Science.gov

Sample records for leeches genus hirudo

  1. First Isolation of a Giant Virus from Wild Hirudo medicinalis Leech: Mimiviridae isolation in Hirudo medicinalis

    PubMed Central

    Boughalmi, Mondher; Pagnier, Isabelle; Aherfi, Sarah; Colson, Philippe; Raoult, Didier; La Scola, Bernard

    2013-01-01

    Giant viruses and amoebae are common in freshwater, where they can coexist with other living multicellular organisms. We screened leeches from the species Hirudo medicinalis for giant viruses. We analyzed five H. medicinalis obtained from Tunisia (3) and France (2). The leeches were decontaminated and then dissected to remove internal parts for co-culture with Acanthamoeba polyphaga. The genomes of isolated viruses were sequenced on a 454 Roche instrument, and a comparative genomics analysis was performed. One Mimivirus was isolated and the strain was named Hirudovirus. The genome assembly generated two scaffolds, which were 1,155,382 and 25,660 base pairs in length. Functional annotations were identified for 47% of the genes, which corresponds to 466 proteins. The presence of Mimividae in the same ecological niche as wild Hirudo may explain the presence of the mimivirus in the digestive tract of the leech, and several studies have already shown that viruses can persist in the digestive tracts of leeches fed contaminated blood. As leeches can be used medically and Mimiviruses have the potential to be an infectious agent in humans, patients treated with leeches should be surveyed to investigate a possible connection. PMID:24287596

  2. First isolation of a giant virus from wild Hirudo medicinalis leech: Mimiviridae isolation in Hirudo medicinalis.

    PubMed

    Boughalmi, Mondher; Pagnier, Isabelle; Aherfi, Sarah; Colson, Philippe; Raoult, Didier; La Scola, Bernard

    2013-11-27

    Giant viruses and amoebae are common in freshwater, where they can coexist with other living multicellular organisms. We screened leeches from the species Hirudo medicinalis for giant viruses. We analyzed five H. medicinalis obtained from Tunisia (3) and France (2). The leeches were decontaminated and then dissected to remove internal parts for co-culture with Acanthamoeba polyphaga. The genomes of isolated viruses were sequenced on a 454 Roche instrument, and a comparative genomics analysis was performed. One Mimivirus was isolated and the strain was named Hirudovirus. The genome assembly generated two scaffolds, which were 1,155,382 and 25,660 base pairs in length. Functional annotations were identified for 47% of the genes, which corresponds to 466 proteins. The presence of Mimividae in the same ecological niche as wild Hirudo may explain the presence of the mimivirus in the digestive tract of the leech, and several studies have already shown that viruses can persist in the digestive tracts of leeches fed contaminated blood. As leeches can be used medically and Mimiviruses have the potential to be an infectious agent in humans, patients treated with leeches should be surveyed to investigate a possible connection.

  3. Spontaneous Electrical Activity and Behavior in the Leech Hirudo Medicinalis

    PubMed Central

    Garcia-Perez, Elizabeth; Mazzoni, Alberto; Torre, Vincent

    2007-01-01

    In the absence of external stimuli, animals explore the environment by performing irregular movements, but the neuronal mechanisms underlying this arrhythmic motion are largely unknown. In this paper, we studied the relationship between the spontaneous neuronal activity in the leech (Hirudo medicinalis) and its behavior. We analyzed the electrical activity of isolated ganglia, chains of two connected ganglia, and semi-intact preparations. The spontaneous electrical activity in ganglia was characterized by the occurrence of irregular bursts of spikes with variable duration and size. Properties of these bursts were modified by synaptic inputs arriving from the neighboring ganglia and from the two primitive brains located in the head and tail. In fact, in semi-intact preparations, unusually large bursts of spikes occurring spontaneously were recorded and caused the leech to move even in the absence of any external sensory stimulation. These large bursts appear to act as internal triggers controlling the spontaneous leech behavior and determining the duration of stereotypical motor patterns. PMID:18958236

