRF sources: Er:glass and CO2 which operate at 1.54 and 10.6 microns, respectively. The expressions are based on accepted models of atmospheric aerosols and molecular extinction and give an estimate of alpha(lambda) as a function of standard meteorological parameters, assuming horizontal beam propagation. Signal-to-noise ratios of LRF returns, measured from a reference target under different weather conditions are compared to predictions based on the estimate of alpha(lambda).

  9. On Spectral Invariance of Single Scattering Albedo for Water Droplets and Ice Crystals at Weakly Absorbing Wavelengths

    NASA Technical Reports Server (NTRS)

    Marshak, Alexander; Knyazikhin, Yuri; Chiu, J. Christine; Wiscombe, Warren J.

    2012-01-01

    The single scattering albedo omega(sub O lambda) in atmospheric radiative transfer is the ratio of the scattering coefficient to the extinction coefficient. For cloud water droplets both the scattering and absorption coefficients, thus the single scattering albedo, are functions of wavelength lambda and droplet size r. This note shows that for water droplets at weakly absorbing wavelengths, the ratio omega(sub O lambda)(r)/omega(sub O lambda)(r (sub O)) of two single scattering albedo spectra is a linear function of omega(sub O lambda)(r). The slope and intercept of the linear function are wavelength independent and sum to unity. This relationship allows for a representation of any single scattering albedo spectrum omega(sub O lambda)(r) via one known spectrum omega(sub O lambda)(r (sub O)). We provide a simple physical explanation of the discovered relationship. Similar linear relationships were found for the single scattering albedo spectra of non-spherical ice crystals.

  10. Duality symmetry and power-law fading of frustration in a quantum multiconnected superconductor

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Sun, S.N.; Ralston, J.P.

    1991-03-01

    We generalize the Alexander--de Gennes equations to a new system of superconducting-wire networks, allowing for variation of the cross-sectional area of wires. The generalized equations are solved for a square lattice of different cross-sectional-area ratios {lambda} in the {ital x} and {ital y} directions. A symmetry of {lambda}{r arrow}1/{lambda} is related to the Aubry-Andre duality and an obvious geometric property. We find that even a slight geometric asymmetry can soften the fine structure of the magnetic phase boundary considerably. We obtain a power-law dependence on the parameter {lambda} as {lambda}{r arrow}{infinity} and {lambda}{r arrow}0. For a finite-area ratio {lambda}, wemore » speculate that a simple analytic fit incorporating the dual symmetry is close to the exact nonperturbative behavior. The system is also related analytically to a recent study of Hu and Chen, which revealed a power-law behavior for a rectangular lattice.« less

  11. Radiation damage and repair in cells and cell components. Progress report, 1980-1981

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Not Available

    1981-01-01

    One aim has been to see whether, in E.coli, the various phenomena which were ascribed to the induction of the recA gene produce (p-recA) are really manifestations of one process. It was concluded that this is true for septum inhibition, Weigle-reactivation, induced inhibition of post radiation DNA degradation, and with the additional concept of a premutational lesion, for uv mutagenesis. lambda prophage induction may perhaps be brought into line with p-recA induction with the consideration of the additional secondary aspects of (a) activation of p-recA to make it enzymatically active and (b) the need to have the concentration of activatedmore » p-recA high enough to keep up with the rate of production of lambda-repressors. Revertants seem to be in more than one class and two of these can not easily be explained by the idea that p-recA contains an error-prone repair enzyme that makes errors at mutagenic lesions.« less

  12. [Atypical chronic myeloid leukemia presenting with trilineage dysplasia and IgG (lambda) type monoclonal gammopathy].

    PubMed

    Itoh, K; Kashimura, T; Kobayashi, Y; Yagasaki, F; Sakata, T; Kawai, N; Matsuda, A; Kusumoto, S; Fukuda, M; Ino, H; Murohashi, I; Jinnai, I; Yoshida, S; Bessho, M; Saitoh, M; Hirashima, K

    1999-02-01

    A 78-year-old man was diagnosed as leukocytosis in February 1994. Physical examination revealed marked hepatosplenomegaly. A peripheral blood examination disclosed 95,090/microliter leukocytes without hiatus leukemicus, 6.5 g/dl Hb, and 15.0 x 10(4)/microliter platelets. The neutrophil alkaline phosphatase score was 27, and serum VB12 was above 1,600pg/ml. IgG was identified as monoclonal immunoglobulin of type lambda. Bone marrow specimens demonstrated marked granulocytic hyperplasia. Neither the Philadelphia chromosome (Ph1) nor BCR gene rearrangement was detected; hence, the diagnosis of Ph1 (-) chronic myeloid leukemia (CML) was made. The patient was treated with hydroxyurea and low-dose VP-16 with no improvement, and died of pneumonia and sepsis in June 1995. This case was considered to be consistent with atypical CML (aCML) according to the FAB classification because monocytosis was not observed. It seems likely and interesting that the coexistent monoclonal gammopathy and aCML might have arisen from common abnormal hematopoietic stem cells.

  13. Further improvements of a new model for turbulent convection in stars

    NASA Technical Reports Server (NTRS)

    Canuto, V. M.; Mazzitelli, I.

    1992-01-01

    The effects of including a variable molecular weight and of using the newest opacities of Rogers and Iglesias (1991) as inputs to a recent model by Canuto and Mazzitelli (1991) for stellar turbulent convection are studied. Solar evolutionary tracks are used to conclude that the the original model for turbulence with mixing length Lambda = z, Giuli's variable Q unequal to 1 and the new opacities yields a fit to solar T(eff) within 0.5 percent. A formulation of Lambda is proposed that extends the purely nonlocal Lambda = z expression to include local effects. A new expression for Lambda is obtained which generalizes both the mixing length theory (MLT) phenomenological expression for Lambda as well as the model Lambda = z. It is argued that the MLT should now be abandoned.

  14. Rayleigh, the unit for light radiance.

    PubMed

    Baker, D J

    1974-09-01

    A 0.7% accurate formula is derived for the easy conversion of power spectral radiance L(lambda) in W cm(-2) sr(-1) microm(-1)to rayleigh spectral radiance R(lambda) in rayleigh/microm, R(lambda) = 2pilambdaL(lambda) x 10(13), where the wavelength lambda is in microm. The rationale for the rayleigh unit is discussed in terms of a photon rate factor and a solid angle factor. The latter is developed in terms of an equivalence theorem about optical receivers and extended sources, and the concept is extended to the computation of photon volume emission rates from altitude profiles of zenith radiance.

  15. Total enantioselectivity in the DNA binding of the dinuclear ruthenium(II) complex [[Ru(Me2bpy)2]2(mu-bpm)]4+ [bpm = 2,2'-bipyrimidine; Me2bpy = 4,4'-dimethyl-2,2'-bipyridine].

    PubMed

    Smith, Jayden A; Collins, J Grant; Patterson, Bradley T; Keene, F Richard

    2004-05-07

    The binding of the three stereoisomers (DeltaDelta-, LambdaLambda- and DeltaLambda-) of the dinuclear ruthenium(II) complex [[Ru(Me2bpy)2]2(mu-bpm)]4+ [Me2bpy = 4,4'-dimethyl-2,2'-bipyridine; bpm = 2,2'-bipyrimidine] to a tridecanucleotide containing a single adenine bulge has been studied by 1H NMR spectroscopy. The addition of the DeltaDelta-isomer to d(CCGAGAATTCCGG)2 induced significant chemical shift changes for the base and sugar resonances of the residues at the bulge site (G3A4G5/C11C10), whereas small shifts were observed upon addition of the enantiomeric LambdaLambda-form. NOESY spectra of the tridecanucleotide bound with the DeltaDelta-isomer revealed intermolecular NOE's between the metal complex and the nucleotide residues at the bulge site, while only weak NOE's were observed to terminal residues to the LambdaLambda-form. Competitive binding studies were performed where both enantiomers were simultaneously added to the tridecanucleotide, and for all ratios of the two stereoisomers the DeltaDelta-isomer remained selectively bound at the bulge site with the LambdaLambda-enantiomer localised at the terminal regions of the tridecanucleotide. The meso-diastereoisomer (DeltaLambda) was found to bind to the tridecanucleotide with characteristics intermediate between the DeltaDelta- and LambdaLambda-enantiomers of the rac form. Two distinct sets of metal complex resonances were observed, with one set having essentially the same shift as the free metal complex, whilst the other set of resonances exhibited significant shifts. The NOE data indicated that the meso-diastereoisomer does not bind as selectively as the DeltaDelta-isomer, with NOE's observed to a greater number of nucleotide residues compared to the DeltaDelta-form. This study provides a rare example of total enantioselectivity in the binding of an inert transition metal complex to DNA, produced by the shape recognition of both ruthenium(II) centres.

  16. FAR-ULTRAVIOLET SPECTRAL IMAGES OF THE VELA SUPERNOVA REMNANT: SUPPLEMENTS AND COMPARISONS WITH OTHER WAVELENGTH IMAGES

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kim, Il-Joong; Seon, Kwang-Il; Han, Wonyong

    We present the improved far-ultraviolet (FUV) emission-line images of the entire Vela supernova remnant (SNR) using newly processed Spectroscopy of Plasma Evolution from Astrophysical Radiation/Far-Ultraviolet Imaging Spectrograph (SPEAR/FIMS) data. The incomplete C III {lambda}977 and O VI {lambda}{lambda}1032, 1038 images presented in the previous study are updated to cover the whole region. The C IV {lambda}{lambda}1548, 1551 image with a higher resolution and new images at Si IV {lambda}{lambda}1394, 1403, O IV] {lambda}1404, He II {lambda}1640.5, and O III] {lambda}{lambda}1661, 1666 are also shown. Comparison of emission-line ratios for two enhanced FUV regions reveals that the FUV emissions of themore » east-enhanced FUV region may be affected by nonradiative shocks of another very young SNR, the Vela Jr. SNR (RX J0852.0-4622, G266.6-1.2). This result is the first FUV detection that is likely associated with the Vela Jr. SNR, supporting previous arguments that the Vela Jr. SNR is close to us. The comparison of the improved FUV images with soft X-ray images shows that an FUV filamentary feature forms the boundary of the northeast-southwest asymmetrical sections of the X-ray shell. The southwest FUV features are characterized as the region where the Vela SNR is interacting with slightly denser ambient medium within the dim X-ray southwest section. From a comparison with the H{alpha} image, we identify a ring-like H{alpha} feature overlapped with an extended hot X-ray feature of similar size and two local peaks of C IV emission. Their morphologies are expected when the H{alpha} ring is in direct contact with the near or far side of the Vela SNR.« less

  17. VizieR Online Data Catalog: [CII] emission in the ISM of 20 nearby galaxies (Croxall+, 2017)

    NASA Astrophysics Data System (ADS)

    Croxall, K. V.; Smith, J. D.; Pellegrini, E.; Groves, B.; Bolatto, A.; Herrera-Camus, R.; Sandstrom, K. M.; Draine, B.; Wolfire, M. G.; Armus, L.; Boquien, M.; Brandl, B.; Dale, D.; Galametz, M.; Hunt, L.; Kennicutt, R.; Kreckel, K.; Rigopoulou, D.; van der Werf, P.; Wilson, C.

    2018-04-01

    Our observations include photometric and spectral-line observations from both the PACS and SPIRE instruments onboard Herschel, obtained as part of the large KINGFISH (Key Insights on Nearby Galaxies: a Far- Infrared Survey with Herschel, Kennicutt+ 2011PASP..123.1347K) and BtP (Beyond the Peak; OT1_jsmith1; P.I. J.D. Smith) projects. [NII]205um BtP observations were performed with SPIRE-FTS intermediate mapping, which is a 4-point dither. E. Pellegrini et al. (2017, in preparation) will contain a full description of the observations and reductions. [CII]158um and [NII]122um emission lines, and 70 and 160um continuum maps have been observed as part the Herschel Open Time Key Program KINGFISH. The data and the associated reduction are described in Kennicutt+ (2011PASP..123.1347K) and Croxall+ (2013ApJ...777...96C). (2 data files).

  18. Herschel Far Infrared Spectra of Dusty Star-Forming Galaxies

    NASA Astrophysics Data System (ADS)

    Wilson, Derek; Cooray, Asantha R.; Nayyeri, Hooshang

    2017-01-01

    We stack archival spectra from the Herschel Space Observatory's SPIRE Spectrometer in three redshift bins from low redshifts (z < 0.2), through intermediate redshifts (0.2 < z < 1), and up to high redshifts (z > 1) in order to determine the average properties of the gas and dust in dusty, star-forming galaxies and (U)LIRGs. In the lower-redshift stack, we detect a host of water and carbon monoxide rotational transition lines, as well as some fine structure lines such as [NII]. At intermediate redshifts, only a [CII] line appears. The high-redshift stack displays strong [CII] emission, as well as faint emission from [OI] and [OIII]. The observed emission lines are used to model the average number density and radiation field strength in the photodissociation regions of our high-redshift sample, and the spectral line energy distributions of CO rotational transitions from the low-redshift stack are presented.

  19. Consistent response of bird populations to climate change on two continents.

    PubMed

    Stephens, Philip A; Mason, Lucy R; Green, Rhys E; Gregory, Richard D; Sauer, John R; Alison, Jamie; Aunins, Ainars; Brotons, Lluís; Butchart, Stuart H M; Campedelli, Tommaso; Chodkiewicz, Tomasz; Chylarecki, Przemysław; Crowe, Olivia; Elts, Jaanus; Escandell, Virginia; Foppen, Ruud P B; Heldbjerg, Henning; Herrando, Sergi; Husby, Magne; Jiguet, Frédéric; Lehikoinen, Aleksi; Lindström, Åke; Noble, David G; Paquet, Jean-Yves; Reif, Jiri; Sattler, Thomas; Szép, Tibor; Teufelbauer, Norbert; Trautmann, Sven; van Strien, Arco J; van Turnhout, Chris A M; Vorisek, Petr; Willis, Stephen G

    2016-04-01

    Global climate change is a major threat to biodiversity. Large-scale analyses have generally focused on the impacts of climate change on the geographic ranges of species and on phenology, the timing of ecological phenomena. We used long-term monitoring of the abundance of breeding birds across Europe and the United States to produce, for both regions, composite population indices for two groups of species: those for which climate suitability has been either improving or declining since 1980. The ratio of these composite indices, the climate impact indicator (CII), reflects the divergent fates of species favored or disadvantaged by climate change. The trend in CII is positive and similar in the two regions. On both continents, interspecific and spatial variation in population abundance trends are well predicted by climate suitability trends. Copyright © 2016, American Association for the Advancement of Science.

  20. Limits on the Decay-Rate Difference of Neutral-B Mesons and on CP, T, and CPT Violation in B0-antiB0 Oscillations

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Aubert, B

    2004-02-29

    Using events in which one of two neutral-B mesons from the decay of an {Upsilon}(4S) resonance is fully reconstructed, we set limits on the difference between the decay rates of the two neutral-B mass eigenstates and on CP, T, and CPT violation in B{sup 0}{bar B}{sup 0} mixing. The reconstructed decays, comprising both CP and flavor eigenstates, are obtained from 88 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II asymmetric-energy B Factory at SLAC. We determine six independent parameters governing oscillations ({Delta}m, {Delta}{Lambda}/{Lambda}), CPT and CP violation (Re z, Im z), and CP andmore » T violation (Im {lambda}{sub CP}, |q/p|), where {lambda}{sub cp} characterizes B{sup 0} and {bar B}{sup 0} decays to states of charmonium plus K{sub S}{sup 0} or K{sub L}{sup 0}. The results are sgn(Re {lambda}{sub CP}){Delta}{Lambda}/{Lambda} = .0.008 {+-} 0.037(stat.) {+-} 0.018(syst.) [-0.084, 0.068], |q/p| = 1.029 {+-} 0.013(stat.) {+-} 0.011(syst.) [1.001, 1.057], (Re {lambda}{sub CP}/|{lambda}{sub CP}|)Re z = 0.014 {+-} 0.035(stat.) {+-} 0.034(syst.) [-0.072, 0.101], Imz = 0.038 {+-} 0.029(stat.) {+-} 0.025(syst.) [-0.028, 0.104]. The values inside square brackets indicate the 90% confidence-level intervals. The values of Im {lambda}{sub CP} and {Delta}m are consistent with previous analyses and are used as cross-checks. These measurements are in agreement with Standard Model expectations.« less

  1. Simple model for lambda-doublet propensities in bimolecular reactions

    NASA Technical Reports Server (NTRS)

    Bronikowski, Michael J.; Zare, Richard N.

    1990-01-01

    A simple geometric model is presented to account for lambda-doublet propensities in bimolecular reactions A + BC - AB + C. It applies to reactions in which AB is formed in a pi state, and in which the unpaired molecular orbital responsible for lambda-doubling arises from breaking the B-C bond. The lambda-doublet population ratio is predicted to be 2:1 provided that: (1) the motion of A in the transition state determines the plane of rotation of AB; (2) the unpaired pi orbital lying initially along the B-C bond may be resolved into a projection onto the AB plane of rotation and a projection perpendicular to this plane; (3) there is no preferred geometry for dissociation of ABC. The 2:1 lambda-doublet ratio is the 'unconstrained dynamics prior' lambda-doublet distribution for such reactions.

  2. Effective screening length of isotropic liquid samples submitted to an applied voltage.

    PubMed

    Zola, R S; Evangelista, L R; Barbero, G

    2006-05-25

    A cell of isotropic liquid in the shape of a slab of thickness d and containing ionic impurities is considered. It is shown that the screening effect produced by the ionic charges on the external field is characterized by an effective surface length, lambda(S)(U), depending on the applied voltage U. The analysis indicates that lambda(S)(U)) < lambda(D) when the applied voltage is very large, and lambda(S)(U) --> lambda(D) for very small values of the applied voltage, where lambda(D) is the Debye screening length. The presence of the ions is responsible also for a counterpotential, v, that for small U is such to cancel the effective electric field in the sample, whereas in the opposite limit it is inversely proportional to the applied difference of potential.

  3. The Legacy Archive for Microwave Background Data Analysis (LAMBDA)

    NASA Astrophysics Data System (ADS)

    Miller, Nathan; LAMBDA

    2018-01-01

    The Legacy Archive for Microwave Background Data Analysis (LAMBDA) provides CMB researchers with archival data for cosmology missions, software tools, and links to other sites of interest. LAMBDA is one-stop shopping for CMB researchers. It hosts data from WMAP along with many suborbital experiments. Over the past year, LAMBDA has acquired new data from SPTpol, SPIDER and ACTPol. In addition to the primary CMB, LAMBDA also provides foreground data.LAMBDA has several ongoing efforts to provide tools for CMB researchers. These tools include a web interface for CAMB and a web interface for a CMB survey footprint database and plotting tool. Additionally, we have recently developed a Docker container with standard CMB analysis tools and demonstrations in the form of Jupyter notebooks. These containers will be publically available through Docker's container repository and the source will be available on github.

  4. The protein interaction map of bacteriophage lambda

    PubMed Central

    2011-01-01

    Background Bacteriophage lambda is a model phage for most other dsDNA phages and has been studied for over 60 years. Although it is probably the best-characterized phage there are still about 20 poorly understood open reading frames in its 48-kb genome. For a complete understanding we need to know all interactions among its proteins. We have manually curated the lambda literature and compiled a total of 33 interactions that have been found among lambda proteins. We set out to find out how many protein-protein interactions remain to be found in this phage. Results In order to map lambda's interactions, we have cloned 68 out of 73 lambda open reading frames (the "ORFeome") into Gateway vectors and systematically tested all proteins for interactions using exhaustive array-based yeast two-hybrid screens. These screens identified 97 interactions. We found 16 out of 30 previously published interactions (53%). We have also found at least 18 new plausible interactions among functionally related proteins. All previously found and new interactions are combined into structural and network models of phage lambda. Conclusions Phage lambda serves as a benchmark for future studies of protein interactions among phage, viruses in general, or large protein assemblies. We conclude that we could not find all the known interactions because they require chaperones, post-translational modifications, or multiple proteins for their interactions. The lambda protein network connects 12 proteins of unknown function with well characterized proteins, which should shed light on the functional associations of these uncharacterized proteins. PMID:21943085

  5. Molecular cloning and expression of Corynebacterium glutamicum genes for amino acid synthesis in Escherichia coli cells

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Beskrovnaya, O.Yu.; Fonshtein, M.Yu.; Kolibaba, L.G.

    1989-01-01

    Molecular cloning of Corynebacterium glutamicum genes for threonine and lysine synthesis has been done in Escherichia coli cells. The clonal library of EcoRI fragments of chromosomal DNA of C. glutamicum was constructed on the plasmid vector /lambda/pSL5. The genes for threonine and lysine synthesis were identified by complementation of E. coli mutations in thrB and lysA genes, respectively. Recombinant plasmids, isolated from independent ThrB/sup +/ clone have a common 4.1-kb long EcoRI DNA fragment. Hybrid plasmids isolated from LysA/sup +/ transductants of E. coli have common 2.2 and 3.3 kb long EcoRI fragments of C. glutamicum DNA. The hybrid plasmidsmore » consistently transduced the markers thrB/sup +/ and lysA/sup +/. The Southern hybridization analysis showed that the cloned DNA fragments hybridized with the fragments of identical length in C. glutamicum chromosomes.« less

  6. Risk assessment of lambda-cyhalothrin on aquatic organisms in paddy field in China.

    PubMed

    Gu, Bao G; Wang, Hui M; Chen, William L; Cai, Dao J; Shan, Zheng J

    2007-06-01

    This study was carried out to assess the risk of lambda-cyhalothrin to aquatic organisms used in paddy field, and to provide assistance in the ecological risk management of lambda-cyhalothrin. The acute toxicities of five individual formulations of lambda-cyhalothrin to four aquatic species were investigated in the laboratory, as well as in a simulated paddy field-pond ecosystem, and the results implicated that lambda-cyhalothrin is highly toxic to fish, and to a greater extent to shrimp. There were differences in the toxicities to each aquatic organisms among different formulations. lambda-Cyhalothrin degraded rapidly in the environment, with half-lives of different formulations in paddy field water (0.23-0.53 days), pond water (0.38-0.63 days), and paddy field soil (0.96-7.35 days), respectively. The water overflow from the paddy field following a simulated rainstorm 12h after application of lambda-cyhalothrin did not cause injury to fish, clam or crab, but was severely hazardous to shrimp. Additionally, no injury to shrimp was found when simulated overflow occurred 4 days after application. These results suggest that the environmental risk of lambda-cyhalothrin to aquatic organisms can be reduced by (1) developing a relatively safe formulation such as a suspension concentrate, and/or (2) controlling the drainage time of the paddy field.

  7. Stereoselective degradation and thyroid endocrine disruption of lambda-cyhalothrin in lizards (Eremias argus) following oral exposure.

    PubMed

    Chang, Jing; Hao, Weiyu; Xu, Yuanyuan; Xu, Peng; Li, Wei; Li, Jianzhong; Wang, Huili

    2018-01-01

    The disturbance of the thyroid system and elimination of chiral pyrethroid pesticides with respect to enantioselectivity in reptiles have so far received limited attention by research. In this study, bioaccumulation, thyroid gland lesions, thyroid hormone levels, and hypothalamus-pituitary-thyroid axis-related gene expression in male Eremias argus were investigated after three weeks oral administration of lambda-cyhalothrin (LCT) enantiomers. In the lizard liver, the concentration of LCT was negatively correlated with the metabolite-3-phenoxybenzoic acid (PBA) level during 21 days of exposure. (+)-LCT exposure induced a higher thyroid follicular epithelium height than (-)-LCT exposure. The thyroxine levels were increased in both treated groups while only (+)-LCT exposure induced a significant change in the triiodothyronine (T3) level. In addition, the expressions of hypothalamus-pituitary-thyroid axis-related genes including thyroid hormone receptors (trs), deiodinases (dios), uridinediphosphate glucuronosyltransferase (udp), and sulfotransferase (sult) were up-regulated after exposure to the two enantiomers. (+)-LCT treatment resulted in higher expression of trs and (-)-LCT exposure led to greater stimulation of dios in the liver, which indicated PBA-induced antagonism on thyroid hormone receptors and LCT-induced disruption of thyroxine (T4) deiodination. The results suggest the (-)-LCT exposure causes higher residual level in lizard liver while induces less disruption on lizard thyroid activity than (+)-LCT. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. T7 RNA polymerase-driven inducible cell lysis for DNA transfer from Escherichia coli to Bacillus subtilis.

    PubMed

    Juhas, Mario; Ajioka, James W

    2017-11-01

    The majority of the good DNA editing techniques have been developed in Escherichia coli; however, Bacillus subtilis is better host for a plethora of synthetic biology and biotechnology applications. Reliable and efficient systems for the transfer of synthetic DNA between E. coli and B. subtilis are therefore of the highest importance. Using synthetic biology approaches, such as streamlined lambda Red recombineering and Gibson Isothermal Assembly, we integrated genetic circuits pT7L123, Repr-ts-1 and pLT7pol encoding the lysis genes of bacteriophages MS2, ΦX174 and lambda, the thermosensitive repressor and the T7 RNA polymerase into the E. coli chromosome. In this system, T7 RNA polymerase regulated by the thermosensitive repressor drives the expression of the phage lysis genes. We showed that T7 RNA polymerase significantly increases efficiency of cell lysis and transfer of the plasmid and bacterial artificial chromosome-encoded DNA from the lysed E. coli into B. subtilis. The T7 RNA polymerase-driven inducible cell lysis system is suitable for the efficient cell lysis and transfer of the DNA engineered in E. coli to other naturally competent hosts, such as B. subtilis. © 2017 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  9. Modelling the interactions between Pseudomonas putida and Escherichia coli O157:H7 in fish-burgers: use of the lag-exponential model and of a combined interaction index.

    PubMed

    Speranza, B; Bevilacqua, A; Mastromatteo, M; Sinigaglia, M; Corbo, M R

    2010-08-01

    The objective of the current study was to examine the interactions between Pseudomonas putida and Escherichia coli O157:H7 in coculture studies on fish-burgers packed in air and under different modified atmospheres (30 : 40 : 30 O(2) : CO(2) : N(2), 5 : 95 O(2) : CO(2) and 50 : 50 O(2) : CO(2)), throughout the storage at 8 degrees C. The lag-exponential model was applied to describe the microbial growth. To give a quantitative measure of the occurring microbial interactions, two simple parameters were developed: the combined interaction index (CII) and the partial interaction index (PII). Under air, the interaction was significant (P < 0.05) only within the exponential growth phase (CII, 1.72), whereas under the modified atmospheres, the interactions were highly significant (P < 0.001) and occurred both in the exponential and in the stationary phase (CII ranged from 0.33 to 1.18). PII values for E. coli O157:H7 were lower than those calculated for Ps. putida. The interactions occurring into the system affected both E. coli O157:H7 and pseudomonads subpopulations. The packaging atmosphere resulted in a key element. The article provides some useful information on the interactions occurring between E. coli O157:H7 and Ps. putida on fish-burgers. The proposed index describes successfully the competitive growth of both micro-organisms, giving also a quantitative measure of a qualitative phenomenon.

  10. Tephrostratigraphy of Grotta del Cavallo, Southern Italy: Insights on the chronology of Middle to Upper Palaeolithic transition in the Mediterranean

    NASA Astrophysics Data System (ADS)

    Zanchetta, Giovanni; Giaccio, Biagio; Bini, Monica; Sarti, Lucia

    2018-02-01

    The Grotta del Cavallo contains one of the most important stratification of Mousterian, Uluzzian and Final Epigravettian tecnocomplexes; its chronology is of paramount importance for understanding the timing of the transition between Middle and Upper Palaeolithic in the Mediterranean region as well as the demise of the Neanderthal and the dispersal of the first anatomically modern humans through Europe. Within the stratigraphy of the cave three different volcanic ash layers occur (layer G, Fa and C-II). They are located in the middle section of the Mousterian (layer G), in between the Mousterian and Uluzzian layers (layer Fa) and on top of the Uluzzian horizons (layer C-II). The three tephra layers were chemically fingerprinted and correlated to well-known and precisely dated widespread Late Pleistocene tephra markers. Specifically, layer G, Fa and C-II were correlated to the X-6 (108.7 ± 0.9 ka), Y-6 (45.5 ± 1.0 ka) and Campanian Ignimbrite (39.85 ± 0.14 ka), respectively. These findings provide robust chronological points allowing to conclude that: (i) the Mousterian occupation of the cave took place after the fall of the sea level following the MIS 5e high-stand; (ii) the Mousterian-Uluzzian boundary can be dated to 45.5 ± 1.0 ka and climatostratigraphically firmly placed at the transition between the Greenland Interstadial 12 (GI12)-Greenland Stadial 12 (GS12); (iii) the Uluzzian lasted for at least five millennial spanning the GS12-GI9 period and ended at beginning of the Heinrich Event 4.

  11. Morphology of the tympanic-basicranial region in Mirounga leonina (Phocidae, Carnivora), postnatal ontogeny and sexual dimorphism

    PubMed Central

    Loza, C M; Scarano, A C; Soibelzon, L H; Negrete, J; Carlini, A A

    2015-01-01

    The auditory region of pinnipeds has seldom been described. Here we describe and analyze the ontogenetic trajectory of the tympanic bulla of the southern elephant seal, Mirounga leonina (Phocidae, Mammalia). This species is extremely sexually dimorphic and highly polygynous (organized in harems). We examined 118 specimens, arranged in three age classes (CI, CII, and CIII), ranging from newborn to adults (males and females). To analyze the overall size and shape of the tympanic bulla we performed a geometric morphometric analysis including 87 skulls. Females reach definitive shape and size of the bulla at earlier ontogenetic stages than males, in agreement with their earlier involvement in reproductive activities. The internal anatomy of the tympanic region (e.g. form and extension of the paries) does not show remarkable differences between sexes or age classes. The greatest differences between age classes are related to bone thickness, resulting from the apposition of new annual layers. An examination of possible sex-related external differences among age classes shows significant shape differences between males and females in CIII. The morphology observed in neonates is conserved across all individuals from CI, which included specimens up to 1 year old. Clear morphological differences were observed between CI individuals, on one hand, and CII individuals plus CIII females on the other. During cranial development of both male and females, the glenoid cavity expands and compresses the bulla; this condition reaches its maximum expression in CIII males. CIII males showed the greatest morphological differences, with respect to both CI and CII individuals, and CIII females. PMID:25827162

  12. Segregated tandem filter for enhanced conversion efficiency in a thermophotovoltaic energy conversion system

    DOEpatents

    Brown, E.J.; Baldasaro, P.F.; Dziendziel, R.J.

    1997-12-23

    A filter system to transmit short wavelength radiation and reflect long wavelength radiation for a thermophotovoltaic energy conversion cell comprises an optically transparent substrate segregation layer with at least one coherent wavelength in optical thickness; a dielectric interference filter deposited on one side of the substrate segregation layer, the interference filter being disposed toward the source of radiation, the interference filter including a plurality of alternating layers of high and low optical index materials adapted to change from transmitting to reflecting at a nominal wavelength {lambda}{sub IF} approximately equal to the bandgap wavelength {lambda}{sub g} of the thermophotovoltaic cell, the interference filter being adapted to transmit incident radiation from about 0.5{lambda}{sub IF} to {lambda}{sub IF} and reflect from {lambda}{sub IF} to about 2{lambda}{sub IF}; and a high mobility plasma filter deposited on the opposite side of the substrate segregation layer, the plasma filter being adapted to start to become reflecting at a wavelength of about 1.5{lambda}{sub IF}. 10 figs.

  13. On the ordinary quiver of the symmetric group over a field of characteristic 2

    NASA Astrophysics Data System (ADS)

    Martin, Stuart; Russell, Lee

    1997-11-01

    Let [fraktur S]n and [fraktur A]n denote the symmetric and alternating groups of degree n[set membership][open face N] respectively. Let p be a prime number and let F be an arbitrary field of characteristic p. We say that a partition of n is p-regular if no p (non-zero) parts of it are equal; otherwise we call it p-singular. Let S[lambda]F denote the Specht module corresponding to [lambda]. For [lambda] a p-regular partition of n let D[lambda]F denote the unique irreducible top factor of S[lambda]F. Denote by [Delta][lambda]F =D[lambda]F [downward arrow][fraktur A]n its restriction to [fraktur A]n. Recall also that, over F, the ordinary quiver of the modular group algebra FG is a finite directed graph defined as follows: the vertices are labelled by the set of all simple FG-modules, L1, [ctdot], Lr, and the number of arrows from Li to Lj equals dimFExtFG(Li, Lj). The quiver gives important information about the block structure of G.

  14. The anomalous C 4 intensity ratio in symbiotic stars

    NASA Technical Reports Server (NTRS)

    Michalitsianos, A. G.; Kafatos, M.; Fahey, R. P.

    1988-01-01

    The C IV lambda lambda 1548.2,1550.8 resonance doublet in a symbiotic stars was shown to exhibit anomalous line intensity ratios in which I (lambda 1548.2)/I(lambda 1550.8) less than 1, or less than the optically-thick limit of unity. The R Aquarii-central HII region and RX Puppis exhibit this phenomena. The I(lambda 1548.2)/I(lambda 1550.8) ratio in RX Puppis is found to vary inversely with the total C IV line intensity, and with the FES-visual light, as the object declined over a 5 yr period following a brightening in UV and optical emission which peaked in 1982. This doublet intensity behavior could be explained by a wind which has a narrow velocity range of 600 approx. less than sup v wind approx. less than 1000 km/sec, or by the pumping of the Fe II (mul. 45.01) transition a sup 4 F sub 9/2 - y sup 4 H(o) sub 11/2 by C IV lambda 1548.2, which effectively scatters C IV photons into the Fe II spectrum in these objects.

  15. Absorption of {Lambda}(1520) hyperons in photon-nucleus collisions

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Paryev, E. Ya.

    2012-12-15

    In the framework of the nuclear spectral function approach for incoherent primary photon-nucleon and secondary pion-nucleon production processes we study the inclusive {Lambda}(1520)-hyperon production in the interaction of 2-GeV photons with nuclei. In particular, the A and momentum dependences of the absolute and relative {Lambda}(1520)-hyperon yields are investigated in two scenarios for its in-medium width. Our model calculations show that the pion-nucleon production channel contributes appreciably to the {Lambda}(1520) creation at intermediate momenta both in light and heavy nuclei in the chosen kinematics and, hence, has to be taken into consideration on close examination of the dependences of the {Lambda}(1520)-hyperonmore » yields on the target mass number with the aim to get information on its width in the medium. They also demonstrate that the A and momentum dependences of the absolute and relative {Lambda}(1520)-hyperon production cross sections at incident energy of interest are markedly sensitive to the {Lambda}(1520) in-medium width, which means that these observables may be an important tool to determine the above width.« less

  16. 47 CFR 22.880 - Information exchange.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Air-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a) Prior notification. Public safety/CII licensees may notify a commercial aviation air-ground system...

  17. Cytoplasmic Copper Detoxification in Salmonella Can Contribute to SodC Metalation but Is Dispensable during Systemic Infection

    PubMed Central

    Fenlon, Luke A.

    2017-01-01

    ABSTRACT Salmonella enterica serovar Typhimurium is a leading cause of foodborne disease worldwide. Severe infections result from the ability of S. Typhimurium to survive within host immune cells, despite being exposed to various host antimicrobial factors. SodCI, a copper-zinc-cofactored superoxide dismutase, is required to defend against phagocytic superoxide. SodCII, an additional periplasmic superoxide dismutase, although produced during infection, does not function in the host. Previous studies suggested that CueP, a periplasmic copper binding protein, facilitates acquisition of copper by SodCII. CopA and GolT, both inner membrane ATPases that pump copper from the cytoplasm to the periplasm, are a source of copper for CueP. Using in vitro SOD assays, we found that SodCI can also utilize CueP to acquire copper. However, both SodCI and SodCII have a significant fraction of activity independent of CueP and cytoplasmic copper export. We utilized a series of mouse competition assays to address the in vivo role of CueP-mediated SodC activation. A copA golT cueP triple mutant was equally as competitive as the wild type, suggesting that sufficient SodCI is active to defend against phagocytic superoxide independent of CueP and cytoplasmic copper export. We also confirmed that a strain containing a modified SodCII, which is capable of complementing a sodCI deletion, was fully virulent in a copA golT cueP background competed against the wild type. These competitions also address the potential impact of cytoplasmic copper toxicity within the phagosome. Our data suggest that Salmonella does not encounter inhibitory concentrations of copper during systemic infection. IMPORTANCE Salmonella is a leading cause of gastrointestinal disease worldwide. In severe cases, Salmonella can cause life-threatening systemic infections, particularly in very young children, the elderly, or people who are immunocompromised. To cause disease, Salmonella must survive the hostile environment inside host immune cells, a location in which most bacteria are killed. Our work examines how one particular metal, copper, is acquired by Salmonella to activate a protein important for survival within immune cells. At high levels, copper itself can inhibit Salmonella. Using a strain of Salmonella that cannot detoxify intracellular copper, we also addressed the in vivo role of copper as an antimicrobial agent. PMID:28924031

  18. Carbon Chemistry in Transitional Clouds from the GOT C+ Survey of CII 158 micron Emission in the Galactic Plane

    NASA Astrophysics Data System (ADS)

    Langer, W. D.; Velusamy, T.; Pineda, J.; Willacy, K.; Goldsmith, P. F.

    2011-05-01

    In understanding the lifecycle and chemistry of the interstellar gas, the transition from diffuse atomic to molecular gas clouds is a very important stage. The evolution of carbon from C+ to C0 and CO is a fundamental part of this transition, and C+ along with its carbon chemistry is a key diagnostic. Until now our knowledge of interstellar gas has been limited primarily to the diffuse atomic phase traced by HI and the dense molecular H2 phase traced by CO. However, we have generally been missing an important layer in diffuse and transition clouds, which is denoted by the warm "dark gas'', that is mostly H2 and little HI and CO, and is best traced with C+. Here, we discuss the chemistry in the transition from C+ to C0 and CO in these clouds as understood by a survey of the CII 1.9 THz (158 micron) line from a sparse survey of the inner galaxy over about 40 degrees in longitude as part of the Galactic Observations of Terahertz C+ (GOT C+) program, a Herschel Space Observatory Open Time Key Program to study interstellar clouds by sampling ionized carbon. Using the first results from GOT C+ along 11 LOSs, in a sample of 53 transition clouds, Velusamy, Langer et al. (A&A 521, L18, 2010) detected an excess of CII intensities indicative of a thick H2 layer (a significant warm H2, "dark gas'' component) around the 12CO core. Here we present a much larger, statistically significant sample of a few hundred diffuse and transition clouds traced by CII, along with auxiliary HI and CO data in the inner Galaxy between l=-30° and +30°. Our new and more extensive sample of transition clouds is used to elucidate the time dependent physical and carbon chemical evolution of diffuse to transition clouds, and transition layers. We consider the C+ to CO conversion pathways such as H++ O and C+ + H2 chemistry for CO production to constrain the physical parameters such as the FUV intensity and cosmic ray ionization rate that drive the CO chemistry in the diffuse transition clouds.

  19. Cytoplasmic Copper Detoxification in Salmonella Can Contribute to SodC Metalation but Is Dispensable during Systemic Infection.

    PubMed

    Fenlon, Luke A; Slauch, James M

    2017-12-15

    Salmonella enterica serovar Typhimurium is a leading cause of foodborne disease worldwide. Severe infections result from the ability of S Typhimurium to survive within host immune cells, despite being exposed to various host antimicrobial factors. SodCI, a copper-zinc-cofactored superoxide dismutase, is required to defend against phagocytic superoxide. SodCII, an additional periplasmic superoxide dismutase, although produced during infection, does not function in the host. Previous studies suggested that CueP, a periplasmic copper binding protein, facilitates acquisition of copper by SodCII. CopA and GolT, both inner membrane ATPases that pump copper from the cytoplasm to the periplasm, are a source of copper for CueP. Using in vitro SOD assays, we found that SodCI can also utilize CueP to acquire copper. However, both SodCI and SodCII have a significant fraction of activity independent of CueP and cytoplasmic copper export. We utilized a series of mouse competition assays to address the in vivo role of CueP-mediated SodC activation. A copA golT cueP triple mutant was equally as competitive as the wild type, suggesting that sufficient SodCI is active to defend against phagocytic superoxide independent of CueP and cytoplasmic copper export. We also confirmed that a strain containing a modified SodCII, which is capable of complementing a sodCI deletion, was fully virulent in a copA golT cueP background competed against the wild type. These competitions also address the potential impact of cytoplasmic copper toxicity within the phagosome. Our data suggest that Salmonella does not encounter inhibitory concentrations of copper during systemic infection. IMPORTANCE Salmonella is a leading cause of gastrointestinal disease worldwide. In severe cases, Salmonella can cause life-threatening systemic infections, particularly in very young children, the elderly, or people who are immunocompromised. To cause disease, Salmonella must survive the hostile environment inside host immune cells, a location in which most bacteria are killed. Our work examines how one particular metal, copper, is acquired by Salmonella to activate a protein important for survival within immune cells. At high levels, copper itself can inhibit Salmonella Using a strain of Salmonella that cannot detoxify intracellular copper, we also addressed the in vivo role of copper as an antimicrobial agent. Copyright © 2017 American Society for Microbiology.

  20. Alterations in mitochondrial electron transport system activity in response to warm acclimation, hypoxia-reoxygenation and copper in rainbow trout, Oncorhynchus mykiss.

    PubMed

    Sappal, Ravinder; MacDougald, Michelle; Fast, Mark; Stevens, Don; Kibenge, Fred; Siah, Ahmed; Kamunde, Collins

    2015-08-01

    Fish expend significant amounts of energy to handle the numerous potentially stressful biotic and abiotic factors that they commonly encounter in aquatic environments. This universal requirement for energy singularizes mitochondria, the primary cellular energy transformers, as fundamental drivers of responses to environmental change. Our study probed the interacting effects of thermal stress, hypoxia-reoxygenation (HRO) and copper (Cu) exposure in rainbow trout to test the prediction that they act jointly to impair mitochondrial function. Rainbow trout were acclimated to 11 (controls) or 20°C for 2 months. Liver mitochondria were then isolated and their responses in vitro to Cu (0-20μM) without and with HRO were assessed. Sequential inhibition and activation of mitochondrial electron transport system (ETS) enzyme complexes permitted the measurement of respiratory activities supported by complex I-IV (CI-IV) in one run. The results showed that warm acclimation reduced fish and liver weights but increased mitochondrial protein indicating impairment of energy metabolism, increased synthesis of defense proteins and/or reduced liver water content. Whereas acute rise (11→20°C) in temperature increased mitochondrial oxidation rates supported by CI-IV, warm acclimation reduced the maximal (state 3) and increased the basal (state 4) respiration leading to global uncoupling of oxidative phosphorylation (OXPHOS). HRO profoundly inhibited both maximal and basal respiration rates supported by CI-IV, reduced RCR for all except CII and lowered CI:CII respiration ratio, an indication of decreased OXPHOS efficiency. The effects of Cu were less pronounced but more variable and included inhibition of CII-IV maximal respiration rates and stimulation of both CI and CIII basal respiration rates. Surprisingly, only CII and CIII indices exhibited significant 3-way interactions whereas 2-way interactions of acclimation either with Cu or HRO were portrayed mostly by CIV, and those of HRO and Cu were most common in CI and II respiratory indices. Our study suggests that warm acclimation blunts sensitivity of the ETS to temperature rise and that HRO and warm acclimation impose mitochondrial changes that sensitize the ETS to Cu. Overall, our study highlights the significance of the ETS in mitochondrial bioenergetic dysfunction caused by thermal stress, HRO and Cu exposure. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Spectroscopy of the neutron-rich hypernucleus He Λ 7 from electron scattering

    DOE PAGES

    Gogami, T.; Chen, C.; Kawama, D.; ...

    2016-08-12

    Here, the missing mass spectroscopy of themore » $$^{7}_{\\Lambda}$$He hypernucleus was performed, using the $$^{7}$$Li$$(e,e^{\\prime}K^{+})^{7}_{\\Lambda}$$He reaction at the Thomas Jefferson National Accelerator Facility Hall C. The $$\\Lambda$$ binding energy of the ground state (1/2$$^{+}$$) was determined with a smaller error than that of the previous measurement, being $$B_{\\Lambda}$$ = 5.55 $$\\pm$$ 0.10(stat.) $$\\pm$$ 0.11(sys.) MeV. The experiment also provided new insight into charge symmetry breaking in p-shell hypernuclear systems. Finally, a peak at $$B_{\\Lambda}$$ = 3.65 $$\\pm$$ 0.20(stat.) $$\\pm$$ 0.11(sys.) MeV was observed and assigned as a mixture of 3/2$$^{+}$$ and 5/2$$^{+}$$ states, confirming the "gluelike" behavior of $$\\Lambda$$, which makes an unstable state in $$^{6}$$He stable against neutron emission.« less

  2. A 2-lambda laser-induced flurorescence field instrument for ground-based and airborne measurements of atmospheric OH

    NASA Technical Reports Server (NTRS)

    Rodgers, M. O.; Bradshaw, J. D.; Sandholm, S. T.; Kesheng, S.; Davis, D. D.

    1985-01-01

    A number of techniques have been proposed for detecting atmospheric OH radicals. Of these, the laser-induced fluorescence (LIF) technique has been used by the largest number of investigators. One of the problems arising in connection with the implementation of this technique is related to the perturbing effect of the UV (lambda approximately 282 nm) laser beam used for OH monitoring, while another problem relates to signal extraction. Several new LIF approaches have been or are currently under development with the objective to bring both problems under control. The present paper deals with the experimental features of one of these new approaches. The considered approach is referred to as 2-lambda laser-induced fluorescence (2-lambda LIF). It is shown that the 2-lambda LIF system provides significant advantages over earlier 1-lambda LIF OH measurement instruments operating at ambient pressure.

  3. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Deur, Alexandre; Brodsky, Stanley J.; de Téramond, Guy F.

    Here, the recent determination of themore » $$\\beta$$--function of the QCD running coupling $$\\alpha_{\\overline{MS}}(Q^2)$$ to five-loops, provides a verification of the convergence of a novel method for determining the fundamental QCD parameter $$\\Lambda_s$$ based on the Light-Front Holographic approach to nonperturbative QCD. The new 5-loop analysis, together with improvements in determining the holographic QCD nonperturbative scale parameter $$\\kappa$$ from hadronic spectroscopy, leads to an improved precision of the value of $$\\Lambda_s$$ in the $${\\overline{MS}}$$ scheme close to a factor of two; we find $$\\Lambda^{(3)}_{\\overline{MS}}=0.339\\pm0.019$$ GeV for $$n_{f}=3$$, in excellent agreement with the world average, $$\\Lambda_{\\overline{MS}}^{(3)}=0.332\\pm0.017$$ GeV. Lastly, we also discuss the constraints imposed on the scale dependence of the strong coupling in the nonperturbative domain by superconformal quantum mechanics and its holographic embedding in anti-de Sitter space.« less

  4. Simultaneous display of two large proteins on the head and tail of bacteriophage lambda.

    PubMed

    Pavoni, Emiliano; Vaccaro, Paola; D'Alessio, Valeria; De Santis, Rita; Minenkova, Olga

    2013-09-30

    Consistent progress in the development of bacteriophage lambda display platform as an alternative to filamentous phage display system was achieved in the recent years. The lambda phage has been engineered to display efficiently multiple copies of peptides or even large protein domains providing a powerful tool for screening libraries of peptides, proteins and cDNA. In the present work we describe an original method for dual display of large proteins on the surface of lambda particles. An anti-CEA single-chain antibody fragment and green fluorescent protein or alkaline phosphatase were simultaneously displayed by engineering both gpD and gpV lambda proteins. Here we show that such modified phage particles can be used for the detection of target molecules in vitro and in vivo. Dual expression of functional moieties on the surface of the lambda phage might open the way to generation of a new class of diagnostic and therapeutic targeted nanoparticles.

  5. Primary Dendrite Arm Spacings in Al-7Si Alloy Directionally Solidified on the International Space Station

    NASA Technical Reports Server (NTRS)

    Angart, Samuel; Lauer, Mark; Poirier, David; Tewari, Surendra; Rajamure, Ravi; Grugel, Richard

    2015-01-01

    Samples from directionally solidified Al- 7 wt. % Si have been analyzed for primary dendrite arm spacing (lambda) and radial macrosegregation. The alloy was directionally solidified (DS) aboard the ISS to determine the effect of mitigating convection on lambda and macrosegregation. Samples from terrestrial DS-experiments thermal histories are discussed for comparison. In some experiments, lambda was measured in microstructures that developed during the transition from one speed to another. To represent DS in the presence of no convection, the Hunt-Lu model was used to represent diffusion controlled growth under steady-state conditions. By sectioning cross-sections throughout the entire length of a solidified sample, lambda was measured and calculated using the model. During steady-state, there was reasonable agreement between the measured and calculated lambda's in the space-grown samples. In terrestrial samples, the differences between measured and calculated lambda's indicated that the dendritic growth was influenced by convection.

  6. Measurement of the Lambdab0 lifetime in Lambdab0 --> Lambdac+pi- decays in pp collisions at square root of s = 1.96 TeV.

    PubMed

    Aaltonen, T; Adelman, J; Alvarez González, B; Amerio, S; Amidei, D; Anastassov, A; Annovi, A; Antos, J; Apollinari, G; Apresyan, A; Arisawa, T; Artikov, A; Asaadi, J; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Barria, P; Bartos, P; Bauer, G; Beauchemin, P-H; Bedeschi, F; Beecher, D; Behari, S; Bellettini, G; Bellinger, J; Benjamin, D; Beretvas, A; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Bridgeman, A; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Calancha, C; Camarda, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carls, B; Carlsmith, D; Carosi, R; Carrillo, S; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavaliere, V; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, K; Chokheli, D; Chou, J P; Chung, K; Chung, W H; Chung, Y S; Chwalek, T; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Compostella, G; Convery, M E; Conway, J; Corbo, M; Cordelli, M; Cox, C A; Cox, D J; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Dagenhart, D; Datta, M; Davies, T; de Barbaro, P; De Cecco, S; Deisher, A; De Lorenzo, G; Dell'Orso, M; Deluca, C; Demortier, L; Deng, J; Deninno, M; d'Errico, M; Di Canto, A; di Giovanni, G P; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Donati, S; Dong, P; Dorigo, T; Dube, S; Ebina, K; Elagin, A; Erbacher, R; Errede, D; Errede, S; Ershaidat, N; Eusebi, R; Fang, H C; Farrington, S; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Ferrazza, C; Field, R; Flanagan, G; Forrest, R; Frank, M J; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; Garcia, J E; Garfinkel, A F; Garosi, P; Gerberich, H; Gerdes, D; Gessler, A; Giagu, S; Giakoumopoulou, V; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C M; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, S R; Halkiadakis, E; Han, B-Y; Han, J Y; Happacher, F; Hara, K; Hare, D; Hare, M; Harr, R F; Hartz, M; Hatakeyama, K; Hays, C; Heck, M; Heinrich, J; Herndon, M; Heuser, J; Hewamanage, S; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Hou, S; Houlden, M; Hsu, S-C; Hughes, R E; Hurwitz, M; Husemann, U; Hussein, M; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; James, E; Jang, D; Jayatilaka, B; Jeon, E J; Jha, M K; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Kar, D; Karchin, P E; Kato, Y; Kephart, R; Ketchum, W; Keung, J; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, H W; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kreps, M; Kroll, J; Krop, D; Krumnack, N; Kruse, M; Krutelyov, V; Kuhr, T; Kulkarni, N P; Kurata, M; Kwang, S; Laasanen, A T; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, E; Lee, H S; Lee, J S; Lee, S W; Leone, S; Lewis, J D; Lin, C-J; Linacre, J; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, C; Liu, T; Lockyer, N S; Loginov, A; Lovas, L; Lucchesi, D; Lueck, J; Lujan, P; Lukens, P; Lungu, G; Lys, J; Lysak, R; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis-Katsikakis, A; Margaroli, F; Marino, C; Marino, C P; Martin, A; Martin, M S; Martin, V; Martínez, M; Martínez-Ballarín, R; Mastrandrea, P; Mathis, M; Mattson, M E; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzione, A; Mesropian, C; Miao, T; Mietlicki, D; Miladinovic, N; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyake, H; Moed, S; Moggi, N; Mondragon, M N; Moon, C S; Moore, R; Morello, M J; Morlock, J; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagai, Y; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Nett, J; Neu, C; Neubauer, M S; Neubauer, S; Nielsen, J; Nodulman, L; Norman, M; Norniella, O; Nurse, E; Oakes, L; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Orava, R; Osterberg, K; Pagan Griso, S; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramanov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Peiffer, T; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Pianori, E; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Potamianos, K; Poukhov, O; Prokoshin, F; Pronko, A; Ptohos, F; Pueschel, E; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Renton, P; Renz, M; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rodriguez, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Rutherford, B; Saarikko, H; Safonov, A; Sakumoto, W K; Santi, L; Sartori, L; Sato, K; Savoy-Navarro, A; Schlabach, P; Schmidt, A; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sforza, F; Sfyrla, A; Shalhout, S Z; Shears, T; Shepard, P F; Shimojima, M; Shiraishi, S; Shochet, M; Shon, Y; Shreyber, I; Simonenko, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soha, A; Somalwar, S; Sorin, V; Squillacioti, P; Stanitzki, M; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Strycker, G L; Suh, J S; Sukhanov, A; Suslov, I; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tang, J; Tecchio, M; Teng, P K; Thom, J; Thome, J; Thompson, G A; Thomson, E; Tipton, P; Ttito-Guzmán, P; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Totaro, P; Tourneur, S; Trovato, M; Tsai, S-Y; Tu, Y; Turini, N; Ukegawa, F; Uozumi, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Vellidis, C; Vidal, M; Vila, I; Vilar, R; Vogel, M; Volobouev, I; Volpi, G; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wagner-Kuhr, J; Wakisaka, T; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Weinelt, J; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Wilbur, S; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wolfe, H; Wright, T; Wu, X; Würthwein, F; Yagil, A; Yamamoto, K; Yamaoka, J; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yi, K; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanetti, A; Zeng, Y; Zhang, X; Zheng, Y; Zucchelli, S

    2010-03-12

    We report a measurement of the lifetime of the Lambda(b)(0) baryon in decays to the Lambda(c)(+)pi(-) final state in a sample corresponding to 1.1 fb(-1) collected in pp collisions at square root of s = 1.96 TeV by the CDF II detector at the Tevatron collider. Using a sample of about 3000 fully reconstructed Lambda(b)(0) events we measure tau(Lambda(b)(0)) = 1.401 +/- 0.046(stat) +/- 0.035(syst) ps (corresponding to ctau(Lambda(b)(0)) = 420.1 +/- 13.7(stat) +/- 10.6(syst) microm, where c is the speed of light). The ratio of this result and the world average B(0) lifetime yields tau(Lambda(b)(0))/tau(B(0)) = 0.918 +/- 0.038 (stat) and (syst), in good agreement with recent theoretical predictions.

  7. {Lambda}K*{Lambda}(1116) photoproduction and nucleon resonances

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kim, Sang-Ho; Kim, Hyun-Chul; Nam, Seung-il

    2011-10-21

    In this presentation, we report our recent studies on the {Lambda}K*{Lambda}(1116) photoproduction off the proton target, using the tree-level Born approximation, via the effective Lagrangian approach. In addition, we include the nine (three- or four-star confirmed) nucleon resonances below the threshold {radical}(s{sub th}){approx_equal}2008 MeV, to interpret the discrepancy between the experiment and previous theoretical studies, in the vicinity of the threshold region. From the numerical studies, we observe that the S{sub 11}(1535) and S11(1650) play an important role for the cross-section enhancement near the {radical}(s{sub th}). It also turns out that, in order to reproduce the data, we have themore » vector coupling constants gK*S{sub 11}(1535){Lambda} = (7.0{approx}9.0) and gK*S{sub 11}(1650){Lambda} (5.0{approx}6.0).« less

  8. Spectroscopic studies and structure of 3-methoxy-2 -[(2,4,4,6,6-pentachloro-1,3,5,2{lambda}{sup 5},4{lambda}{sup 5},6{lambda}{sup 5}-triazatriphosphin-2-yl)oxy] benzaldehyde

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Oezay, H.; Yildiz, M., E-mail: myildiz@comu.edu.tr; Uenver, H.

    2013-01-15

    The compound called 3-methoxy-2- [(2,4,4,6,6-pentachloro-1,3,5,2{lambda}{sup 5},4{lambda}{sup 5},6{lambda}{sup 5}-triazatriphosphin-2-yl)oxy] benzaldehyde has been synthesized from the reaction of 2-hydroxy-3-methoxybenzaldehyde with hexachlorocyclotriphosphazene. It has been characterized by elemental analysis, MS, IR, {sup 1}H NMR, {sup 13}C NMR, {sup 31}P NMR and UV-visible spectroscopic techniques. The structure of the title compound has been determind by X-ray analysis. Crystals are orthorhombic, space group P2{sub 1}2{sub 1}2{sub 1}, Z = 4, a = 7.705(1), b = 12.624(1), c = 17.825(2) A, R{sub 1} = 0.0390 and wR{sub 2} = 0.1074 [I > 2{sigma}(I)], respectively.

  9. High dietary intake of sodium selenite does not affect gene mutation frequency in rat colon and liver.

    PubMed

    Zeng, Huawei; Uthus, Eric O; Ross, Sharon A; Davis, Cindy D

    2009-10-01

    Our previous studies have shown that selenium (Se) is protective against dimethylhydrazine (DMH)-induced preneoplastic colon cancer lesions, and protection against DNA damage has been hypothesized to be one mechanism for the anticancer effect of Se. The present study was designed to determine whether dietary selenite affects somatic mutation frequency in vivo. We used the Big Blue transgenic model to evaluate the in vivo mutation frequency of the cII gene in rats fed either a Se-deficient (0 microg Se/g diet) or Se-supplemented diet (0.2 or 2 microg Se/g diet; n = 3 rats/diet in experiment 1 and n = 5 rats/group in experiment 2) and injected with DMH (25 mg/kg body weight, i.p.). There were no significant differences in body weight between the Se-deficient and Se-supplemented (0.2 or 2 microg Se/g diet) rats, but the activities of liver glutathione peroxidase and thioredoxin reductase and concentration of liver Se were significantly lower (p < 0.0001) in Se-deficient rats compared to rats supplemented with Se. We found no effect of dietary Se on liver 8-hydroxy-2'-deoxyguanosine. Gene mutation frequency was significantly lower in liver (p < 0.001) than that of colon regardless of dietary Se. However, there were no differences in gene mutation frequency in DNA from colon mucosa or liver from rats fed the Se-deficient diet compared to those fed the Se-supplemented (0.2 or 2 microg Se/g diet) diet. Although gene mutations have been implicated in the etiology of cancer, our data suggest that decreasing gene mutation is not likely a key mechanism through which dietary selenite exerts its anticancer action against DMH-induced preneoplastic colon cancer lesions in a Big Blue transgenic rat model.

  10. Subtraction of cap-trapped full-length cDNA libraries to select rare transcripts.

    PubMed

    Hirozane-Kishikawa, Tomoko; Shiraki, Toshiyuki; Waki, Kazunori; Nakamura, Mari; Arakawa, Takahiro; Kawai, Jun; Fagiolini, Michela; Hensch, Takao K; Hayashizaki, Yoshihide; Carninci, Piero

    2003-09-01

    The normalization and subtraction of highly expressed cDNAs from relatively large tissues before cloning dramatically enhanced the gene discovery by sequencing for the mouse full-length cDNA encyclopedia, but these methods have not been suitable for limited RNA materials. To normalize and subtract full-length cDNA libraries derived from limited quantities of total RNA, here we report a method to subtract plasmid libraries excised from size-unbiased amplified lambda phage cDNA libraries that avoids heavily biasing steps such as PCR and plasmid library amplification. The proportion of full-length cDNAs and the gene discovery rate are high, and library diversity can be validated by in silico randomization.

  11. Overproduction and nucleotide sequence of the respiratory D-lactate dehydrogenase of Escherichia coli.

    PubMed Central

    Rule, G S; Pratt, E A; Chin, C C; Wold, F; Ho, C

    1985-01-01

    Recombinant DNA plasmids containing the gene for the membrane-bound D-lactate dehydrogenase (D-LDH) of Escherichia coli linked to the promoter PL from lambda were constructed. After induction, the levels of D-LDH were elevated 300-fold over that of the wild type and amounted to 35% of the total cellular protein. The nucleotide sequence of the D-LDH gene was determined and shown to agree with the amino acid composition and the amino-terminal sequence of the purified enzyme. Removal of the amino-terminal formyl-Met from D-LDH was not inhibited in cells which contained these high levels of D-LDH. Images PMID:3882663

  12. Longitudinal diffusion tensor magnetic resonance imaging study of radiation-induced white matter damage in a rat model.

    PubMed

    Wang, Silun; Wu, Ed X; Qiu, Deqiang; Leung, Lucullus H T; Lau, Ho-Fai; Khong, Pek-Lan

    2009-02-01

    Radiation-induced white matter (WM) damage is a major side effect of whole brain irradiation among childhood cancer survivors. We evaluate longitudinally the diffusion characteristics of the late radiation-induced WM damage in a rat model after 25 and 30 Gy irradiation to the hemibrain at 8 time points from 2 to 48 weeks postradiation. We hypothesize that diffusion tensor magnetic resonance imaging (DTI) indices including fractional anisotropy (FA), trace, axial diffusivity (lambda(//)), and radial diffusivity (lambda( perpendicular)) can accurately detect and monitor the histopathologic changes of radiation-induced WM damage, measured at the EC, and that these changes are dose and time dependent. Results showed a progressive reduction of FA, which was driven by reduction in lambda(//) from 4 to 40 weeks postradiation, and an increase in lambda( perpendicular) with return to baseline in lambda(//) at 48 weeks postradiation. Histologic evaluation of irradiated WM showed reactive astrogliosis from 4 weeks postradiation with reversal at 36 weeks, and demyelination, axonal degeneration, and necrosis at 48 weeks postradiation. Moreover, changes in lambda(//) correlated with reactive astrogliosis (P < 0.01) and lambda( perpendicular) correlated with demyelination (P < 0.01). Higher radiation dose (30 Gy) induced earlier and more severe histologic changes than lower radiation dose (25 Gy), and these differences were reflected by the magnitude of changes in lambda(//) and lambda( perpendicular). DTI indices reflected the histopathologic changes of WM damage and our results support the use of DTI as a biomarker to noninvasively monitor radiation-induced WM damage.

  13. Assessment of resistance risk to lambda-cyhalothrin and cross-resistance to four other insecticides in the house fly, Musca domestica L. (Diptera: Muscidae).

    PubMed

    Abbas, Naeem; Shad, Sarfraz Ali

    2015-07-01

    Lambda-cyhalothrin, a sodium channel modulator insecticide, has been used frequently for the control of house flies, Musca domestica L. (Diptera: Muscidae) worldwide, including Pakistan. This experiment was performed to determine the selection and assessment of lambda-cyhalothrin resistance evolution along with four other insecticides. After 26 generations of selection, the lambda-cyhalothrin-selected population developed 445-fold resistance to lambda-cyhalothrin compared to the susceptible population. There was low cross-resistance to bifenthrin and very low cross-resistance to methomyl, imidacloprid, and fipronil in the lambda-cyhalothrin-selected population compared to the field population (G1). Realized heritability (h (2)) of resistance to lambda-cyhalothrin, bifenthrin, methomyl, imidacloprid, and fipronil was 0.07, 0.05, 0.01, 0.08, and 0.08, respectively. The projected rate of resistance development revealed that if 90 % house flies were selected, then a tenfold increase in lethal concentration 50 occurred after 17, 20, 159, 13, and 14 generations for lambda-cyhalothrin (h (2) = 0.07, slope = 2.09), bifenthrin (h (2) = 0.05, slope = 1.73), methomyl (h (2) = 0.01, slope = 2.52), imidacloprid (h (2) = 0.08, slope = 1.89), and fipronil (h (2) = 0.08, slope = 2.03), respectively. The results of our study concluded that the house fly has the potential to develop multiple insecticide resistances following continued selection pressure with lambda-cyhalothrin. This study will be helpful for assisting the development of resistance management strategies.

  14. Size effects of primary/secondary twins on the atomistic deformation mechanisms in hierarchically nanotwinned metals

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Yuan, Fuping; Wu, Xiaolei

    2013-05-28

    A series of large-scale molecular dynamics simulations have been performed to investigate the tensile properties of nanotwinned (NT) copper with hierarchically twinned structures (HTS). For the same grain size d and the same spacing of primary twins {lambda}{sub 1}, the average flow stress first increases as the spacing of secondary twins {lambda}{sub 2} decreases, reaching a maximum at a critical {lambda}{sub 2}, and then decreases as {lambda}{sub 2} becomes even smaller. The smaller the spacing for {lambda}{sub 1}, the smaller the critical spacing for {lambda}{sub 2}. There exists a transition in dominating deformation mechanisms, occurring at a critical spacing ofmore » {lambda}{sub 2} for which strength is maximized. Above the critical spacing of {lambda}{sub 2}, the deformation mechanisms are dominated by the two Hall-Petch type strengthening mechanisms: (a) partial dislocations emitted from grain boundaries (GBs) travel across other GBs and twin boundaries (TBs); (b) partial dislocations emitted from TBs travel across other TBs. Below the critical spacing of {lambda}{sub 2}, the deformation mechanism is dominated by the two softening mechanisms: (a) Partial dislocations emitted from boundaries of the primary twins travel parallel to the TBs of the secondary twins, leading to detwinning of the secondary twins; (b) Boundaries of the primary twins shift entirely, leading to thickening in one part of primary twins and thinning in the other part of primary twins. The present results should provide insights to design the microstructures for reinforcing the mechanical properties in the NT metals with HTS.« less

  15. RECONCILIATION OF WAITING TIME STATISTICS OF SOLAR FLARES OBSERVED IN HARD X-RAYS

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Aschwanden, Markus J.; McTiernan, James M., E-mail: aschwanden@lmsal.co, E-mail: jimm@ssl.berkeley.ed

    2010-07-10

    We study the waiting time distributions of solar flares observed in hard X-rays with ISEE-3/ICE, HXRBS/SMM, WATCH/GRANAT, BATSE/CGRO, and RHESSI. Although discordant results and interpretations have been published earlier, based on relatively small ranges (<2 decades) of waiting times, we find that all observed distributions, spanning over 6 decades of waiting times ({Delta}t {approx} 10{sup -3}-10{sup 3} hr), can be reconciled with a single distribution function, N({Delta}t) {proportional_to} {lambda}{sub 0}(1 + {lambda}{sub 0{Delta}}t){sup -2}, which has a power-law slope of p {approx} 2.0 at large waiting times ({Delta}t {approx} 1-1000 hr) and flattens out at short waiting times {Delta}t {approx}

  16. Modulation of collagen-induced arthritis by adenovirus-mediated intra-articular expression of modified collagen type II.

    PubMed

    Tang, Bo; Cullins, David L; Zhou, Jing; Zawaski, Janice A; Park, Hyelee; Brand, David D; Hasty, Karen A; Gaber, M Waleed; Stuart, John M; Kang, Andrew H; Myers, Linda K

    2010-01-01

    Rheumatoid arthritis (RA) is a systemic disease manifested by chronic inflammation in multiple articular joints, including the knees and small joints of the hands and feet. We have developed a unique modification to a clinically accepted method for delivering therapies directly to the synovium. Our therapy is based on our previous discovery of an analog peptide (A9) with amino acid substitutions made at positions 260 (I to A), 261 (A to B), and 263 (F to N) that could profoundly suppress immunity to type II collagen (CII) and arthritis in the collagen-induced arthritis model (CIA). We engineered an adenoviral vector to contain the CB11 portion of recombinant type II collagen and used PCR to introduce point mutations at three sites within (CII124-402, 260A, 261B, 263D), (rCB11-A9) so that the resulting molecule contained the A9 sequence at the exact site of the wild-type sequence. We used this construct to target intra-articular tissues of mice and utilized the collagen-induced arthritis model to show that this treatment strategy provided a sustained, local therapy for individual arthritic joints, effective whether given to prevent arthritis or as a treatment. We also developed a novel system for in vivo bioimaging, using the firefly luciferase reporter gene to allow serial bioluminescence imaging to show that luciferase can be detected as late as 18 days post injection into the joint. Our therapy is unique in that we target synovial cells to ultimately shut down T cell-mediated inflammation. Its effectiveness is based on its ability to transform potential inflammatory T cells and/or bystander T cells into therapeutic (regulatory-like) T cells which secrete interleukin (IL)-4. We believe this approach has potential to effectively suppress RA with minimal side effects.

  17. Modulation of collagen-induced arthritis by adenovirus-mediated intra-articular expression of modified collagen type II

    PubMed Central

    2010-01-01

    Introduction Rheumatoid arthritis (RA) is a systemic disease manifested by chronic inflammation in multiple articular joints, including the knees and small joints of the hands and feet. We have developed a unique modification to a clinically accepted method for delivering therapies directly to the synovium. Our therapy is based on our previous discovery of an analog peptide (A9) with amino acid substitutions made at positions 260 (I to A), 261 (A to B), and 263 (F to N) that could profoundly suppress immunity to type II collagen (CII) and arthritis in the collagen-induced arthritis model (CIA). Methods We engineered an adenoviral vector to contain the CB11 portion of recombinant type II collagen and used PCR to introduce point mutations at three sites within (CII124-402, 260A, 261B, 263D), (rCB11-A9) so that the resulting molecule contained the A9 sequence at the exact site of the wild-type sequence. Results We used this construct to target intra-articular tissues of mice and utilized the collagen-induced arthritis model to show that this treatment strategy provided a sustained, local therapy for individual arthritic joints, effective whether given to prevent arthritis or as a treatment. We also developed a novel system for in vivo bioimaging, using the firefly luciferase reporter gene to allow serial bioluminescence imaging to show that luciferase can be detected as late as 18 days post injection into the joint. Conclusions Our therapy is unique in that we target synovial cells to ultimately shut down T cell-mediated inflammation. Its effectiveness is based on its ability to transform potential inflammatory T cells and/or bystander T cells into therapeutic (regulatory-like) T cells which secrete interleukin (IL)-4. We believe this approach has potential to effectively suppress RA with minimal side effects. PMID:20615221

  18. Alternatives to Goodman and Kruskal's Lambda.

    ERIC Educational Resources Information Center

    Stavig, Gordon R.

    1979-01-01

    Lambda and kappa coefficients of nominal scale association are developed for research hypotheses that involve predictions of modality, agreement, or some theoretically specified configuration. The proposed new coefficient is offered as an alternative to Goodman and Kruskal's lambda. (Author/CTM)

  19. Hepatopancreatic intoxication of lambda cyhalothrin insecticide on albino rats

    PubMed Central

    Elhalwagy, Manal EA; Abd-Alrahman, Sherif H; Nahas, AA; Ziada, Reem M; Mohamady, Aziza H

    2015-01-01

    Background: Despite the known adverse effects of lambda cyhalothrin insecticide, little is known about its hepatopancreatic intoxication effects. The present study was carried out to elucidate sub-chronic effect of Karat 2.5% EC formulation of lambda cyhalothrin on male albino rats. Methods: To explore the effects of exposure to lambda cyhalothrin on rats and its mechanism, low (1/40 of LD50, 5 mg/kg/day) and high dose (1/4 of LD50, 50 mg/kg/day) lambda cyhalothrin were applied to rats via drinking water for 3 months. Blood samples were collected monthly, and the animals were dissected for liver and pancreas’s examination at the end of the experiment. Lambda cyhalothrin administration was associated with the elevation in lipid peroxidation marker, malondialdehyde (MDA), reduction in SH-protein a major marker for antioxidant, as well as basel paraoxonase (PON) in both treated groups throughout the experimental periods. Results: In addition, significant elevations in liver enzymes alanin amino transferase, (ALT), and aspartate amino transferase (AST), as well as plasma acetylcholinesterase (AChE) and glucose level. While, significant reduction in insulin level through the experimental periods. Results of histopathological and histochemical studies showed that lambda cyhalothrin exposure induces liver and pancreatic tissues damage and depletion in glycogen content was pronounced in liver of both treated groups. Conclusions: In conclusion subchronic intoxication with lambda cyhalothrin formulation induced remarkable changes in the examined parameters. PMID:26221269

  20. Hepatopancreatic intoxication of lambda cyhalothrin insecticide on albino rats.

    PubMed

    Elhalwagy, Manal Ea; Abd-Alrahman, Sherif H; Nahas, A A; Ziada, Reem M; Mohamady, Aziza H

    2015-01-01

    Despite the known adverse effects of lambda cyhalothrin insecticide, little is known about its hepatopancreatic intoxication effects. The present study was carried out to elucidate sub-chronic effect of Karat 2.5% EC formulation of lambda cyhalothrin on male albino rats. To explore the effects of exposure to lambda cyhalothrin on rats and its mechanism, low (1/40 of LD50, 5 mg/kg/day) and high dose (1/4 of LD50, 50 mg/kg/day) lambda cyhalothrin were applied to rats via drinking water for 3 months. Blood samples were collected monthly, and the animals were dissected for liver and pancreas's examination at the end of the experiment. Lambda cyhalothrin administration was associated with the elevation in lipid peroxidation marker, malondialdehyde (MDA), reduction in SH-protein a major marker for antioxidant, as well as basel paraoxonase (PON) in both treated groups throughout the experimental periods. In addition, significant elevations in liver enzymes alanin amino transferase, (ALT), and aspartate amino transferase (AST), as well as plasma acetylcholinesterase (AChE) and glucose level. While, significant reduction in insulin level through the experimental periods. Results of histopathological and histochemical studies showed that lambda cyhalothrin exposure induces liver and pancreatic tissues damage and depletion in glycogen content was pronounced in liver of both treated groups. In conclusion subchronic intoxication with lambda cyhalothrin formulation induced remarkable changes in the examined parameters.

  1. Anisotropy of the penetration depth in La2-xSrxCuO4 in underdoped and overdoped regions

    NASA Astrophysics Data System (ADS)

    Zaleski, A. J.; Klamut, J.

    1999-12-01

    We present the results of measurements of the penetration depth anisotropy in pulverized, ceramic La2-xSrxCuO4. The measurements were carried out for x = 0.08, 0.1, 0.125, 0.15 and 0.2. The powdered samples, immersed in wax, were magnetically oriented in a static magnetic field of 10 T. The penetration depth in the a-b plane, icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/>ab, and perpendicular to it, icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/>icons/Journals/Common/perp" ALT="perp" ALIGN="MIDDLE"/>, were derived from alternating-current susceptibility measurements. For underdoped samples they both vary linearly with temperature (for the low-temperature region), while for the samples from the overdoped region the measured points can be fitted by an exponential function. These results support Uemura's picture (Uemura Y J 1997 Physica C 282-287 194) of crossover from Bose-Einstein condensation to a Bardeen-Cooper-Schrieffer mechanism of superconductivity. The penetration depth values extrapolated to T = 0 may be described by a quadratic function of the strontium concentration (for both icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/>ab and icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/>icons/Journals/Common/perp" ALT="perp" ALIGN="MIDDLE"/>). The anisotropy of the penetration depth as a function of the substitution shows a similar dependence to the critical temperature Tc(x).

  2. First-trimester ultrasound determination of chorionicity in twin gestations using the lambda sign: a systematic review and meta-analysis.

    PubMed

    Maruotti, G M; Saccone, G; Morlando, M; Martinelli, P

    2016-07-01

    To evaluate the accuracy of first-trimester sonographic determination of chorionicity in twin gestations using the lambda sign. Electronic databases (MEDLINE, PROSPERO, Scopus, ClinicalTrials.gov, EMBASE, Sciencedirect) were searched from their inception until April 2016. We included only study assessing the accuracy lambda sign in prediction of monochorionicity in the first trimester. Forest plots for pooled sensitivity and specificity with 95% confidence intervals (CI) were generated. In addition, symmetric summary receiver-operating characteristic curves were plotted. The area under the curve (AUC) was also computed to evaluate the overall accuracy of the diagnostic test. Nine studies, including 2292 twins, were analysed. In all of these studies, identification of the lambda sign was used to diagnose chorionicity on real-time B-mode imaging. Twins were classified as monochorionic if there was a single placental mass in the absence of the lambda sign, and dichorionic if there was a single placental mass but the lambda sign was present or the placentas were not adjacent to each other. In all nine studies, placental histology or discordant fetal sex were used to confirm chorionicity. Pooled results from the meta-analysis showed that sensitivity of the presence of the lambda sign in the prediction of dichorionicity was 99% (95% CI 98-100%), and specificity was 95% (95% CI 92-97%). Pooled sensitivity of the absence of the lambda sign in the prediction of monochorionicity was 96% (95% CI 92-98%) and pooled specificity was 99% (95% CI 98-99%). The AUC for diagnostic accuracy was 0.99, and suggested very high diagnostic accuracy. The lambda sign predicts chorionicity with a high degree of accuracy before 14 weeks of gestation. Presence of the lambda sign indicates dichorionicity, and absence of the lambda sign indicates monochorionicity. All hospitals should encourage departments providing ultrasound services to determine chorionicity when examining women with twin pregnancies in the first trimester. As determination of chorionicity is most accurate before 14 weeks when the amnion and chorion have not yet fused, the first-trimester scan in twin pregnancy is paramount. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. Simultaneous X-ray, UV, and Optical Variations in lambda ERI (B2e)

    NASA Astrophysics Data System (ADS)

    Smith, M. A.; Murakami, T.; Anandarao, B.

    1996-12-01

    We have carried out a simultaneous observing campaign on the prototypical Be star lambda Eri using ground stations and ROSAT, ASCA, IUE, and Voyager spacecrafts during the week of February-March 1995; a smaller campaign was carried out the following September. In late February lambda Eri showed extraordinary disk-wind activity. ROSAT/HRI monitoring disclosed no large flares such as ROSAT observed in 1991 in lambda Eri. Possible low amplitude fluctuations in the 1995 data occurred at the same time with unusual activity in Hα , HeI lambda 6678, HeII lambda 1640, CIII, and the CIV doublet. The helium line activity suggests that mass ejection occurred at the base of the wind. The strong CIII and CIV lines implies that shock interactions originated in the wind flow. It is not clear that the X-ray fluctuations are directly related to the increases in wind line absorption. Within hours of the mild X-ray flux variations found by ROSAT on February 28, the Voyager UVS observed a ``ringing" that decayed over three 3-hr. cycles. The amplitude of these fluctuations was large (50%) at lambda lambda 950-1100, decreased rapidly with wavelength, and faded to nondetection above lambda 1300. Various considerations indicate that these continuum variations were not due to an instrument pathology in the UVS. Rather, they appear to be due to a time-dependent flux deficit in the lambda lambda 1250 during the minima of these cycles. We outline a scenario in which dense plasma over the star's surface is alternately heated and cooled quasi-periodically to produce the flux changes. Additional examples of this new phenomenon are needed. Amateur astronomers can make a significant contribution to the understanding of flickering in Be star light curves during their outburst phases. We also draw attention to an increase in the emission of the Hα line that occurred at about the same time the FUV ringing started. This increased emission hints that ~ 50,000K plasma near the star's surface can infuence the circumstellar disc some distance away by its increased Lyman continuum flux.

  4. 6 CFR 29.3 - Effect of provisions.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

  5. 6 CFR 29.3 - Effect of provisions.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

  6. 6 CFR 29.3 - Effect of provisions.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

  7. 6 CFR 29.3 - Effect of provisions.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

  8. 6 CFR 29.3 - Effect of provisions.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

  9. 47 CFR 22.973 - Information exchange.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Information exchange. 22.973 Section 22.973 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII...

  10. Study of the strong {sigma}{sub c}{yields}{lambda}{sub c}{pi},{sigma}{sub c}*{yields}{lambda}{sub c}{pi} and {xi}{sub c}*{yields}{xi}{sub c}{pi} decays in a nonrelativistic quark model

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Albertus, C.; Nieves, J.; Hernandez, E.

    We present results for the strong widths corresponding to the {sigma}{sub c}{yields}{lambda}{sub c}{pi}, {sigma}{sub c}*{yields}{lambda}{sub c}{pi} and {xi}{sub c}*{yields}{xi}{sub c}{pi} decays. The calculations have been done in a nonrelativistic constituent quark model with wave functions that take advantage of the constraints imposed by heavy quark symmetry. Partial conservation of axial current hypothesis allows us to determine the strong vertices from an analysis of the axial current matrix elements. Our results {gamma}({sigma}{sub c}{sup ++}{yields}{lambda}{sub c}{sup +}{pi}{sup +})=2.41{+-}0.07{+-}0.02 MeV, {gamma}({sigma}{sub c}{sup +}{yields}{lambda}{sub c}{sup +}{pi}{sup 0})=2.79{+-}0.08{+-}0.02 MeV, {gamma}({sigma}{sub c}{sup 0}{yields}{lambda}{sub c}{sup +}{pi}{sup -})=2.37{+-}0.07{+-}0.02 MeV, {gamma}({sigma}{sub c}*{sup ++}{yields}{lambda}{sub c}{sup +}{pi}{sup +})=17.52{+-}0.74{+-}0.12 MeV, {gamma}({sigma}{sub c}*{supmore » +}{yields}{lambda}{sub c}{sup +}{pi}{sup 0})=17.31{+-}0.73{+-}0.12 MeV, {gamma}({sigma}{sub c}*{sup 0}{yields}{lambda}{sub c}{sup +}{pi}{sup -})=16.90{+-}0.71{+-}0.12 MeV, {gamma}({xi}{sub c}*{sup +}{yields}{xi}{sub c}{sup 0}{pi}{sup +}+{xi}{sub c}{sup +}{pi}{sup 0})=3.18{+-}0.10{+-}0.01 MeV, and {gamma}({xi}{sub c}*{sup 0}{yields}{xi}{sub c}{sup +}{pi}{sup -}+{xi}{sub c}{sup 0}{pi}{sup 0})=3.03{+-}0.10{+-}0.01 MeV are in good agreement with experimental determinations.« less

  11. Modified van Vaals-Bergman coaxial cable coil (lambda coil) for high-field imaging.

    PubMed

    Matsuzawa, H; Nakada, T

    1996-03-01

    An easily constructed, low-capacitive coupling volume coil based on the van Vaals-Bergman coaxial cable coil for high field imaging is described. The coil (designated "lambda coil") was constructed using two 5/4 length 50 omega coaxial cables matched to a 50 omega transmission line with LC bridge balun. The standing wave on the single 5/4 lambda length coaxial cable provides two points of current maxima in oppositional direction. Therefore, the four current elements necessary for effective B1 field generation can be obtained by two 5/4 lambda length coaxial cables arranged analogous to 1/2 lambda T-antenna. Capacitive coupling between the coil elements and conductive samples (i.e. animals) is minimized by simply retaining the shield of the coaxial cable for the area of voltage maxima. The lambda coil exhibited excellent performance as a volume coil with a high quality factor and highly homogeneous rf fields. Because of its dramatically simple architecture and excellent performance, the lambda coil configuration appears to be an economical alternative to the original van Vaals-Bergman design, especially for research facilities with a high field magnet and limited bore space.

  12. Wind and boundary layers in Rayleigh-Bénard convection. II. Boundary layer character and scaling.

    PubMed

    van Reeuwijk, Maarten; Jonker, Harm J J; Hanjalić, Kemo

    2008-03-01

    The scaling of the kinematic boundary layer thickness lambda(u) and the friction factor C(f) at the top and bottom walls of Rayleigh-Bénard convection is studied by direct numerical simulation (DNS). By a detailed analysis of the friction factor, a new parameterisation for C(f) and lambda(u) is proposed. The simulations were made of an L/H=4 aspect-ratio domain with periodic lateral boundary conditions at Ra=(10(5), 10(6), 10(7), 10(8)) and Pr=1. The continuous spectrum, as well as significant forcing due to Reynolds stresses, clearly indicates a turbulent character of the boundary layer, while viscous effects cannot be neglected, judging from the scaling of classical integral boundary layer parameters with Reynolds number. Using a conceptual wind model, we find that the friction factor C(f) should scale proportionally to the thermal boundary layer thickness as C(f) proportional variant lambda(Theta)/H, while the kinetic boundary layer thickness lambda(u) scales inversely proportionally to the thermal boundary layer thickness and wind Reynolds number lambda(u)/H proportional variant (lambda(Theta)/H)(-1)Re(-1). The predicted trends for C(f) and lambda(u) are in agreement with DNS results.

  13. Neurotoxic effects of lambda-cyhalothrin modulated by piperonyl butoxide in the brain of Oreochromis niloticus.

    PubMed

    Piner, Petek; Üner, Nevin

    2014-11-01

    The objective of this research was to investigate the neurotoxic effects of pyrethroid pesticide lambda-cyhalothrin by the modulation of cytochrome P450 with piperonyl butoxide in the brain of juvenile Oreochromis niloticus. The fish were exposed to 0.48 μg L(-1) (1/6 of the 96-h LC50 ) lambda-cyhalothrin and 10 μg L(-1) piperonyl butoxide for 96 h and 15 days. tGSH, GSSG, TBARS contents, GPx, GR, GST, and AChE enzymes activities were determined by spectrophotometrical methods and Hsp70 content was analyzed by ELISA technique. Lambda-cyhalothrin had no significant effect on the components of GSH redox system, lipid peroxidation and Hsp70 levels but inhibited AChE activity. In the presence of piperonyl butoxide, lambda-cyhalothrin caused increases in tGSH, GSSG, TBARS and Hsp70 contents, GST activity, and decrease in AChE activity. Present results showed that in the presence of piperonyl butoxide, lambda-cyhalothrin caused neurotoxic effects by increasing oxidative stress. Adaptation to its oxidative stress effects may be supplied by GSH-related antioxidant system. Piperonyl butoxide revealed neurotoxic effect of lambda-cyhalothrin. Copyright © 2013 Wiley Periodicals, Inc., a Wiley company.

  14. Preliminary use of nematic liquid crystal adaptive optics with a 2.16-meter reflecting telescope.

    PubMed

    Cao, Zhaoliang; Mu, Quanquan; Hu, Lifa; Li, Dayu; Peng, Zenghui; Liu, Yonggang; Xuan, Li

    2009-02-16

    A nematic liquid crystal adaptive optics system (NLC AOS) was assembled for a 2.16-m telescope to correct for atmospheric turbulence. LC AOS was designed and optimized with Zemax optical software. Second, an adaptive correction experiment was performed in the laboratory to test the performance of the NLC AOS. After the correction, the peak to valley (PV) and root mean square (RMS) of the wavefront were down to 0.2 lambda (lambda=633 nm) and 0.05 lambda, respectively. Finally, the star of Pollux (beta Gem) was tracked using the 2.16-m Reflecting Telescope, and real time correction of the atmospheric turbulence was performed with the NLC AOS. After the adaptive correction, the average PV and RMS of the wavefront were reduced from 11 lambda and 2.5 lambda to 2.3 lambda and 0.6 lambda, respectively. Although the intensity distribution of the beta Gem was converged and its peak was sharp, a halo still existed around the peak. These results indicated that the NLC AOS only partially corrected the vertical atmospheric turbulence. The limitations of our NLC AOS are discussed and some proposals are made.

  15. Cloning of the altered mRNA stability (ams) gene of Escherichia coli K-12.

    PubMed Central

    Claverie-Martin, F; Diaz-Torres, M R; Yancey, S D; Kushner, S R

    1989-01-01

    A temperature-sensitive mutation in the ams gene of Escherichia coli causes an increase in the chemical half-life of pulse-labeled RNA at the nonpermissive temperature. Using lambda clones containing DNA fragments from the 23- to 24-min region on the E. coli chromosome, we have isolated a 5.8-kilobase DNA fragment which, when present in a low-copy-number plasmid, complements the conditional lethality and increased mRNA stability associated with the ams-1 mutation. The approximate initiation site and the direction of transcription of the ams gene were determined from the size of truncated polypeptides produced by Tn1000 insertions and Bal 31 deletions. Overexpression of the ams locus by using a T7 RNA polymerase-promoter system permitted the identification of an ams-encoded polypeptide of 110 kilodaltons. Images PMID:2477358

  16. Effects of tag loss on direct estimates of population growth rate

    USGS Publications Warehouse

    Rotella, J.J.; Hines, J.E.

    2005-01-01

    The temporal symmetry approach of R. Pradel can be used with capture-recapture data to produce retrospective estimates of a population's growth rate, lambda(i), and the relative contributions to lambda(i) from different components of the population. Direct estimation of lambda(i) provides an alternative to using population projection matrices to estimate asymptotic lambda and is seeing increased use. However, the robustness of direct estimates of lambda(1) to violations of several key assumptions has not yet been investigated. Here, we consider tag loss as a possible source of bias for scenarios in which the rate of tag loss is (1) the same for all marked animals in the population and (2) a function of tag age. We computed analytic approximations of the expected values for each of the parameter estimators involved in direct estimation and used those values to calculate bias and precision for each parameter estimator. Estimates of lambda(i) were robust to homogeneous rates of tag loss. When tag loss rates varied by tag age, bias occurred for some of the sampling situations evaluated, especially those with low capture probability, a high rate of tag loss, or both. For situations with low rates of tag loss and high capture probability, bias was low and often negligible. Estimates of contributions of demographic components to lambda(i) were not robust to tag loss. Tag loss reduced the precision of all estimates because tag loss results in fewer marked animals remaining available for estimation. Clearly tag loss should be prevented if possible, and should be considered in analyses of lambda(i), but tag loss does not necessarily preclude unbiased estimation of lambda(i).

  17. Cholinergic dysfunctions and enhanced oxidative stress in the neurobehavioral toxicity of lambda-cyhalothrin in developing rats.

    PubMed

    Ansari, Reyaz W; Shukla, Rajendra K; Yadav, Rajesh S; Seth, Kavita; Pant, Aditya B; Singh, Dhirendra; Agrawal, Ashok K; Islam, Fakhrul; Khanna, Vinay K

    2012-11-01

    This study is focused on understanding the mechanism of neurobehavioral toxicity of lambda-cyhalothrin, a new generation type II synthetic pyrethroid in developing rats following their exposure from post-lactational day (PLD)22 to PLD49 and investigate whether neurobehavioral alterations are transient or persistent. Post-lactational exposure to lambda-cyhalothrin (1.0 or 3.0 mg/kg body weight, p.o.) affected grip strength and learning activity in rats on PLD50 and the persistent impairment of grip strength and learning was observed at 15 days after withdrawal of exposure on PLD65. A decrease in the binding of muscarinic-cholinergic receptors in frontocortical, hippocampal, and cerebellar membranes associated with decreased expression of choline acetyltransferase (ChAT) and acetylcholinesterase (AChE) in hippocampus was observed following exposure to lambda-cyhalothrin on PLD50 and PLD65. Exposure to lambda-cyhalothrin was also found to increase the expression of growth-associated protein-43 in hippocampus of rats on PLD50 and PLD65 as compared to controls. A significant increase in lipid peroxidation and protein carbonyl levels and decreased levels of reduced glutathione and activity of superoxide dismutase, catalase, and glutathione peroxidase in brain regions of lambda-cyhalothrin exposed rats were distinctly observed indicating increased oxidative stress. Inhibition of ChAT and AChE activity may cause down-regulation of muscarinic-cholinergic receptors consequently impairing learning activity in developing rats exposed to lambda-cyhalothrin. The data further indicate that long-term exposure to lambda-cyhalothrin at low doses may be detrimental and changes in selected behavioral and neurochemical end points may persist if exposure to lambda-cyhalothrin continues.

  18. Simultaneous display of two large proteins on the head and tail of bacteriophage lambda

    PubMed Central

    2013-01-01

    Background Consistent progress in the development of bacteriophage lambda display platform as an alternative to filamentous phage display system was achieved in the recent years. The lambda phage has been engineered to display efficiently multiple copies of peptides or even large protein domains providing a powerful tool for screening libraries of peptides, proteins and cDNA. Results In the present work we describe an original method for dual display of large proteins on the surface of lambda particles. An anti-CEA single-chain antibody fragment and green fluorescent protein or alkaline phosphatase were simultaneously displayed by engineering both gpD and gpV lambda proteins. Conclusions Here we show that such modified phage particles can be used for the detection of target molecules in vitro and in vivo. Dual expression of functional moieties on the surface of the lambda phage might open the way to generation of a new class of diagnostic and therapeutic targeted nanoparticles. PMID:24073829

  19. Selection of Optical Glasses Using Buchdahl's Chromatic Coordinate

    NASA Technical Reports Server (NTRS)

    Griffin, DeVon W.

    1999-01-01

    This investigation attempted to extend the method of reducing the size of glass catalogs to a global glass selection technique with the hope of guiding glass catalog offerings. Buchdahl's development of optical aberration coefficients included a transformation of the variable in the dispersion equation from wavelength to a chromatic coordinate omega defined as omega = (lambda - lambda(sub 0))/ 1 + 2.5(lambda - lambda(sub 0)) where lambda is the wavelength at which the wavelength is calculated and lambda(sub 0) is a base wavelength about which the expansion is performed. The advantage of this approach is that the dispersion equation may be written in terms of a simple power series and permits direct calculation of dispersion coefficients. While several promising examples were given, a systematic application of the technique to an entire glass catalog and analysis of the subsequent predictions was not performed. The goal of this work was to apply the technique in a systematic fashion to glasses in the Schoft catalog and assess the quality of the predictions.

  20. Exposure and health assessment during application of lambda-cyhalothrin for malaria vector control in Pakistan.

    PubMed

    Chester, G; Sabapathy, N N; Woollen, B H

    1992-01-01

    Icon 10 WP insecticide, a wettable powder formulation containing 10% lambda-cyhalothrin, was evaluated for possible adverse effects on the health of spraymen and villagers during treatment of dwellings for malaria vector control. Skin sensory effects and occasional coughing and sneezing in confined spaces were the only symptoms noted by the workers resulting from the handling and spraying of the insecticide. Absorption of lambda-cyhalothrin was estimated by determining its metabolites in urine and serum. The average amount of lambda-cyhalothrin absorbed by the workers per day (54 micrograms) represents less than 0.0001% (< 1 micrograms.kg-1.day-1) of the average daily amount of the substance handled. Only a small proportion of villagers showed detectable levels of lambda-cyhalothrin metabolites in their urine. Absorption of lambda-cyhalothrin from the formulation tested was therefore very low and, apart from the nuisance of skin sensory effects, there should be no risk to the health of workers or to the villagers whose dwellings are treated.

  1. Exposure and health assessment during application of lambda-cyhalothrin for malaria vector control in Pakistan.

    PubMed Central

    Chester, G.; Sabapathy, N. N.; Woollen, B. H.

    1992-01-01

    Icon 10 WP insecticide, a wettable powder formulation containing 10% lambda-cyhalothrin, was evaluated for possible adverse effects on the health of spraymen and villagers during treatment of dwellings for malaria vector control. Skin sensory effects and occasional coughing and sneezing in confined spaces were the only symptoms noted by the workers resulting from the handling and spraying of the insecticide. Absorption of lambda-cyhalothrin was estimated by determining its metabolites in urine and serum. The average amount of lambda-cyhalothrin absorbed by the workers per day (54 micrograms) represents less than 0.0001% (< 1 micrograms.kg-1.day-1) of the average daily amount of the substance handled. Only a small proportion of villagers showed detectable levels of lambda-cyhalothrin metabolites in their urine. Absorption of lambda-cyhalothrin from the formulation tested was therefore very low and, apart from the nuisance of skin sensory effects, there should be no risk to the health of workers or to the villagers whose dwellings are treated. PMID:1464147

  2. Two-dimensional energy spectra in high-Reynolds-number turbulent boundary layers

    NASA Astrophysics Data System (ADS)

    Chandran, Dileep; Baidya, Rio; Monty, Jason P.; Marusic, Ivan

    2017-09-01

    Here we report the measurements of two-dimensional (2-D) spectra of the streamwise velocity ($u$) in a high Reynolds number turbulent boundary layer. A novel experiment employing multiple hot-wire probes was carried out at friction Reynolds numbers ranging from 2400 to 26000. Taylor's frozen turbulence hypothesis is used to convert temporal-spanwise information into a 2-D spatial spectrum which shows the contribution of streamwise ($\\lambda_x$) and spanwise ($\\lambda_y$) length scales to the streamwise variance at a given wall height ($z$). At low Reynolds numbers, the shape of the 2-D spectra at a constant energy level shows $\\lambda_y/z \\sim (\\lambda_x/z)^{1/2}$ behaviour at larger scales, which is in agreement with the existing literature at a matched Reynolds number obtained from direct numerical simulations. However, at high Reynolds numbers, it is observed that the square-root relationship tends towards a linear relationship ($\\lambda_y \\sim \\lambda_x$) as required for self-similarity and predicted by the attached eddy hypothesis.

  3. Physical parameters of lambda Bootis stars

    NASA Astrophysics Data System (ADS)

    Solano, E.; Paunzen, E.; Pintado, O. I.; Córdoba; Varela, J.

    2001-08-01

    This is the first of two papers whose main goal is to update and improve the information available on the physical properties of the lambda Bootis stars. The determination of the stellar parameters is of fundamental importance to shed light into the different theories proposed to explain the lambda Bootis phenomenon. With this aim, projected rotational velocities, effective temperatures, surface gravities and chemical abundances of a sample of suspected lambda Bootis stars have been calculated. Five objects showing composite spectra typical of binary systems were found in our analysis. The abundance distribution of the program stars does not resemble the chemical composition of the class prototype, lambda Boo, which poses some concerns regarding the idea of a well-defined, chemically homogeneous group of stars. A possible relation between rotational velocities and the lambda Bootis phenomenon has been found. This result would be in agreement with the accretion scenario proposed by Turcotte & Charbonneau (\\cite{Turcotte93}). Figure 3 is only available in electronic form at http://www.edpsciences.org

  4. Effects of Spinosad, Imidacloprid, and Lambda-cyhalothrin on Survival, Parasitism, and Reproduction of the Aphid Parasitoid Aphidius colemani.

    PubMed

    D'Ávila, Vinicius A; Barbosa, Wagner F; Guedes, Raul N C; Cutler, G Christopher

    2018-05-28

    Insecticides can affect biological control by parasitoids. Here, we examined the lethal and sublethal effects of two conventional insecticides, imidacloprid and lambda-cyhalothrin, and a reduced-risk bioinsecticide, spinosad, on the aphid parasitoid Aphidius colemani Viereck (Hymenoptera: Braconidae). Concentration-mortality curves generated from insecticide residue bioassays found that wasps were nearly 20-fold more susceptible to spinosad than imidacloprid and lambda-cyhalothrin. Imidacloprid and lambda-cyhalothrin compromised adult parasitoid longevity, but not as dramatically as spinosad: concentrations >200 ng spinosad/cm2 reduced wasp longevity by half. Imidacloprid and lambda-cyhalothrin also compromised aphid parasitism by wasps. Although increasing imidacloprid concentrations led to increased host viability and reduced progeny production, lambda-cyhalothrin did not affect viability of parasitized hosts or parasitoid progeny production in a dose-dependent manner. Our results demonstrate that reduced risk bioinsecticide products like spinosad can be more toxic to biological control agents than certain conventional insecticides.

  5. 48 CFR 225.504 - Evaluation examples.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation examples. 225.504 Section 225.504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... 225.504 Evaluation examples. For examples that illustrate the evaluation procedures in 225.502(c)(ii...

  6. Relative heating costs for Virginia Department of Highways and Transportation buildings.

    DOT National Transportation Integrated Search

    1982-01-01

    This report presents the results of a survey of the energy used to heat various buildings owned and operated by the Virginia Department of Highways and Transportation. Energy intensity and cost intensity indices (EII and CII) for buildings were calcu...

  7. U.S. EPA, Pesticide Product Label, INSECTICIDE CONCENTRATE, 02/11/1985

    EPA Pesticide Factsheets

    2011-04-21

    ... ". ... w ••• 11 dft ... ln- .... el ..... wi" .... 4 h., • .. 0 .... . cil eft ..... If I"'tet'''' ,11'1. If ••• 111."- • "I' •• Alee -.ltI"._ C.II. ",11.:1 ... 1_ ... ,tI,. ...

  8. 48 CFR 225.504 - Evaluation examples.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 48 Federal Acquisition Regulations System 3 2011-10-01 2011-10-01 false Evaluation examples. 225..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Evaluating Foreign Offers-Supply Contracts 225.504 Evaluation examples. For examples that illustrate the evaluation procedures in 225.502(c)(ii...

  9. Peginterferon Lambda-1a Is Associated with a Low Incidence of Autoimmune Thyroid Disease in Chronic Hepatitis C.

    PubMed

    Fredlund, Paul; Hillson, Jan; Gray, Todd; Shemanski, Lynn; Dimitrova, Dessislava; Srinivasan, Subasree

    2015-11-01

    Peginterferon alfa (alfa) increases the risk of autoimmune disease. Peginterferon lambda-1a (Lambda) acts through a receptor with a more liver-specific distribution compared to the alfa receptor. In a phase-2b study, 525 treatment-naive patients with chronic hepatitis C virus (HCV) infection received ribavirin and Lambda interferon (120, 180, or 240 μg) or alfa interferon (180 μg) for 24 (genotypes 2 and 3) or 48 (genotypes 1 and 4) weeks. Retrospective analysis found that adverse events of MedDRA-coded thyroid dysfunction and abnormal levels of thyroid-stimulating hormone (TSH) were significantly more frequent with alfa versus Lambda (12% versus 2.6% and 15.2% versus 3.4%, respectively, both P<0.0001). Most Lambda recipients with abnormal TSH had levels below the lower limit of normal; the frequency of low and high TSH was similar in alfa recipients with abnormal TSH. Blinded review by an endocrinologist found that new-onset primary hypothyroidism or painless thyroiditis was less frequent with Lambda versus alfa (0.5% and 1.8% versus 5.3% and 7.5%, respectively, P<0.0001). Most TSH elevations reflected new-onset hypothyroidism requiring treatment, while most markedly suppressed TSH values reflected probable painless thyroiditis and resolved without sequelae. In conclusion, HCV-infected patients treated with Lambda/ribavirin experienced fewer adverse events of thyroid dysfunction compared with patients treated with alfa/ribavirin.

  10. Neutral-strange-particle production in 200-GeV/ c p /. pi. sup + / K sup + interactions on Au, Ag, and Mg

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Brick, D.H.; Widgoff, M.; Beilliere, P.

    1992-02-01

    We have used the Fermilab 30-in. bubble-chamber--hybrid spectrometer to study neutral-strange-particle production in the interactions of 200-GeV/{ital c} protons and {pi}{sup +} and {ital K}{sup +} mesons with nuclei of gold, silver, and magnesium. Average multiplicities and inclusive cross sections for {ital K}{sup 0} and {Lambda} are measured, and a power law is found to give a good description of their {ital A} dependence. The exponent characterizing the {ital A} dependence is consistent with being the same for {ital K}{sup 0} and {Lambda} production, and also the same for proton and {pi}{sup +} beams. Average {ital K}{sup 0} and {Lambda}more » multiplicities, as well as their ratio, have been measured as functions of the numbers of projectile collisions {nu}{sub {ital p}} and secondary collisions {nu}{sub {ital s}} in the nucleus, and indicate that rescattering contributes significantly to enhancement of {Lambda} production but not to {ital K}{sup 0} production. The properties of events with multiple {ital K}{sup 0}'s or {Lambda}'s also corroborate this conclusion. {ital K}{sup 0} rapidities are in the central region and decrease gently with increasing {nu}{sub {ital p}}, while {Lambda} rapidities are in the target-fragmentation region and are independent of {nu}{sub {ital p}}. {ital K}{sup 0} and {Lambda} multiplicities increase with the rapidity loss of the projectile, but their rapidities do not.« less

  11. THERMALLY DRIVEN ATMOSPHERIC ESCAPE: TRANSITION FROM HYDRODYNAMIC TO JEANS ESCAPE

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Volkov, Alexey N.; Johnson, Robert E.; Tucker, Orenthal J.

    2011-03-10

    Thermally driven escape from planetary atmospheres changes in nature from an organized outflow (hydrodynamic escape) to escape on a molecule-by-molecule basis (Jeans escape) with increasing Jeans parameter, {lambda}, the ratio of the gravitational to thermal energy of the atmospheric molecules. This change is described here for the first time using the direct simulation Monte Carlo method. When heating is predominantly below the lower boundary of the simulation region, R{sub 0}, and well below the exobase of a single-component atmosphere, the nature of the escape process changes over a surprisingly narrow range of Jeans parameters, {lambda}{sub 0}, evaluated at R{sub 0}.more » For an atomic gas, the transition occurs over {lambda}{sub 0} {approx} 2-3, where the lower bound, {lambda}{sub 0} {approx} 2.1, corresponds to the upper limit for isentropic, supersonic outflow. For {lambda}{sub 0} > 3 escape occurs on a molecule-by-molecule basis and we show that, contrary to earlier suggestions, for {lambda}{sub 0} > {approx}6 the escape rate does not deviate significantly from the familiar Jeans rate. In a gas composed of diatomic molecules, the transition shifts to {lambda}{sub 0} {approx} 2.4-3.6 and at {lambda}{sub 0} > {approx}4 the escape rate increases a few tens of percent over that for the monatomic gas. Scaling by the Jeans parameter and the Knudsen number, these results can be applied to thermally induced escape of the major species from solar and extrasolar planets.« less

  12. Active Knowledge Structures for Natural Language Processing.

    DTIC Science & Technology

    1991-01-01

    specialist belief: Assume there is a lambda-expression "(LAMBDA L) immed-type-ofL" and Z = ((LAMBDA L) immed-type-of L) ( thalassemia ), we can describe...SPEC) -> ([AVG-PERSON] -> (VAL-FOR) -> CGREEK-PLCE)3 This expresses the various levels of specialized knowledge of thalassemia , depending on

  13. Seawater pH Predicted for the Year 2100 Affects the Metabolic Response to Feeding in Copepodites of the Arctic Copepod Calanus glacialis.

    PubMed

    Thor, Peter; Bailey, Allison; Halsband, Claudia; Guscelli, Ella; Gorokhova, Elena; Fransson, Agneta

    2016-01-01

    Widespread ocean acidification (OA) is transforming the chemistry of the global ocean, and the Arctic is recognised as a region where the earliest and strongest impacts of OA are expected. In the present study, metabolic effects of OA and its interaction with food availability was investigated in Calanus glacialis from the Kongsfjord, West Spitsbergen. We measured metabolic rates and RNA/DNA ratios (an indicator of biosynthesis) concurrently in fed and unfed individuals of copepodite stages CII-CIII and CV subjected to two different pH levels representative of present day and the "business as usual" IPCC scenario (RCP8.5) prediction for the year 2100. The copepods responded more strongly to changes in food level than to decreasing pH, both with respect to metabolic rate and RNA/DNA ratio. However, significant interactions between effects of pH and food level showed that effects of pH and food level act in synergy in copepodites of C. glacialis. While metabolic rates in copepodites stage CII-CIII increased by 78% as a response to food under present day conditions (high pH), the increase was 195% in CII-CIIIs kept at low pH-a 2.5 times greater increase. This interaction was absent for RNA/DNA, so the increase in metabolic rates were clearly not a reaction to changing biosynthesis at low pH per se but rather a reaction to increased metabolic costs per unit of biosynthesis. Interestingly, we did not observe this difference in costs of growth in stage CV. A 2.5 times increase in metabolic costs of growth will leave the copepodites with much less energy for growth. This may infer significant changes to the C. glacialis population during future OA.

  14. OT2_smalhotr_3: Herschel Extreme Lensing Line Observations (HELLO)

    NASA Astrophysics Data System (ADS)

    Malhotra, S.

    2011-09-01

    We request 59.8 hours of Herschel time to observe 20 normal star-forming galaxies in the [CII] 158 micron and [OI] 63 micron lines. These galaxies lie at high redshift (1

  15. Computer-assisted rehabilitation of attention in pediatric multiple sclerosis and ADHD patients: a pilot trial.

    PubMed

    Simone, Marta; Viterbo, Rosa Gemma; Margari, Lucia; Iaffaldano, Pietro

    2018-06-08

    The treatment of cognitive deficits is challenging in pediatric onset multiple sclerosis (POMS) and in patients with attention deficit hyperactivity disorder (ADHD). We performed a pilot double-blind RCT to evaluate the efficacy of a home-based computerized-program for retraining attention in two cohorts of POMS and ADHD patients. POMS and ADHD patients failing in at least 2/4 attention tests on a neuropsychological battery were randomized to specific or nonspecific computerized training (ST, nST), performed in one-hour sessions, twice/week for 3 months. The primary outcome was the effect of the training on global neuropsychological performances measured by the cognitive impairment index (CII). The efficacy of the intervention was evaluated in each disease group by using repeated measures ANOVA. Sixteen POMS (9 females, age 15.75 ± 1.74 years) and 20 ADHD (2 females, age 11.19 ± 2.49 years) patients were enrolled. In POMS patients the ST exposure was associated to a significantly more pronounced improvement of the CII (p < 0.0001) and on cognitive test exploring attention, concentration, planning strategies and visuo-spatial memory performances in comparison to nST exposure. In ADHD patients the difference between the ST and nST on the CII was not statistical significant (p = 0.06), but a greater effect of the ST was found only on cognitive test exploring attention and delayed recall of visuo-spatial memory performances. Our data suggest that a cognitive rehabilitation program that targets attention is a suitable tool for improving global cognitive functioning in POMS patients, whereas it has a less pronounced transfer effect in ADHD patients. ClinicalTrials.gov; NCT03190902 ; registration date: June 15, 2017; retrospectively registered.

  16. Regional projection of climate impact indices over the Mediterranean region

    NASA Astrophysics Data System (ADS)

    Casanueva, Ana; Frías, M.; Dolores; Herrera, Sixto; Bedia, Joaquín; San Martín, Daniel; Gutiérrez, José Manuel; Zaninovic, Ksenija

    2014-05-01

    Climate Impact Indices (CIIs) are being increasingly used in different socioeconomic sectors to transfer information about climate change impacts and risks to stakeholders. CIIs are typically based on different weather variables such as temperature, wind speed, precipitation or humidity and comprise, in a single index, the relevant meteorological information for the particular impact sector (in this study wildfires and tourism). This dependence on several climate variables poses important limitations to the application of statistical downscaling techniques, since physical consistency among variables is required in most cases to obtain reliable local projections. The present study assesses the suitability of the "direct" downscaling approach, in which the downscaling method is directly applied to the CII. In particular, for illustrative purposes, we consider two popular indices used in the wildfire and tourism sectors, the Fire Weather Index (FWI) and the Physiological Equivalent Temperature (PET), respectively. As an example, two case studies are analysed over two representative Mediterranean regions of interest for the EU CLIM-RUN project: continental Spain for the FWI and Croatia for the PET. Results obtained with this "direct" downscaling approach are similar to those found from the application of the statistical downscaling to the individual meteorological drivers prior to the index calculation ("component" downscaling) thus, a wider range of statistical downscaling methods could be used. As an illustration, future changes in both indices are projected by applying two direct statistical downscaling methods, analogs and linear regression, to the ECHAM5 model. Larger differences were found between the two direct statistical downscaling approaches than between the direct and the component approaches with a single downscaling method. While these examples focus on particular indices and Mediterranean regions of interest for CLIM-RUN stakeholders, the same study could be extended to other indices and regions.

  17. Extended Star-formation and Disk-like Kinematics in a z~3 Massive ``Main-Sequence'' Galaxy through [CII] Imaging and Multi-J CO Line Observations

    NASA Astrophysics Data System (ADS)

    Leung, Tsz Kuk Daisy; Riechers, Dominik A.; Clements, David; Cooray, Asantha; Ivison, Rob; Perez-Fournon, Ismael; Wardlow, Julie

    2018-01-01

    Dusty star-forming galaxies (SFG) at high redshifts are the main contributors to the comoving star formation rate (SFR) density, which peaks between the redshift of z=1-3 (``Cosmic Noon''). Yet, new insights into their gas dynamics, and thus, structural evolution are awaiting spatially resolved observations. I will present the latest results from our kpc-scale [CII] imaging and multi-J CO line observations obtained with ALMA, CARMA, PdBI, and the VLA in one of the most massive ``main-sequence'' disk galaxy known. XMM03 (z=2.9850) is an extremely IR-luminous galaxy with a SFR of ~3000 Msun/yr, but its molecular gas excitation is surprisingly similar to the Milky Way up to J=5, which is in stark contrast with most high-z galaxies studied to date. The monotonic velocity gradient seen in the [CII] line emission suggest that it is a rotating disk galaxy. Based on the molecular gas surface density and the far-UV radiation flux determined from photo-dissociation region (PDR) modeling, the star-forming environment of XMM03 is similar to nearby SFGs. These findings together with the ~1100 km/s wide CO(1-0) line across the entire disk of ~8 kpc in radius showcase the different interstellar medium (ISM) environment that we are probing at the most massive end of galaxies in the early Universe. With a stellar mass of M*~10^12, its specific SFR is consistent with an extrapolation of the ``star-forming main-sequence'' up to M*~10^12 Msun at z~3. Our findings therefore confirm the prevalence of disk-wide star formation responsible for assembling most of the stellar masses toward the ``Cosmic Noon''.

  18. Increased platelet mitochondrial respiration after cardiac arrest and resuscitation as a potential peripheral biosignature of cerebral bioenergetic dysfunction.

    PubMed

    Ferguson, Michael A; Sutton, Robert M; Karlsson, Michael; Sjövall, Fredrik; Becker, Lance B; Berg, Robert A; Margulies, Susan S; Kilbaugh, Todd J

    2016-06-01

    Cardiac arrest (CA) results in a sepsis-like syndrome with activation of the innate immune system and increased mitochondrial bioenergetics. To determine if platelet mitochondrial respiration increases following CA in a porcine pediatric model of asphyxia-associated ventricular fibrillation (VF) CA, and if this readily obtained biomarker is associated with decreased brain mitochondrial respiration. CA protocol: 7 min of asphyxia, followed by VF, protocolized titration of compression depth to systolic blood pressure of 90 mmHg and vasopressor administration to a coronary perfusion pressure greater than 20 mmHg. platelet integrated mitochondrial electron transport system (ETS) function evaluated pre- and post-CA/ROSC four hours after return of spontaneous circulation (ROSC). Secondary outcome: correlation of platelet mitochondrial bioenergetics to cerebral bioenergetic function. Platelet maximal oxidative phosphorylation (OXPHOSCI+CII), P < 0.02, and maximal respiratory capacity (ETSCI+CII), P < 0.04, were both significantly increased compared to pre-arrest values. This was primarily due to a significant increase in succinate-supported respiration through Complex II (OXPHOSCII, P < 0.02 and ETSCII, P < 0.03). Higher respiration was not due to uncoupling, as the LEAKCI + CII respiration (mitochondrial respiration independent of ATP-production) was unchanged after CA/ROSC. Larger increases in platelet mitochondrial respiratory control ratio (RCR) compared to pre-CA RCR were significantly correlated with lower RCRs in the cortex (P < 0.03) and hippocampus (P < 0.04) compared to sham respiration. Platelet mitochondrial respiration is significantly increased four hours after ROSC. Future studies will identify mechanistic relationships between this serum biomarker and altered cerebral bioenergetics function following cardiac arrest.

  19. The Complete Genome Phylogeny of Geographically Distinct Dengue Virus Serotype 2 Isolates (1944-2013) Supports Further Groupings within the Cosmopolitan Genotype

    PubMed Central

    Ali, Akhtar; Ali, Ijaz

    2015-01-01

    Dengue virus serotype 2 (DENV-2) isolates have been implicated in deadly outbreaks of dengue fever (DF) and dengue hemorrhagic fever (DHF) in several regions of the world. Phylogenetic analysis of DENV-2 isolates collected from particular countries has been performed using partial or individual genes but only a few studies have examined complete whole-genome sequences collected worldwide. Herein, 50 complete genome sequences of DENV-2 isolates, reported over the past 70 years from 19 different countries, were downloaded from GenBank. Phylogenetic analysis was conducted and evolutionary distances of the 50 DENV-2 isolates were determined using maximum likelihood (ML) trees or Bayesian phylogenetic analysis created from complete genome nucleotide (nt) and amino acid (aa) sequences or individual gene sequences. The results showed that all DENV-2 isolates fell into seven main groups containing five previously defined genotypes. A Cosmopolitan genotype showed further division into three groups (C-I, C-II, and C-III) with the C-I group containing two subgroups (C-IA and C-IB). Comparison of the aa sequences showed specific mutations among the various groups of DENV-2 isolates. A maximum number of aa mutations was observed in the NS5 gene, followed by the NS2A, NS3 and NS1 genes, while the smallest number of aa substitutions was recorded in the capsid gene, followed by the PrM/M, NS4A, and NS4B genes. Maximum evolutionary distances were found in the NS2A gene, followed by the NS4A and NS4B genes. Based on these results, we propose that genotyping of DENV-2 isolates in future studies should be performed on entire genome sequences in order to gain a complete understanding of the evolution of various isolates reported from different geographical locations around the world. PMID:26414178

  20. T(sub lambda) Depression by a Heat Current Along the lambda-Line

    NASA Technical Reports Server (NTRS)

    Liu, Yuanming; Larson, Melora; Iraelsson, Ulf E.

    1999-01-01

    We report measurements of the depression of the superfluid transition temperature by a heat current (1 less than or = Q less than or = 100 microW/sq cm) along the lambda-line (SVP less than or = P less than or = 21.6 bar). At P = 21.6 bar, measurements were also performed in a reduced gravity (0.2g). Experimental results show that the pressure dependence of the depression and the gravity effect on the measurements are small, in qualitative agreement with theoretical predictions. Keywords: superfluid helium; Lambda transition; heat current

  1. Biomechanical stability analysis of the lambda-model controlling one joint.

    PubMed

    Lan, L; Zhu, K Y

    2007-06-01

    Computer modeling and control of the human motor system might be helpful for understanding the mechanism of human motor system and for the diagnosis and treatment of neuromuscular disorders. In this paper, a brief view of the equilibrium point hypothesis for human motor system modeling is given, and the lambda-model derived from this hypothesis is studied. The stability of the lambda-model based on equilibrium and Jacobian matrix is investigated. The results obtained in this paper suggest that the lambda-model is stable and has a unique equilibrium point under certain conditions.

  2. Phase correlation of laser waves with arbitrary frequency spacing.

    PubMed

    Huss, A F; Lammegger, R; Neureiter, C; Korsunsky, E A; Windholz, L

    2004-11-26

    The theoretically predicted correlation of laser phase fluctuations in Lambda-type interaction schemes is experimentally demonstrated. We show that the mechanism of correlation in a Lambda scheme is restricted to high-frequency noise components, whereas in a double-Lambda scheme, due to the laser phase locking in a closed-loop interaction, it extends to all noise frequencies. In this case the correlation is weakly sensitive to coherence losses. Thus the double-Lambda scheme can be used to correlate electromagnetic fields with carrier frequency differences beyond the GHz regime.

  3. [Extraction of lambda-cyhalothrin from aqueous dioxan solutions].

    PubMed

    Shormanov, V K; Chigareva, E N; Belousova, O V

    2011-01-01

    The results of extraction of lambda-cigalotrin from dioxan aqueous solutions by hydrophobic organic solvents are presented. It is shown that the degree of extraction depends on the nature of the extractant, the water to dioxan ratio, and saturation of the water-dioxan layer with the electrolyte. The highest efficiency of lambda-cigalotrin extraction was achieved using chlorophorm as a solvent under desalination conditions. The extraction factor was calculated necessary to obtain the desired amount of lambda-cigalotrin from the water-dioxan solution (4:1) with the help of the extractants being used.

  4. Far-infrared spectrophotometer for astronomical observations

    NASA Technical Reports Server (NTRS)

    Moseley, H.; Silverberg, R. F.

    1981-01-01

    A liquid-helium-cooled far infrared spectrophotometer was built and used to make low resolution observations of the continua of several kinds of astronomical objects using the Kuiper Airborne Observatory. This instrument fills a gap in both sensitivity to continuum sources and spectral resolution between the broadband photometers with lambda/Delta lambda approximately 1 and spectrometers with lambda/Delta lambda greater than 50. While designed primarily to study planetary nebulae, the instrument permits study of the shape of the continua of many weak sources which cannot easily be observed with high resolution systems.

  5. [Spectral emissivity of thin films].

    PubMed

    Zhong, D

    2001-02-01

    In this paper, the contribution of multiple reflections in thin film to the spectral emissivity of thin films of low absorption is discussed. The expression of emissivity of thin films derived here is related to the thin film thickness d and the optical constants n(lambda) and k(lambda). It is shown that in the special case d-->infinity the emissivity of thin films is equivalent to that of the bulk material. Realistic numerical and more precise general numerical results for the dependence of the emissivity on d, n(lambda) and k(lambda) are given.

  6. Quantitation of IgG kappa and IgG lambda in the cerebrospinal fluid by sandwich ELISA method.

    PubMed

    Zeman, David; Kušnierová, Pavlína; Bojková, Jana; Všianský, František; Zapletalová, Olga

    2017-01-01

    IgG kappa and IgG lambda concentrations were quantified in 96 paired CSF and sera using Hevylite™ antibodies in an in-house developed sandwich ELISA method. In 56 of these samples, the results were compared with a qualitative isoelectric focusing/affinity-mediated immunoblotting assay for oligoclonal IgG kappa and IgG lambda. Normal IgG kappa/lambda ratio in the CSF was the same as in serum. In 19/33 patients with intrathecal oligoclonal IgG synthesis, skewed IgG kappa/lambda ratio was observed (increased in 16 and decreased in 3 cases). The analysis of light chain composition of intrathecally synthesised immunoglobulins could contribute to our understanding of intrathecal humoral immune response, although its diagnostic utility is limited.

  7. Particle-type dependence of azimuthal anisotropy and nuclear modification of particle production in Au+Au collisions at square root of sNN=200 GeV.

    PubMed

    Adams, J; Adler, C; Aggarwal, M M; Ahammed, Z; Amonett, J; Anderson, B D; Anderson, M; Arkhipkin, D; Averichev, G S; Badyal, S K; Balewski, J; Barannikova, O; Barnby, L S; Baudot, J; Bekele, S; Belaga, V V; Bellwied, R; Berger, J; Bezverkhny, B I; Bhardwaj, S; Bhaskar, P; Bhati, A K; Bichsel, H; Billmeier, A; Bland, L C; Blyth, C O; Bonner, B E; Botje, M; Boucham, A; Brandin, A; Bravar, A; Cadman, R V; Cai, X Z; Caines, H; Calderón de la Barca Sánchez, M; Carroll, J; Castillo, J; Castro, M; Cebra, D; Chaloupka, P; Chattopadhyay, S; Chen, H F; Chen, Y; Chernenko, S P; Cherney, M; Chikanian, A; Choi, B; Christie, W; Coffin, J P; Cormier, T M; Cramer, J G; Crawford, H J; Das, D; Das, S; Derevschikov, A A; Didenko, L; Dietel, T; Dong, W J; Dong, X; Draper, J E; Du, F; Dubey, A K; Dunin, V B; Dunlop, J C; Dutta Majumdar, M R; Eckardt, V; Efimov, L G; Emelianov, V; Engelage, J; Eppley, G; Erazmus, B; Estienne, M; Fachini, P; Faine, V; Faivre, J; Fatemi, R; Filimonov, K; Filip, P; Finch, E; Fisyak, Y; Flierl, D; Foley, K J; Fu, J; Gagliardi, C A; Gagunashvili, N; Gans, J; Ganti, M S; Gaudichet, L; Germain, M; Geurts, F; Ghazikhanian, V; Ghosh, P; Gonzalez, J E; Grachov, O; Grigoriev, V; Gronstal, S; Grosnick, D; Guedon, M; Guertin, S M; Gupta, A; Gushin, E; Gutierrez, T D; Hallman, T J; Hardtke, D; Harris, J W; Heinz, M; Henry, T W; Heppelmann, S; Herston, T; Hippolyte, B; Hirsch, A; Hjort, E; Hoffmann, G W; Horsley, M; Huang, H Z; Huang, S L; Humanic, T J; Igo, G; Ishihara, A; Jacobs, P; Jacobs, W W; Janik, M; Jiang, H; Johnson, I; Jones, P G; Judd, E G; Kabana, S; Kaneta, M; Kaplan, M; Keane, D; Khodyrev, V Yu; Kiryluk, J; Kisiel, A; Klay, J; Klein, S R; Klyachko, A; Koetke, D D; Kollegger, T; Kopytine, M; Kotchenda, L; Kovalenko, A D; Kramer, M; Kravtsov, P; Kravtsov, V I; Krueger, K; Kuhn, C; Kulikov, A I; Kumar, A; Kunde, G J; Kunz, C L; Kutuev, R Kh; Kuznetsov, A A; Lamont, M A C; Landgraf, J M; Lange, S; Lansdell, C P; Lasiuk, B; Laue, F; Lauret, J; Lebedev, A; Lednický, R; LeVine, M J; Li, C; Li, Q; Lindenbaum, S J; Lisa, M A; Liu, F; Liu, L; Liu, Z; Liu, Q J; Ljubicic, T; Llope, W J; Long, H; Longacre, R S; Lopez-Noriega, M; Love, W A; Ludlam, T; Lynn, D; Ma, J; Ma, Y G; Magestro, D; Mahajan, S; Mangotra, L K; Mahapatra, D P; Majka, R; Manweiler, R; Margetis, S; Markert, C; Martin, L; Marx, J; Matis, H S; Matulenko, Yu A; McShane, T S; Meissner, F; Melnick, Yu; Meschanin, A; Messer, M; Miller, M L; Milosevich, Z; Minaev, N G; Mironov, C; Mishra, D; Mitchell, J; Mohanty, B; Molnar, L; Moore, C F; Mora-Corral, M J; Morozov, D A; Morozov, V; de Moura, M M; Munhoz, M G; Nandi, B K; Nayak, S K; Nayak, T K; Nelson, J M; Nevski, P; Nikitin, V A; Nogach, L V; Norman, B; Nurushev, S B; Odyniec, G; Ogawa, A; Okorokov, V; Oldenburg, M; Olson, D; Paic, G; Pandey, S U; Pal, S K; Panebratsev, Y; Panitkin, S Y; Pavlinov, A I; Pawlak, T; Perevoztchikov, V; Perkins, C; Peryt, W; Petrov, V A; Phatak, S C; Picha, R; Planinic, M; Pluta, J; Porile, N; Porter, J; Poskanzer, A M; Potekhin, M; Potrebenikova, E; Potukuchi, B V K S; Prindle, D; Pruneau, C; Putschke, J; Rai, G; Rakness, G; Raniwala, R; Raniwala, S; Ravel, O; Ray, R L; Razin, S V; Reichhold, D; Reid, J G; Renault, G; Retiere, F; Ridiger, A; Ritter, H G; Roberts, J B; Rogachevski, O V; Romero, J L; Rose, A; Roy, C; Ruan, L J; Sahoo, R; Sakrejda, I; Salur, S; Sandweiss, J; Savin, I; Schambach, J; Scharenberg, R P; Schmitz, N; Schroeder, L S; Schweda, K; Seger, J; Seliverstov, D; Seyboth, P; Shahaliev, E; Shao, M; Sharma, M; Shestermanov, K E; Shimanskii, S S; Singaraju, R N; Simon, F; Skoro, G; Smirnov, N; Snellings, R; Sood, G; Sorensen, P; Sowinski, J; Spinka, H M; Srivastava, B; Stanislaus, S; Stock, R; Stolpovsky, A; Strikhanov, M; Stringfellow, B; Struck, C; Suaide, A A P; Sugarbaker, E; Suire, C; Sumbera, M; Surrow, B; Symons, T J M; de Toledo, A Szanto; Szarwas, P; Tai, A; Takahashi, J; Tang, A H; Thein, D; Thomas, J H; Tikhomirov, V; Tokarev, M; Tonjes, M B; Trainor, T A; Trentalange, S; Tribble, R E; Trivedi, M D; Trofimov, V; Tsai, O; Ullrich, T; Underwood, D G; Van Buren, G; VanderMolen, A M; Vasiliev, A N; Vasiliev, M; Vigdor, S E; Viyogi, Y P; Voloshin, S A; Waggoner, W; Wang, F; Wang, G; Wang, X L; Wang, Z M; Ward, H; Watson, J W; Wells, R; Westfall, G D; Whitten, C; Wieman, H; Willson, R; Wissink, S W; Witt, R; Wood, J; Wu, J; Xu, N; Xu, Z; Xu, Z Z; Yamamoto, E; Yepes, P; Yurevich, V I; Zanevski, Y V; Zborovský, I; Zhang, H; Zhang, W M; Zhang, Z P; Zołnierczuk, P A; Zoulkarneev, R; Zoulkarneeva, J; Zubarev, A N

    2004-02-06

    We present STAR measurements of the azimuthal anisotropy parameter v(2) and the binary-collision scaled centrality ratio R(CP) for kaons and lambdas (Lambda+Lambda) at midrapidity in Au+Au collisions at square root of s(NN)=200 GeV. In combination, the v(2) and R(CP) particle-type dependencies contradict expectations from partonic energy loss followed by standard fragmentation in vacuum. We establish p(T) approximately 5 GeV/c as the value where the centrality dependent baryon enhancement ends. The K(0)(S) and Lambda+Lambda v(2) values are consistent with expectations of constituent-quark-number scaling from models of hadron formation by parton coalescence or recombination.

  8. Diffractive centrosymmetric 3D-transmission phase gratings positioned at the image plane of optical systems transform lightlike 4D-WORLD as tunable resonators into spectral metrics...

    NASA Astrophysics Data System (ADS)

    Lauinger, Norbert

    1999-08-01

    Diffractive 3D phase gratings of spherical scatterers dense in hexagonal packing geometry represent adaptively tunable 4D-spatiotemporal filters with trichromatic resonance in visible spectrum. They are described in the (lambda) - chromatic and the reciprocal (nu) -aspects by reciprocal geometric translations of the lightlike Pythagoras theorem, and by the direction cosine for double cones. The most elementary resonance condition in the lightlike Pythagoras theorem is given by the transformation of the grating constants gx, gy, gz of the hexagonal 3D grating to (lambda) h1h2h3 equals (lambda) 111 with cos (alpha) equals 0.5. Through normalization of the chromaticity in the von Laue-interferences to (lambda) 111, the (nu) (lambda) equals (lambda) h1h2h3/(lambda) 111-factor of phase velocity becomes the crucial resonance factor, the 'regulating device' of the spatiotemporal interaction between 3D grating and light, space and time. In the reciprocal space equal/unequal weights and times in spectral metrics result at positions of interference maxima defined by hyperbolas and circles. A database becomes built up by optical interference for trichromatic image preprocessing, motion detection in vector space, multiple range data analysis, patchwide multiple correlations in the spatial frequency spectrum, etc.

  9. Ion Viscosity Mediated by Tangled Magnetic Fields: An Application to Black Hole Accretion Disks

    NASA Technical Reports Server (NTRS)

    Subramanian, Prasad; Becker, Peter A.; Kafatos, Menas

    1996-01-01

    We examine the viscosity associated with the shear stress exerted by ions in the presence of a tangled magnetic field. As an application, we consider the effect of this mechanism on the structure of black hole accretion disks. We do not attempt to include a self-consistent description of the magnetic field. Instead, we assume the existence of a tangled field with coherence length lambda(sub coh), which is the average distance between the magnetic 'kinks' that scatter the particles. For simplicity, we assume that the field is self-similar, and take lambda(sub coh) to be a fixed fraction zeta of the local disk height H. Ion viscosity in the presence of magnetic fields is generally taken to be the cross-field viscosity, wherein the effective mean free path is the ion Larmor radius lambda(sub L), which is much less than the ion-ion Coulomb mean free path A(sub ii) in hot accretion disks. However, we arrive at a formulation for a 'hybrid' viscosity in which the tangled magnetic field acts as an intermediary in the transfer of momentum between different layers in the shear flow. The hybrid viscosity greatly exceeds the standard cross-field viscosity when (lambda/lambda(sub L)) much greater than (lambda(sub L)/lambda(sub ii)), where lambda = ((lambda(sub ii)(sup -1) + lambda(sub (coh)(sup -1))(sup -1) is the effective mean free path for the ions. This inequality is well satisfied in hot accretion disks, which suggests that the ions may play a much larger role in the momentum transfer process in the presence of magnetic fields than was previously thought. The effect of the hybrid viscosity on the structure of a steady-state, two-temperature, quasi-Keplerian accretion disk is analyzed. The hybrid viscosity is influenced by the degree to which the magnetic field is tangled (represented by zeta = lambda(sub coh)), and also by the relative accretion rate M/M(sub E), where M(sub E) = L(sub E)/c(sup 2) and L(sub E) is the Eddington luminosity. We find that ion viscosity in the presence of magnetic fields (hybrid viscosity) can dominate over conventional magnetic viscosity for fields that are tangled on sufficiently small scales.

  10. Cloning, sequence analysis, and expression in Escherichia coli of a gene coding for a. beta. -mannanase from the extremely thermophilic bacterium Caldocellum saccharolyticum

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Luethi, E.; Jasmat, N.B.; Grayling, R.A.

    1991-03-01

    A {lambda} recombinant phage expressing {beta}-mannanase activity in Escherichia coli has been isolated from a genomic library of the extremely thermophilic anaerobe Caldocellum saccharolyticum. The gene was cloned into pBR322 on a 5-kb BamHI fragment, and its location was obtained by deletion analysis. The sequence of a 2.1-kb fragment containing the mannanase gene has been determined. One open reading frame was found which could code for a protein of M{sub r} 38,904. The mannanase gene (manA) was overexpressed in E. coli by cloning the gene downstream from the lacZ promoter of pUC18. The enzyme was most active at pH 6more » and 80 C and degraded locust bean gum, guar gum, Pinus radiata glucomannan, and konjak glucomannan. The noncoding region downstream from the mannanase gene showed strong homology to celB, a gene coding for a cellulase from the same organism, suggesting that the manA gene might have been inserted into its present position on the C. saccharolyticum genome by homologous recombination.« less

  11. 47 CFR 22.880 - Information exchange.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 47 Telecommunication 2 2014-10-01 2014-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

  12. 47 CFR 22.880 - Information exchange.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 47 Telecommunication 2 2012-10-01 2012-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

  13. 47 CFR 22.880 - Information exchange.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 47 Telecommunication 2 2013-10-01 2013-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

  14. 47 CFR 22.880 - Information exchange.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 47 Telecommunication 2 2011-10-01 2011-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

  15. 45 CFR 1326.9 - Contributions.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

  16. 45 CFR 1326.9 - Contributions.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

  17. 45 CFR 1326.9 - Contributions.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

  18. 45 CFR 1326.9 - Contributions.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

  19. 45 CFR 1326.9 - Contributions.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

  20. Effect of temperature on enzymatic and physiological factors related to chilling injury in carambola fruit (Averrhoa carambola L.).

    PubMed

    Pérez-Tello, G O; Silva-Espinoza, B A; Vargas-Arispuro, I; Briceño-Torres, B O; Martinez-Tellez, M A

    2001-10-05

    Three groups of carambola fruits (Averrhoa carambola L.) were stored at 2 and 10 degrees C (85-90% relative humidity). The major physicochemical, physiological, and enzymatic responses of fruit were measured in each group over a 30-day period: chilling injury index (CII), decay (%), intracuticular waxes, cuticle permeability, pulp firmness, weight loss, sucrose, fructose and glucose contents, ion electrolyte leakage in pulp (%), ethylene and carbon dioxide production rates, and the activities of peroxidase (POD), polyphenol oxidase (PPO), and phenylalanine ammonia-lyase (PAL) enzymes. CII values were statistically different at 2 and 10 degrees C, showing high significance with respect to sucrose content and weight loss (P < 0.05). Chilling injury included darkened ribs and skin desiccation. According to the CI symptom development, a possible relationship of POD and PPO activities was found at 2 degrees C. A significant sucrose content increase was observed at 10 degrees C. CI symptoms were associated with POD and PAL activities. Copyright 2001 Academic Press.

  1. ZINGRS: CO2-1 observations of strong C+ emitters at z~2

    NASA Astrophysics Data System (ADS)

    Scrabeck, Alex; Ferkinhoff, Carl; Brisbin, Drew; Lamarche, Cody; Vishwas, Amit; Nikola, Thomas; Stacey, Gordon J.; Higdon, James L.; Higdon, Sarah; Walter, Fabian; Decarli, Roberto

    2018-06-01

    We present new CO(2-1) line observations from NOEMA of five strong C+ emitting galaxies at high redshift. These galaxies, pulled from the Zeus INvestigated Galaxy Reference Sample (ZINGRS), were observed in their [CII] 158 micron line with the ZEUS instrument showing strong emission, 1 to 2% of their total far-IR luminosity. Our previous work suggests this emission is produced by normal star forming processes in photo-dissociation regions (PDRs), albeit on a galaxy wide scale fueled by cold-flow accretion. However, we could not fully exclude other mechanisms accounting for some or all of the emission. The work presented here, combining the CO emission with the [CII] 158 micron line, is consistent with PDRs being the source of the extreme C+ emission. It is further evidence for the existence of gas-rich galaxies in the early Universe undergoing galaxy-wide starbursts. These systems are not present in the nearby Universe, so represent a unique yet import evolutionary stage at early epochs.

  2. OT2_wlanger_7: Dynamics of Giant Magnetic Gas Loops and Their Connection to the CMZ in the Galactic Center

    NASA Astrophysics Data System (ADS)

    Langer, W.

    2011-09-01

    Understanding the mass transfer and dynamics among the Galactic Center, the disk, and the halo of the Milky Way is fundamental to the study of the evolution of galaxies and star formation. Recently several giant loops of molecular gas (GML) have been found in the Galactic Center from CO maps, which are likely the result of the magnetic Parker instability. There is new evidence of a possible connection between these loops and the Central Molecular Zone as shown in a sparse [CII] sampling made by the Herschel Key Project GOT C+. Here we propose to map various features of the GMLs and the interface region in [CII] with HIFI. We will also map the foot points of the loop, which are thought to be highly shocked regions, in the ortho 110-101 line of water, which is a known shock tracer. With this data we will characterize different ISM components and their flow among these Galactic Center features.

  3. Anti-citrullinated protein antibodies cause arthritis by cross-reactivity to joint cartilage

    PubMed Central

    Ge, Changrong; Tong, Dongmei; Liang, Bibo; Schneider, Nadine; Viljanen, Johan; Stawikowska, Roma; Fields, Gregg B.; Skogh, Thomas; Kihlberg, Jan; Burkhardt, Harald

    2017-01-01

    Today, it is known that autoimmune diseases start a long time before clinical symptoms appear. Anti-citrullinated protein antibodies (ACPAs) appear many years before the clinical onset of rheumatoid arthritis (RA). However, it is still unclear if and how ACPAs are arthritogenic. To better understand the molecular basis of pathogenicity of ACPAs, we investigated autoantibodies reactive against the C1 epitope of collagen type II (CII) and its citrullinated variants. We found that these antibodies are commonly occurring in RA. A mAb (ACC1) against citrullinated C1 was found to cross-react with several noncitrullinated epitopes on native CII, causing proteoglycan depletion of cartilage and severe arthritis in mice. Structural studies by X-ray crystallography showed that such recognition is governed by a shared structural motif “RG-TG” within all the epitopes, including electrostatic potential-controlled citrulline specificity. Overall, we have demonstrated a molecular mechanism that explains how ACPAs trigger arthritis. PMID:28679953

  4. The PI3K p110delta is required for down-regulation of RAG expression in immature B cells.

    PubMed

    Llorian, Miriam; Stamataki, Zania; Hill, Susan; Turner, Martin; Mårtensson, Inga-Lill

    2007-02-15

    At the immature B cell stage the BCR signals the down-regulation of the RAG genes and Ig L chain (LC) allelic and isotype exclusion. The signaling pathway that regulates these events is poorly characterized. We demonstrate that immature B cells from mice deficient in the PI3K catalytic subunit p110delta fail to suppress RAG expression and inappropriately recombine kappa and lambda LC loci. In addition, in the presence of the autoantigen, clonal deletion and receptor editing still takes place, demonstrating that these processes are independent of p110delta. These results demonstrate a role for p110delta in the regulation of RAG gene expression and thereby LC allelic/isotype exclusion.

  5. Peginterferon Lambda-1a/Ribavirin with Daclatasvir or Peginterferon Alfa-2a/Ribavirin with Telaprevir for Chronic Hepatitis C Genotype 1b.

    PubMed

    Flisiak, Robert; Kawazoe, Seiji; Znoyko, Olga; Assy, Nimer; Gadano, Adrian; Kao, Jia-Horng; Lee, Kwan-Sik; Zwirtes, Ricardo; Portsmouth, Simon; Dong, Yuping; Xu, Dong; Kumada, Hiromitsu; Srinivasan, Subasree

    2016-11-01

    The study objective was to compare the efficacy and safety of peginterferon lambda-1a combined with ribavirin/daclatasvir (Lambda/RBV/DCV), versus peginterferon alfa-2a combined with ribavirin/telaprevir (Alfa/RBV/TVR), in patients chronically infected with hepatitis C virus (HCV), genotype 1b. This was a prospective, randomized, open-label, phase 3 study (NCT01718158) in adults (aged ≥18 years) who were treatment naïve or prior relapsers to peginterferon alfa/ribavirin therapy. The primary endpoint was sustained virologic response at post-treatment follow-up week 12 (SVR12). Patients were randomized in a 2:1 ratio to receive 24 weeks of Lambda/RBV/DCV or response-guided 24 or 48 weeks of Alfa/RBV/TVR. Overall, 440 patients were treated (294 with Lambda/RBV/DCV; 146 with Alfa/RBV/TVR). The proportion of patients achieving SVR12 was 88.8% in the Lambda/RBV/DCV arm and 70.5% in the Alfa/RBV/TVR arm (difference between arms: 18.3%; 95% confidence interval: 9.9-25.7; P < 0.0001). Patients in the Lambda/RBV/DCV group had fewer rash-related adverse events (AEs), cytopenic abnormalities, flu-like symptoms, serious AEs, and discontinuations due to AEs, but more liver abnormalities than those in the Alfa/RBV/TVR group. In conclusion, treatment with Lambda/RBV/DCV led to higher SVR12 rates and a more favorable safety profile than Alfa/RBV/TVR in patients with chronic HCV, genotype 1b infection.

  6. Narrow-line region kinematics in Seyfert nuclei

    NASA Astrophysics Data System (ADS)

    Moore, David J.

    1994-01-01

    We present results of a study of narrow-line region (NLR) kinematics in Seyfert nuclei. This study has involved extensive modeling which includes collimated emission, radially dependent rotation and turbulence, explicit photoionization calculations, realistic treatments of both internal and external obscuration, and allows for gradients in the electron density and the radial velocity of clouds throughout the NLR. Line profiles of (O II) lambda 3727, (Ne III) lambda 3869, (O III) lambda 5007, (Fe VII) lambda 6087, (Fe X) lambda 6374, (O I) lambda 6300, H alpha lambda 6563, and (S II) lambda 6731 are calculated for a wide range of physical conditions throughout the NLR. The model profiles are compared with line profiles derived from data taken with the Mount Palomar 5 m Hale Telescope as well as from profiles taken from the literature. The scenario in agreement with the largest of observational considerations consists of clouds which are accelerating outward with v varies as square root of r (i.e., constant force) and ne varies as 1/r2. The cloud start out at the inner NLR radium with ne approximately equal to 106/cu cm and with a very large column density (1023 - 10(exp 24/sq cm). These clouds are uniformly accelerated from a few tens of km/sec to approximately less than 1,000 km/sec. When the clouds reached the outer NLR radius, they have ne approximately greater than 102/cu cm and a column density of 1021-1022/sq cm. The clouds maintain an ionization parameter of about 0.3 throughout the NLR.

  7. Data bank of optical properties of biological tissue and blood in the visible and near infrared spectral region

    NASA Astrophysics Data System (ADS)

    Khairullina, Alphiya Y.; Bui, Lilia; Oleinik, Tatiana V.; Artishevsky, Nelli; Prigoun, Natalia; Sevkovsky, Jakov; Mokhort, Tatiana

    1996-12-01

    The data bank contains optical, ordinary biochemical and biophysical information on 120 venous blood samples of donors, healthy persons, patients with high pathology, 60 tissue samples. The optical parameters include diffuse reflection R((lambda) ) and transmission T((lambda) ) coefficients for optically thick layers, the absorption K((lambda) ) and extinction (epsilon) ((lambda) ) spectra, oxygenation degree CO2, parameter p determined by sizes and shapes of cells and their aggregates, refractive index of a disperse phase relative to surrounding media, and cooperative effects at high relative concentration. The peculiarities in absorption K((lambda) spectra are connected with different pathologies. It is shown from K((lambda) ) that the grade of pathology connected with the concentration of hemoglobin and mithohondrion together with oxygenation degree of blood and tissues, with the pathological hemoglobin's forms and its decomposition products of different levels. Parameter p is an important diagnostic parameter. We consider that it is necessary to include the oxygenation degree and erythrocyte's aggregation parameter to extend the range of common diagnostic parameters of blood by the first rota.

  8. Approaches for the direct estimation of lambda, and demographic contributions to lambda, using capture-recapture data

    USGS Publications Warehouse

    Nichols, J.D.; Hines, J.E.

    2002-01-01

    We first consider the estimation of the finite rate of population increase or population growth rate, lambda sub i, using capture-recapture data from open populations. We review estimation and modelling of lambda sub i under three main approaches to modelling open-population data: the classic approach of Jolly (1965) and Seber (1965), the superpopulation approach of Crosbie & Manly (1985) and Schwarz & Arnason (1996), and the temporal symmetry approach of Pradel (1996). Next, we consider the contributions of different demographic components to lambda sub i using a probabilistic approach based on the composition of the population at time i + 1 (Nichols et al., 2000b). The parameters of interest are identical to the seniority parameters, gamma sub i, of Pradel (1996). We review estimation of gamma sub i under the classic, superpopulation, and temporal symmetry approaches. We then compare these direct estimation approaches for lambda sub i and gamma sub i with analogues computed using projection matrix asymptotics. We also discuss various extensions of the estimation approaches to multistate applications and to joint likelihoods involving multiple data types.

  9. Solar Electromagnetic Radiation Study for Solar Cycle 22: Solar Ultraviolet Irradiance, 120 to 300 NM: Report of Working Groups 2 and 3 of SOLERS 22

    NASA Technical Reports Server (NTRS)

    Rottman, G. J.; Cebula, R. P.; Gillotay, D.; Simon, P. A.

    1996-01-01

    This report summarizes the activities of Working Group 2 and Working Group 3 of the SOLax Electromagnetic Radiation Study for Solar Cycle 22 (SOLERS22) Program. The international (SOLERS22) is Project 1.2 of the Solar-Terrestrial Energy Program (STEP) sponsored by SCOSTEP, a committee of the International Council of Scientific Unions). SOLERS22 is comprised of five Working Groups, each concentrating on a specific wave-length range: WG-1 - visible and infrared, WG-2 - mid-ultraviolet (200 < A < 300 nm), WG-3 - Far-ultraviolet (lambda greater than 100 and lambda less than 200 nanometers), WG-4 - extreme-ultraviolet (lambda greater than 10 and lambda less than 100 nm), and WG-5 - X-ray (lambda greater than 1 and lambda less than 10 nano meters). The overarching goals of SOLERS22 are to: 1) establish daily solar irradiance values in the specified wavelength ranges, 2) consider the evolving solar structures as the cause of temporal variations, and 3) understand the underlying physical processes driving these changes.

  10. [Determination of lambda-cyhalothrin residue tea and soil using gas chromatography].

    PubMed

    Chen, Linglong; Chen, Jiuxing; Ma, Ming; Chen, Lihua; Yang, Hui; Zhang, Guiqun

    2010-08-01

    A gas chromatographic (GC) method was established for the determination of lambda-cyhalothrin residue in tea and soil. Tea and soil samples were extracted with hexane, separated by capillary column and determined by gas chromatography-electron capture detector (GC-ECD). The average recoveries of lambda-cyhalothrin in tea and soil were 89.0% - 94.1% and 89.8% - 94.7%, respectively at the spiking levels of 0.02 to 2.00 mg/kg. The corresponding relative standard deviations (RSDs, n = 5) were 3.0% -4.9% and 2.5% -4.2%, respectively. The limit of detection (S/N = 3) was 0.002 mg/kg for lambda-cyhalothrin. The degradations of 2.5% lambda-cyhalothrin microemulsion in tea and soil in Changsha, Hunan were investigated and the degradation equations were Y = 3.199 6e(-0.339 4x) and Y = 0.122 4e(-0.103 6x) with the correlation coefficients of 0.995 6 and 0.924 7, respectively. The half-lives of lambda-cyhalothrin in tea and soil were 2.04 days and 6.69 days, respectively.

  11. An {alpha}-cluster model for {sub {Lambda}}{sup 9}Be spectroscopy

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Filikhin, I. N., E-mail: ifilikhin@nccu.edu; Suslov, V. M.; Vlahovic, B.

    An {alpha}-cluster model is applied to study low-lying spectrum of the {sub {Lambda}}{sup 9}Be hypernucleus. The three-body {alpha}{alpha}{Lambda} problem is numerically solved by the Faddeev equations in configuration space using phenomenological pair potentials. We found a set of the potentials that reproduces experimental data for the ground state (1/2{sup +}) binding energy and excitation energy of the 5/2{sup +} and 3/2{sup +} states, simultaneously. This set includes the Ali-Bodmer potential of the version 'e' for {alpha}{alpha} and modified Tang-Herndon potential for {alpha}{Lambda} interactions. The spin-orbit {alpha}{Lambda} interaction is given by modified Scheerbaum potential. Low-lying energy levels are evaluated applying amore » variant of the analytical continuation method in the coupling constant. It is shown that the spectral properties of {sub {Lambda}}{sup 9}Be can be classified as an analog of {sup 9}Be spectrum with the exception of several 'genuine hypernuclear states'. This agrees qualitatively with previous studies. The results are compared with experimental data and new interpretation of the spectral structure is discussed.« less

  12. Cloning and determination of the transcription termination site of ribosomal RNA gene of the mouse.

    PubMed Central

    Kominami, R; Mishima, Y; Urano, Y; Sakai, M; Muramatsu, M

    1982-01-01

    A Eco RI 6.6 kb DNA fragment containing the 3'-end of 28S ribosomal RNA gene of the mouse was detected by Southern blot hybridization, and cloned in a lambda-phage vector. The site of transcription termination and the processed 3'-end of 28S RNA were determined on the cloned fragment and the surrounding nucleotide sequence determined. The 3'-terminal nucleotides of mouse 28S RNA are similar to those of yeast, Drosophila and Xenopus although the homology was lost drastically beyond the 3'-end of 28S RNA. 45S precursor RNA terminated at 30 nucleotides downstream from the 3'-end of 28S RNA gene. A structure of a dyad symmetry with a loop was found immediately prior to the termination site of 45S RNA. The rDNA termination site thus shares some common features with termination sites recognized by other RNA polymerases. Images PMID:6281727

  13. A nonmonotonic dependence of standard rate constant on reorganization energy for heterogeneous electron transfer processes on electrode surface

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Xu Weilin; Li Songtao; Zhou Xiaochun

    2006-05-07

    In the present work a nonmonotonic dependence of standard rate constant (k{sup 0}) on reorganization energy ({lambda}) was discovered qualitatively from electron transfer (Marcus-Hush-Levich) theory for heterogeneous electron transfer processes on electrode surface. It was found that the nonmonotonic dependence of k{sup 0} on {lambda} is another result, besides the disappearance of the famous Marcus inverted region, coming from the continuum of electronic states in electrode: with the increase of {lambda}, the states for both Process I and Process II ET processes all vary from nonadiabatic to adiabatic state continuously, and the {lambda} dependence of k{sup 0} for Process Imore » is monotonic thoroughly, while for Process II on electrode surface the {lambda} dependence of k{sup 0} could show a nonmonotonicity.« less

  14. Differential Photoproduction Cross Sections of the Sigma0(1385), Lambda(1405), and Lambda(1520)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Moriya, Kei; Schumacher, Reinhard A.

    2013-10-01

    We report the exclusive photoproduction cross sections for the Sigma(1385), Lambda(1405), and Lambda(1520) in the reactions gamma + p -> K+ + Y* using the CLAS detector for energies from near the respective production thresholds up to a center-of-mass energy W of 2.85 GeV. The differential cross sections are integrated to give the total exclusive cross sections for each hyperon. Comparisons are made to current theoretical models based on the effective Lagrangian approach and fitted to previous data. The accuracy of these models is seen to vary widely. The cross sections for the Lambda(1405) region are strikingly different for themore » Sigma+pi-, Sigma0 pi0, and Sigma- pi+ decay channels, indicating the effect of isospin interference, especially at W values close to the threshold.« less

  15. A bacteriophage T7 RNA polymerase/promoter system for controlled exclusive expression of specific genes.

    PubMed Central

    Tabor, S; Richardson, C C

    1985-01-01

    The RNA polymerase gene of bacteriophage T7 has been cloned into the plasmid pBR322 under the inducible control of the lambda PL promoter. After induction, T7 RNA polymerase constitutes 20% of the soluble protein of Escherichia coli, a 200-fold increase over levels found in T7-infected cells. The overproduced enzyme has been purified to homogeneity. During extraction the enzyme is sensitive to a specific proteolysis, a reaction that can be prevented by a modification of lysis conditions. The specificity of T7 RNA polymerase for its own promoters, combined with the ability to inhibit selectively the host RNA polymerase with rifampicin, permits the exclusive expression of genes under the control of a T7 RNA polymerase promoter. We describe such a coupled system and its use to express high levels of phage T7 gene 5 protein, a subunit of T7 DNA polymerase. Images PMID:3156376

  16. A homolog of Escherichia coli RecA in mitochondria of the cellular slime mold Dictyostelium discoideum.

    PubMed

    Hasegawa, Yasuna; Wakabayashi, Masayuki; Nakamura, Shogo; Kodaira, Ken-ichi; Shinohara, Hiroaki; Yasukawa, Hiro

    2004-05-04

    The cellular slime mold Dictyostelium discoideum expresses a gene encoding a 452-amino-acid polypeptide that is 47% identical to Escherichia coli RecA. A recA-deficient E. coli, JE6651, was transformed by pYSN1, which was designed to express the truncated form of the D. discoideum gene, and used in suppression assays. The viability of the transformant, JE6651(pYSN1), increased following UV irradiation or mitomycin C treatment. Phage lambda (red(-) gam(-)), which required RecA activity for DNA packaging, formed plaques on a lawn of JE6651(pYSN1). These results indicate that the gene product has a DNA recombination activity. Fluorescence of D. discoideum protein fused with GFP was detected in mitochondria. The gene disruption mutant was hypersensitive to UV-light (254nm), mitomycin C and H(2)O(2), indicating that D. discoideum recA is important for survival following exposure to DNA damaging agents.

  17. The lambda sign: a new radiographic indicator of latent syndesmosis instability.

    PubMed

    Ryan, Ltc Paul; Hills, Maj Chad; Chang, James; Wilson, Cpt David

    2014-09-01

    Latent syndesmotic instability is a common cause of chronic ankle pain. The diagnosis is not readily apparent on static imaging as the fibula remains reduced. The hypothesis of this study was that a previously undescribed novel finding on coronal MRI (lambda sign) is an independent indicator of latent syndesmosis instability. We also report on the utility of classic radiographic and physical exam findings. A total of 23 patients with latent syndesmotic instability diagnosed via arthroscopy (group I) were compared to a cohort of 40 patients who were found to have a stable syndesmosis during arthroscopy for unrelated conditions (group II). A retrospective chart review was performed evaluating their clinical history, preoperative physical examination, and radiologic findings. The lambda sign is a high intensity signal seen on coronal MR imaging that resembles the Greek letter lambda. All of the physical exam findings tested were statistically significant. Pain at the syndesmosis had the highest sensitivity (83%), while pain reproduced with the proximal squeeze test resulted in the highest specificity (89%). The external rotation stress test had the highest positive predictive value (75%). Of the radiographic examinations performed, only the lambda sign was found to have statistical significance with a sensitivity of 75% and a specificity of 63%. The presence of a lambda sign on the MRI of patients with physical exam findings suggestive of syndesmotic pain was highly sensitive (75%) and specific (85%). The lambda sign noted on the coronal MRI was both sensitive and specific for injuries involving greater than 2 mm of diastasis on arthroscopic stress examination of the syndesmosis. While neither the lambda sign nor any other finding on physical or radiographic examination represented an independent predictor of syndesmotic instability, the presence of a lambda sign in concert with positive physical exam findings might help health care providers determine which patients might benefit from operative intervention or referral. Level III, case control study. © The Author(s) 2014.

  18. A reanalysis of the SWP-HI IUE observations of Capella

    NASA Technical Reports Server (NTRS)

    Wood, Brian E.; Ayres, T. R.

    1995-01-01

    We have reanalyzed the numerous high-resolution, far-ultraviolet observations of Capella made by the International Ultraviolet Explorer (IUE) in its 16 yr lifetime. Our purpose was to search for long-term profile variations in Capella's ultraviolet emission lines and to complement the analysis of Goddard High Resolution Spectrograph (GHRS) observations of Capella, discussed in a companion paper (Linsky et al. 1995). We implemented a state-of-the-art photometric correction and spectral extraction procedure to improve S/N and control potential sources for systematic errors. Nevertheless, we were unable to find compelling evidence for any significant long-term profile variations. Previous work has shown that the G8 primary star is only a minor contributor to the high-excitation transition region lines but is a significant contributor to the low-excitation chromospheric lines. We have found exceptions to this rule, however. We find that the G8 star is responsible for a significant portion of Capella's N V lambda lambda 1239, 1243 emission, but is not a large contributor to the S I lambda 1296, Cl I lambda 1352, and O lambda 1356 lines. We suggest possible explanations for these behaviors. We also find evidence that the He II lambda 1640 emission from the G1 star is from the transition region, while the He II lambda 1640 emission from the G8 star is chromospheric, consistent with the findings of Linsky et al. (1994). The C II lambda 1336 line shows a weak central reversal. It is blueshifted by about 9 km/s with respect to the centroid of the emission from the G1 star. While the central reversal of the C II line is blueshifted by about 9 km/s with respect to the centroid of the emission from the G1 star. While the central reversal of the C II line is blueshifted, the central reversal of the Si III lambda 1207 line discussed by Linsky et al. (1994) is not.

  19. Ultraviolet Broad Absorption Features and the Spectral Energy Distribution of the QSO PG 1351+64. 3.1

    NASA Technical Reports Server (NTRS)

    Zheng, W.; Kriss, G. A.; Wang, J. X.; Brotherton, M.; Oegerle, W. R.; Blair, W. P.; Davidsen, A. F.; Green, R. F.; Hutchings, J. B.; Kaiser, M. E.; hide

    2001-01-01

    We present a moderate-resolution (approximately 20 km s(exp -1) spectrum of the mini broad absorption line QSO PG 1351+64 between 915-1180 A, obtained with the Far Ultraviolet Spectroscopic Explorer (FUSE). Additional low-resolution spectra at longer wavelengths were also obtained with the Hubble Space Telescope (HST) and ground-based telescopes. Broad absorption is present on the blue wings of C III (lambda)977, Ly(beta), O VI (lambda)(lambda)1032,1038, Ly(alpha), N V (lambda)(lambda)1238,1242, Si IV (lambda)(lambda)1393,1402, and C IV (lambda)(lambda)1548,1450. The absorption profile can be fitted with five components at velocities of approximately -780, -1049, -1629, -1833, and -3054 km s(exp -1) with respect to the emission-line redshift of z = 0.088. All the absorption components cover a large fraction of the continuum source as well as the broad-line region. The O VI emission feature is very weak, and the O VI/Ly(alpha) flux ratio is 0.08, one of the lowest among low-redshift active galaxies and QSOs. The UV (ultraviolet) continuum shows a significant change in slope near 1050 A in the restframe. The steeper continuum shortward of the Lyman limit extrapolates well to the observed weak X-ray flux level. The absorbers' properties are similar to those of high-redshift broad absorption-line QSOs. The derived total column density of the UV absorbers is on the order of 10(exp 21) cm(exp -2), unlikely to produce significant opacity above 1 keV in the X-ray. Unless there is a separate, high-ionization X-ray absorber, the QSO's weak X-ray flux may be intrinsic. The ionization level of the absorbing components is comparable to that anticipated in the broad-line region, therefore the absorbers may be related to broad-line clouds along the line of sight.

  20. Ultraviolet Broad Absorption Features and the Spectral Energy Distribution of the QSO PG 1351+641. 2.5

    NASA Technical Reports Server (NTRS)

    Zheng, W.; Kriss, G. A.; Wang, J. X.; Brotherton, M.; Oegerle, W. R.; Blair, W. P.; Davidsen, A. F.; Green, R. F.; Hutchings, J. B.; Kaiser, M. E.; hide

    2001-01-01

    We present a moderate-resolution (approximately 20 km/s) spectrum of the broad-absorption line QSO PG 1351+64 between 915-1180 angstroms, obtained with the Far Ultraviolet Spectroscopic Explorer (FUSE). Additional low-resolution spectra at longer wavelengths were also obtained with the Hubble Space Telescope (HST) and ground-based telescopes. Broad absorption is present on the blue wings of C III lambda977, Ly-beta, O VI lambda-lambda-1032,1038, Ly-alpha, N V lambda-lambda-1238,1242, Si IV lambda-lambda-1393,1402, and C IV lambda-lambda-1548,1450. The absorption profile can be fitted with five components at velocities of approximately -780, -1049, -1629, -1833, and -3054 km/s with respect to the emission-line redshift of z = 0.088. All the absorption components cover a large fraction of the continuum source as well as the broad-line region. The O VI emission feature is very weak, and the O VI/Ly-alpha flux ratio is 0.08, one of the lowest among low-redshift active galaxies and QSOs. The ultraviolet continuum shows a significant change in slope near 1050 angstroms in the restframe. The steeper continuum shortward of the Lyman limit extrapolates well to the observed weak X-ray flux level. The absorbers' properties are similar to those of high-redshift broad absorption-line QSOs. The derived total column density of the UV absorbers is on the order of 10(exp 21)/s, unlikely to produce significant opacity above 1 keV in the X-ray. Unless there is a separate, high-ionization X-ray absorber, the QSO's weak X-ray flux may be intrinsic. The ionization level of the absorbing components is comparable to that anticipated in the broad-line region, therefore the absorbers may be related to broad-line clouds along the line of sight.

  1. One-particle inclusive and semi-inclusive spectra of. lambda. hyperons in p-barp interactions at 32 GeV/c

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Bogolyubskii-breve, M.Y.; Vinitskii-breve, A.A.; Ermolov, P.F.

    1986-05-01

    Inclusive and semi-inclusive ..lambda..-hyperon spectra in p-barp interactions at 32 GeV/c are presented. The processes whereby ..lambda.. hyperons are produced in various channels are analyzed by comparison with the predictions of the Lund model and with dual-topological-unitarization (DTU)-based models. The ..lambda..-hyperon characteristics differ from those predicted in the Lund model. The main cause of the differences is that multiple production of particles is represented in this model in terms of breaking of one string, thereby excluding correlation effects between the vertices.

  2. Kato type operators and Weyl's theorem

    NASA Astrophysics Data System (ADS)

    Duggal, B. P.; Djordjevic, S. V.; Kubrusly, Carlos

    2005-09-01

    A Banach space operator T satisfies Weyl's theorem if and only if T or T* has SVEP at all complex numbers [lambda] in the complement of the Weyl spectrum of T and T is Kato type at all [lambda] which are isolated eigenvalues of T of finite algebraic multiplicity. If T* (respectively, T) has SVEP and T is Kato type at all [lambda] which are isolated eigenvalues of T of finite algebraic multiplicity (respectively, T is Kato type at all [lambda][set membership, variant]iso[sigma](T)), then T satisfies a-Weyl's theorem (respectively, T* satisfies a-Weyl's theorem).

  3. Assessments of fluid friction factors for use in leak rate calculations

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chivers, T.C.

    1997-04-01

    Leak before Break procedures require estimates of leakage, and these in turn need fluid friction to be assessed. In this paper available data on flow rates through idealized and real crack geometries are reviewed in terms of a single friction factor k It is shown that for {lambda} < 1 flow rates can be bounded using correlations in terms of surface R{sub a} values. For {lambda} > 1 the database is less precise, but {lambda} {approx} 4 is an upper bound, hence in this region flow calculations can be assessed using 1 < {lambda} < 4.

  4. Geometrical interpretation for the outer SU(3) outer multiplicity label

    NASA Technical Reports Server (NTRS)

    Draayer, Jerry P.; Troltenier, D.

    1995-01-01

    A geometrical interpretation for the outer multiplicity rho that occurs in a reduction of the product of two SU(3) representations, (lambda(sub pi), mu(sub pi)) x (lambda(sub nu), mu(sub nu)) approaches sigma(sub rho)(lambda, mu)(sub rho), is introduced. This coupling of proton (pi) and neutron (nu) representations arises, for example, in both boson and fermion descriptions of heavy deformed nuclei. Attributing a geometry to the coupling raises the possibility of introducing a simple interaction that provides a physically meaningful way for distinguishing multiple occurrences of (lambda, mu) values that can arise in such products.

  5. U.S. EPA, Pesticide Product Label, ISOTOX INSECT KILLER FORMULA IV, 11/19/1992

    EPA Pesticide Factsheets

    2011-04-13

    ... StIr.bs ,"'1 "" f ,lpl\\ ] T: s II ' : I ,';' T • j' , •• , S; 'do ... ~t" '''stCII 0' /fI,tn II, plfler~ oriel-jon" ~.-t;, \\ "~l "~' -td R'.-Ul,t 'f''''nlahon occur, For Mfilybul~"IOw.' ...

  6. U.S. EPA, Pesticide Product Label, BALAN E.C., 02/08/1993

    EPA Pesticide Factsheets

    2011-04-21

    ... CII CDIIct 517~ • tOO. • • • • Ali 3 ..... 0." lIP DollCllllliPor __ foodI~VUgs • or daI'.1Q.. ... pi' r ,', L • ~"'-cIioiIy"'-- _ . ..., WtIorIn e 6 • ' .. Maid boom .... _ .. ...

  7. Associations between Intimate Partner Violence and Health among Men Who Have Sex with Men: A Systematic Review and Meta-Analysis

    PubMed Central

    Buller, Ana Maria; Devries, Karen M.; Howard, Louise M.; Bacchus, Loraine J.

    2014-01-01

    Background Intimate partner violence (IPV) among men who have sex with men (MSM) is a significant problem. Little is known about the association between IPV and health for MSM. We aimed to estimate the association between experience and perpetration of IPV, and various health conditions and sexual risk behaviours among MSM. Methods and Findings We searched 13 electronic databases up to 23 October 2013 to identify research studies reporting the odds of health conditions or sexual risk behaviours for MSM experiencing or perpetrating IPV. Nineteen studies with 13,797 participants were included in the review. Random effects meta-analyses were performed to estimate pooled odds ratios (ORs). Exposure to IPV as a victim was associated with increased odds of substance use (OR = 1.88, 95% CIOR 1.59–2.22, I 2 = 46.9%, 95% CII 2 0%–78%), being HIV positive (OR = 1.46, 95% CIOR 1.26–1.69, I 2 = 0.0%, 95% CII 2 0%–62%), reporting depressive symptoms (OR = 1.52, 95% CIOR 1.24–1.86, I 2 = 9.9%, 95% CII 2 0%–91%), and engagement in unprotected anal sex (OR = 1.72, 95% CIOR 1.44–2.05, I 2 = 0.0%, 95% CII 2 0%–68%). Perpetration of IPV was associated with increased odds of substance use (OR = 1.99, 95% CIOR 1.33–2.99, I 2 = 73.1%). These results should be interpreted with caution because of methodological weaknesses such as the lack of validated tools to measure IPV in this population and the diversity of recall periods and key outcomes in the identified studies. Conclusions MSM who are victims of IPV are more likely to engage in substance use, suffer from depressive symptoms, be HIV positive, and engage in unprotected anal sex. MSM who perpetrate IPV are more likely to engage in substance use. Our results highlight the need for research into effective interventions to prevent IPV in MSM, as well as the importance of providing health care professionals with training in how to address issues of IPV among MSM and the need to raise awareness of local and national support services. Please see later in the article for the Editors' Summary PMID:24594975

  8. Interpretation Difficulties of Serum Immunofixation Test in Immunoglobulin D Multiple Myeloma with Hidden Lambda Light Chains.

    PubMed

    Biaz, A; Uwingabiye, J; Rachid, A; Dami, A; Bouhsain, S; Ouzzif, Z; Idrissi, S El Machtani

    2018-06-01

    We report a case of immunoglobulin (Ig) D myeloma with hidden lambda light chains in a patient whose immunofixation test was very difficult to interpret: the IgD reacts with the anti-δ heavy chain antiserum but does not react with anti-lambda antiserum. The band in the D heavy chain lane is unmatched in light chain lanes and the band in lambda light chain lane migrates higher. To distinguish between heavy chain disease and immunoglobulin with "hidden" light chains, the sample was exposed to a very high concentration of anti-lambda and anti-kappa antisera for 48 hours. The serum immunofixation test of the sample treated with anti-lambda showed a decrease in the intensity of the band corresponding to D heavy chain lane as well as the modification of its mobility confirming the presence of IgD with the hidden lambda light chains. The IgD myeloma with hidden light chains remains a rare entity, hence the interest of sensitizing health professionals to be vigilant and ensure a good diagnosis. The proposed technique is useful, simple, reliable, and less laborious than those previous reported in the literature. Medical laboratories using Sebia-Hydrasys® system should be aware of the described phenomenon in order to avoid identifying an IgD myeloma as a delta heavy chain disease.

  9. Perturbation theory corrections to the two-particle reduced density matrix variational method.

    PubMed

    Juhasz, Tamas; Mazziotti, David A

    2004-07-15

    In the variational 2-particle-reduced-density-matrix (2-RDM) method, the ground-state energy is minimized with respect to the 2-particle reduced density matrix, constrained by N-representability conditions. Consider the N-electron Hamiltonian H(lambda) as a function of the parameter lambda where we recover the Fock Hamiltonian at lambda=0 and we recover the fully correlated Hamiltonian at lambda=1. We explore using the accuracy of perturbation theory at small lambda to correct the 2-RDM variational energies at lambda=1 where the Hamiltonian represents correlated atoms and molecules. A key assumption in the correction is that the 2-RDM method will capture a fairly constant percentage of the correlation energy for lambda in (0,1] because the nonperturbative 2-RDM approach depends more significantly upon the nature rather than the strength of the two-body Hamiltonian interaction. For a variety of molecules we observe that this correction improves the 2-RDM energies in the equilibrium bonding region, while the 2-RDM energies at stretched or nearly dissociated geometries, already highly accurate, are not significantly changed. At equilibrium geometries the corrected 2-RDM energies are similar in accuracy to those from coupled-cluster singles and doubles (CCSD), but at nonequilibrium geometries the 2-RDM energies are often dramatically more accurate as shown in the bond stretching and dissociation data for water and nitrogen. (c) 2004 American Institute of Physics.

  10. A comparison of the fate and effects of two pyrethroid insecticides (lambda-cyhalothrin and cypermethrin) in pond mesocosms.

    PubMed

    Farmer, D; Hill, I R; Maund, S J

    1995-08-01

    : The fate and effects of two pyrethroid insecticides (lambda-cyhalothrin and cypermethrin) were investigated in replicated 25 m(3) pond mesocosms. Three pesticide treatments which simulated spray drift deposition were examined: 0.7 g a.i. ha(-1) cypermethrin and 0.17 and 1.7 g a.i. ha(-1) lambda-cyhalothrin. Based on the use rate and pesticidal activity of the chemicals, the cypermethrin and lower lambda-cyhalothrin rates were approximately equivalent. After applications, pyrethroid residues in the water column declined rapidly. Treatment-related effects were observed on some macroinvertebrate taxa, most notably the Asellidae and Gammaridae. Surfacedwelling insects also suffered initial knock-down, particularly in the 1.7 g a.i. ha(-1) lambda-cyhalothrin treatment, but there was recovery after the spray period. No adverse effects occurred on algae, macrophytes or zooplankton, but there were occasional enhancements (e.g. algal biomass and abundances of copepod nauplii and Rotifera) which may have been indirect effects. An overall comparison of the treatments indicated that the higher lambda-cyhalothrin rate had the greatest effects, whilst the cypermethrin application had a somewhat greater impact than the lower lambda-cyhalothrin treatment rate (due to effects on peracarid crustaceans). The study indicated that should spray drift occur at the levels expected for either pyrethroid's normal use patterns, potential impacts on natural aquatic ecosystems would be minor and transient.

  11. Statistical Considerations in Choosing a Test Reliability Coefficient. ACT Research Report Series, 2012 (10)

    ERIC Educational Resources Information Center

    Woodruff, David; Wu, Yi-Fang

    2012-01-01

    The purpose of this paper is to illustrate alpha's robustness and usefulness, using actual and simulated educational test data. The sampling properties of alpha are compared with the sampling properties of several other reliability coefficients: Guttman's lambda[subscript 2], lambda[subscript 4], and lambda[subscript 6]; test-retest reliability;…

  12. First report of L1014F-kdr mutation in Culex pipiens complex from Morocco.

    PubMed

    Bkhache, Meriem; Tmimi, Fatim-Zohra; Charafeddine, Omar; Faraj, Chafika; Failloux, Anna-Bella; Sarih, M'hammed

    2016-12-16

    Mosquitoes of the Culex pipiens complex, competent vectors for West Nile virus (WNV) and Rift Valley fever virus (RVFV) are widely targeted by insecticide treatments. The intensive application of chemical insecticides led to the development of resistance in many insects including Culex pipiens mosquitoes. The absence of data on resistance mechanisms in Morocco allow us to assess the levels of lambda-cyhalothrin resistance and the frequency of the mutated gene L1014F kdr in different forms of Cx. pipiens complex from three regions of Morocco. Mosquito adults were reared from immature stages collected in three different regions in Morocco (Tangier, Casablanca and Marrakech). Standard WHO insecticide susceptibility tests were conducted on adults emerged from collected larvae. Specimens were identified as belonging to the Culex pipiens complex using a multiplex PCR assay with diagnostic primers designed from the flanking region of microsatellite CQ11. Identified mosquitoes were then tested for the presence of the L1014F kdr mutation using PCR assay. Our results showed that 21% of the tested population has a resistance to lambda-cyhalothrin. The molecular identification of survivors shows that 43% belonged to the Cx. pipiens pipiens and only 9.5% to the Cx. pipiens molestus form. On the other hand, 416 specimens were screened for the L1014F kdr mutation. L1014F mutation was detected in different forms of Cx. pipiens in different sites. The frequency of L1014F mutation was similar between the Cx. pipiens pipiens form and hybrid form, while it was lower in the Cx. pipiens molestus form. The presence of the L1014F kdr allele was significantly associated with resistance to lambda-cyhalothrin in Cx. pipiens pipiens (P < 0.0001) and hybrid form (P < 0.0001). Resistance to lambda-cyhalothrin of Cx. pipiens populations appears to be largely due to the L1014F kdr mutation. To our knowledge, the frequencies of L1014F kdr mutation are examined for the first time in natural populations of the Culex pipiens complex in Morocco. These findings will provide important information to propose more adapted vector control measures towards this mosquito species, potential vector of arboviruses.

  13. The pharmacokinetics of peginterferon lambda-1a following single dose administration to subjects with impaired renal function.

    PubMed

    Hruska, Matthew W; Adamczyk, Robert; Colston, Elizabeth; Hesney, Michael; Stonier, Michele; Myler, Heather; Bertz, Richard

    2015-09-01

    This open label study was conducted to assess the effect of renal impairment (RI) on the pharmacokinetics (PK) of peginterferon lambda-1a (Lambda). Subjects (age 18-75 years, BMI 18-35 kg m(-2) ) were enrolled into one of five renal function groups: normal (n = 12), mild RI (n = 8), moderate RI (n = 8), severe RI (n = 7), end-stage renal disease (ESRD, n = 8) based on estimated glomerular filtration rate (eGFR) calculated using the Modification of Diet in Renal Disease (MDRD) equation. Subjects received a single dose of Lambda (180 µg) subcutaneously on day 1 followed by PK serum sample collections through day 29. Safety, tolerability and immunogenicity data were collected through day 43. PK parameters were estimated and summarized by group. Geometric mean ratios (GMR) and 90% confidence intervals (CIs) were calculated between normal and RI groups. With decreasing eGFR, Lambda exposure (Cmax , AUC) increased while apparent clearance (CL/F) and apparent volume of distribution (V/F) decreased. Relative to subjects with normal renal function (geometric mean AUC = 99.5 ng ml(-1) h), Lambda exposure estimates (AUC) were slightly increased in the mild RI group (geometric mean [90% CI]: 1.20 [0.82, 1.77]) and greater in the moderate (1.95 [1.35, 2.83]), severe RI (1.95 [1.30, 2.93]) and ESRD (1.88 [1.30, 2.73]) groups. Lambda was generally well tolerated. The results demonstrated that RI reduces the clearance of Lambda and suggests that dose modifications may not be required in patients with mild RI but may be required in patients with moderate to severe RI or ESRD. © 2015 The British Pharmacological Society.

  14. Fluorescence spectroscopy for rapid detection and classification of bacterial pathogens.

    PubMed

    Sohn, Miryeong; Himmelsbach, David S; Barton, Franklin E; Fedorka-Cray, Paula J

    2009-11-01

    This study deals with the rapid detection and differentiation of Escherichia coli, Salmonella, and Campylobacter, which are the most commonly identified commensal and pathogenic bacteria in foods, using fluorescence spectroscopy and multivariate analysis. Each bacterial sample cultured under controlled conditions was diluted in physiologic saline for analysis. Fluorescence spectra were collected over a range of 200-700 nm with 0.5 nm intervals on the PerkinElmer Fluorescence Spectrometer. The synchronous scan technique was employed to find the optimum excitation (lambda(ex)) and emission (lambda(em)) wavelengths for individual bacteria with the wavelength interval (Deltalambda) being varied from 10 to 200 nm. The synchronous spectra and two-dimensional plots showed two maximum lambda(ex) values at 225 nm and 280 nm and one maximum lambda(em) at 335-345 nm (lambda(em) = lambda(ex) + Deltalambda), which correspond to the lambda(ex) = 225 nm, Deltalambda = 110-120 nm, and lambda(ex) = 280 nm, Deltalambda = 60-65 nm. For all three bacterial genera, the same synchronous scan results were obtained. The emission spectra from the three bacteria groups were very similar, creating difficulty in classification. However, the application of principal component analysis (PCA) to the fluorescence spectra resulted in successful classification of the bacteria by their genus as well as determining their concentration. The detection limit was approximately 10(3)-10(4) cells/mL for each bacterial sample. These results demonstrated that fluorescence spectroscopy, when coupled with PCA processing, has the potential to detect and to classify bacterial pathogens in liquids. The methodology is rapid (>10 min), inexpensive, and requires minimal sample preparation compared to standard analytical methods for bacterial detection.

  15. Measurements of the branching fractions for B{sub (s)}{yields}D{sub (s)}{pi}{pi}{pi} and {Lambda}{sub b}{sup 0}{yields}{Lambda}{sub c}{sup +}{pi}{pi}{pi}

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Aaij, R.; Bauer, Th.; Beuzekom, M. van

    Branching fractions of the decays H{sub b}{yields}H{sub c}{pi}{sup -}{pi}{sup +}{pi}{sup -} relative to H{sub b}{yields}H{sub c}{pi}{sup -} are presented, where H{sub b} (H{sub c}) represents B{sup 0} (D{sup +}), B{sup -} (D{sup 0}), B{sub s}{sup 0} (D{sub s}{sup +}), and {Lambda}{sub b}{sup 0} ({Lambda}{sub c}{sup +}). The measurements are performed with the LHCb detector using 35 pb{sup -1} of data collected at {radical}(s)=7 TeV. The ratios of branching fractions are measured to be [B(B{sup 0}{yields}D{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -})]/[B(B{sup 0}{yields}D{sup +}{pi}{sup -})]=2.38{+-}0.11{+-}0.21, [B(B{sup -}{yields}D{sup 0}{pi}{sup -}{pi}{sup +}{pi}{sup -})]/[B(B{sup -}{yields}D{sup 0}{pi}{sup -})]= 1.27{+-}0.06{+-}0.11, [B(B{sub s}{sup 0}{yields}D{sub s}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -})]/[B(B{submore » s}{sup 0}{yields}D{sub s}{sup +}{pi}{sup -})]=2.01{+-}0.37{+-}0.20, [B({Lambda}{sub b}{sup 0}{yields}{Lambda}{sub c}{sup +}{pi}{sup -} {pi}{sup +}{pi}{sup -})]/[B({Lambda}{sub b}{sup 0}{yields}{Lambda}{sub c}{sup +}{pi}{sup -})]=1.43{+-}0.16{+-}0.13 We also report measurements of partial decay rates of these decays to excited charm hadrons. These results are of comparable or higher precision than existing measurements.« less

  16. RAMAN SCATTERED He II {lambda}4332 IN THE SYMBIOTIC STAR V1016 CYGNI

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lee, Hee-Won

    Raman scattering of He II line photons with atomic hydrogen is important in studying the mass loss processes in many symbiotic stars and a number of young planetary nebulae. We calculate the scattering cross sections and branching ratios associated with the Raman scattered He II {lambda}4332 feature formed through inelastic scattering of He II {lambda}949 with a hydrogen atom. At the line center of He II {lambda}949, the total scattering cross section is computed to be {sigma}{sub tot} = 2.5 Multiplication-Sign 10{sup -22} cm{sup 2}, and the branching ratio into the level 2s is 0.12. We also present a high-resolutionmore » spectrum of the symbiotic star V1016 Cygni obtained with the 1.8 m telescope at Mt. Bohyun to investigate the Raman scattering origin of the broad feature blueward of He II {lambda}4338. Based on the atomic calculation, we perform Monte Carlo calculations for the line formation. The scattering region is assumed to be a part of a uniform spherical shell that subtends a solid angle {Delta}{Omega} = {pi} steradian with a neutral column density N{sub HI} = 1.0 x 10{sup 21} cm{sup -2}. By adding a far-UV continuum around He II {lambda}949 normalized by the equivalent width of He II {lambda}949 to be 2.3 Angstrom-Sign , we obtain a good fit for both the Raman scattered He II {lambda}4332 and the broad wings around H{gamma}. Our analysis of the Raman feature blueward of H{gamma} in V1016 Cyg is consistent with the previous study of the Raman features blueward of H{alpha} and H{beta} by Jung and Lee.« less

  17. Distributed modeling of diffusive solute transport in peritoneal dialysis.

    PubMed

    Waniewski, Jacek

    2002-01-01

    The diffusive transport between blood and an ex-tissue medium (dialysis fluid) is evaluated using a mathematical model that takes into account the (quasicontinuous) distribution of capillaries within the tissue at various distances from the tissue surface, and includes diffusive-convective transport through the capillary wall and lymphatic absorption from the tissue. General formulas for solute penetration depth, lambda, and for the diffusive mass transport coefficient for the transport between blood and dialysis fluid, K(BD), are provided in terms of local transport coefficients for capillary wall, tissue, and lymphatic absorption. For pure diffusive transport between blood and dialysis fluid and thick tissue layers (i.e., if the solute penetration depth is much lower than the tissue thickness) these formulas yield previously known expressions. It is shown that apparent tissue layers, with widths lambdaTBL and lambdaT, respectively, may be defined according to the values of local transport parameters in such a way that K(BD) is equal to the solute clearance K(TBL) from the tissue by blood and lymph for a layer with width lambdaTBL or to the solute clearance K(T) from blood to dialysate by diffusion through the tissue layer with width lambdaT. For tissue layers with width much higher than the penetration depth: lambdaT approximately = lambdaTBL approximately = lambda. These characteristic width lengths depend on the transport parameters (and thus on the size) of solutes. Effective blood flow, which may be related to the exchange of the solute between blood and dialysate, is defined using an analogy to the extraction/absorption coefficients for blood-tissue exchange. Various approximations for the distributed model formula for diffusive mass transport coefficient (K(BD)) are possible. The appropriate range for their application is obtained from the general formula.

  18. Fitting the constitution type Ia supernova data with the redshift-binned parametrization method

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Huang Qingguo; Kavli Institute for Theoretical Physics China, Chinese Academy of Sciences, Beijing 100190; Li Miao

    2009-10-15

    In this work, we explore the cosmological consequences of the recently released Constitution sample of 397 Type Ia supernovae (SNIa). By revisiting the Chevallier-Polarski-Linder (CPL) parametrization, we find that, for fitting the Constitution set alone, the behavior of dark energy (DE) significantly deviates from the cosmological constant {lambda}, where the equation of state (EOS) w and the energy density {rho}{sub {lambda}} of DE will rapidly decrease along with the increase of redshift z. Inspired by this clue, we separate the redshifts into different bins, and discuss the models of a constant w or a constant {rho}{sub {lambda}} in each bin,more » respectively. It is found that for fitting the Constitution set alone, w and {rho}{sub {lambda}} will also rapidly decrease along with the increase of z, which is consistent with the result of CPL model. Moreover, a step function model in which {rho}{sub {lambda}} rapidly decreases at redshift z{approx}0.331 presents a significant improvement ({delta}{chi}{sup 2}=-4.361) over the CPL parametrization, and performs better than other DE models. We also plot the error bars of DE density of this model, and find that this model deviates from the cosmological constant {lambda} at 68.3% confidence level (CL); this may arise from some biasing systematic errors in the handling of SNIa data, or more interestingly from the nature of DE itself. In addition, for models with same number of redshift bins, a piecewise constant {rho}{sub {lambda}} model always performs better than a piecewise constant w model; this shows the advantage of using {rho}{sub {lambda}}, instead of w, to probe the variation of DE.« less

  19. Observation of B{sup +}{yields}{xi}{sub c}{sup 0}{lambda}{sub c}{sup +} and evidence for B{sup 0}{yields}{xi}{sub c}{sup -}{lambda}{sub c}{sup +}

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chistov, R.; Aushev, T.; Balagura, V.

    We report the first observation of the decay B{sup +}{yields}{xi}{sub c}{sup 0}{lambda}{sub c}{sup +} with a significance of 8.7{sigma} and evidence for the decay B{sup 0}{yields}{xi}{sub c}{sup -}{lambda}{sub c}{sup +} with a significance of 3.8{sigma}. The product B(B{sup +}{yields}{xi}{sub c}{sup 0}{lambda}{sub c}{sup +})xB({xi}{sub c}{sup 0}{yields}{xi}{sup +}{pi}{sup -}) is measured to be (4.8{sub -0.9}{sup +1.0}{+-}1.1{+-}1.2)x10{sup -5}, and B(B{sup 0}{yields}{xi}{sub c}{sup -}{lambda}{sub c}{sup +})xB({xi}{sub c}{sup -}{yields}{xi}{sup +}{pi}{sup -}{pi}{sup -}) is measured to be (9.3{sub -2.8}{sup +3.7}{+-}1.9{+-}2.4)x10{sup -5}. The errors are statistical, systematic and the error of the {lambda}{sub c}{sup +}{yields}pK{sup -}{pi}{sup +} branching fraction, respectively. The decay B{sup +}{yields}{xi}{sub c}{sup 0}{lambda}{sub c}{supmore » +} is the first example of a two-body exclusive B{sup +} decay into two charmed baryons. The data used for this analysis was accumulated at the {upsilon}(4S) resonance, using the Belle detector at the e{sup +}e{sup -} asymmetric-energy collider KEKB. The integrated luminosity of the data sample is equal to 357 fb{sup -1}, corresponding to 386x10{sup 6} BB pairs.« less

  20. Linear Polarization Measurements of Chromospheric Emission Lines

    NASA Technical Reports Server (NTRS)

    Sheeley, N. R., Jr.; Keller, C. U.

    2003-01-01

    We have used the Zurich Imaging Stokes Polarimeter (ZIMPOL I) with the McMath-Pierce 1.5 m main telescope on Kitt Peak to obtain linear polarization measurements of the off-limb chromosphere with a sensitivity better than 1 x 10(exp -5). We found that the off-disk observations require a combination of good seeing (to show the emission lines) and a clean heliostat (to avoid contamination by scattered light from the Sun's disk). When these conditions were met, we obtained the following principal results: 1. Sometimes self-reversed emission lines of neutral and singly ionized metals showed linear polarization caused by the transverse Zeeman effect or by instrumental cross talk from the longitudinal Zeeman effect in chromospheric magnetic fields. Otherwise, these lines tended to depolarize the scattered continuum radiation by amounts that ranged up to 0.2%. 2. Lines previously known to show scattering polarization just inside the limb (such as the Na I lambda5889 D2 and the He I lambda5876 D3 lines) showed even more polarization above the Sun's limb, with values approaching 0.7%. 3. The O I triplet at lambda7772, lambda7774, and lambda7775 showed a range of polarizations. The lambda7775 line, whose maximum intrinsic polarizability, P(sub max), is less than 1%, revealed mainly Zeeman contributions from chromospheric magnetic fields. However, the more sensitive lambda7772 (P(sub max) = 19%) and lambda7774 (P(sub max) = 29%) lines had relatively strong scattering polarizations of approximately 0.3% in addition to their Zeeman polarizations. At times of good seeing, the polarization spectra resolve into fine structures that seem to be chromospheric spicules.

Top