  4. Flavobacterium cutihirudinis sp. nov., isolated from the skin of the medical leech Hirudo verbana.

    PubMed

    Glaeser, S P; Galatis, H; Martin, K; Kämpfer, P

    2013-08-01

    A Gram-staining-negative, non-endospore-forming, yellow-pigmented strain (E89(T)) was isolated from the skin of the medical leech Hirudo verbana obtained from a leech farm located in Biebertal, Germany. 16S rRNA gene sequencing analysis showed that the isolate was grouped in the genus Flavobacterium. Strain E89(T) was most closely related to Flavobacterium chilense LM-09-Fp(T) (98.2 %), Flavobacterium chungangense CJ7(T) (98.1 %), and Flavobacterium oncorhynchi 631-08(T) (98.1 %). 16S rRNA gene sequence similarities to all other species of the genus Flavobacterium were ≤ 97.4 %. A menaquinone of the type MK-6 was found to be the predominant respiratory quinone and the polar lipid profile consisted of the major compounds phosphatidylethanolamine, phosphatidylserine, two unidentified aminolipids, one unknown phospholipid and two unknown lipids. The fatty acid profile was composed of iso-C15 : 0, C15 : 0, summed feature 3 (C16 : 1ω7c and/or iso-C15 : 0 2-OH) found in major amounts and several hydroxylated fatty acids in smaller amounts, among them iso-C15 : 0 3-OH and iso-C17 : 0 3-OH. All these data support the allocation of the isolate in the genus Flavobacterium. Physiological/biochemical characterization and DNA-DNA hybridizations with the type strains of the most closely related species allowed a clear phenotypic and genotypic differentiation of the strain. Based on these data, strain E89(T) represents a novel species of the genus Flavobacterium, for which the name Flavobacterium cutihirudinis sp. nov. is proposed. The type strain is E89(T) (= DSM 25795(T) = LMG 26922(T) = CIP 110374(T)).

  5. Serotonin modulates muscle function in the medicinal leech Hirudo verbana

    PubMed Central

    Gerry, Shannon P.; Ellerby, David J.

    2011-01-01

    The body wall muscles of sanguivorous leeches power mechanically diverse behaviours: suction feeding, crawling and swimming. These require longitudinal muscle to exert force over an extremely large length range, from 145 to 46 per cent of the mean segmental swimming length. Previous data, however, suggest that leech body wall muscle has limited capacity for force production when elongated. Serotonin (5-HT) alters the passive properties of the body wall and stimulates feeding. We hypothesized that 5-HT may also have a role in allowing force production in elongated muscle by changing the shape of the length–tension relationship (LTR). LTRs were measured from longitudinal muscle strips in vitro in physiological saline with and without the presence of 10 µM 5-HT. The LTR was much broader than previously measured for leech muscle. Rather than shifting the LTR, 5-HT reduced passive muscle tonus and increased active stress at all lengths. In addition to modulating leech behaviour and passive mechanical properties, 5-HT probably enhances muscle force and work production during locomotion and feeding. PMID:21561963

  6. Functional morphology of suction discs and attachment performance of the Mediterranean medicinal leech (Hirudo verbana Carena)

    PubMed Central

    Eberhard, Laura; Gallenmüller, Friederike; Speck, Thomas

    2016-01-01

    Medicinal leeches use their suction discs for locomotion, adhesion to the host and, in the case of the anterior disc, also for blood ingestion. The biomechanics of their suction-based adhesion systems has been little understood until now. We investigated the functional morphology of the anterior and posterior suckers of Hirudo verbana by using light and scanning electron microscopy. Furthermore, we analysed the adhesion qualitatively and quantitatively by conducting behavioural and mechanical experiments. Our high-speed video analyses provide new insights into the attachment and detachment processes and we present a detailed description of the leech locomotion cycle. Pull-off force measurements of the anterior and posterior suction organs on seven different substrates under both aerial and water-submersed conditions reveal a significant influence of the surrounding medium, the substrate surface roughness and the tested organ on attachment forces and tenacities. PMID:27075001

  7. Small bite, large impact-saliva and salivary molecules in the medicinal leech, Hirudo medicinalis

    NASA Astrophysics Data System (ADS)

    Hildebrandt, Jan-Peter; Lemke, Sarah

    2011-12-01

    Blood-sucking leeches have been used for medical purposes in humans for hundreds of years. Accordingly, one of the most prominent species has been named Hirudo medicinalis by Carl Linne in 1758. Feeding on vertebrate blood poses some serious problems to blood-sucking ectoparasites, as they have to penetrate the body surface of the host and to suppress the normal reactions of the host to such injuries (swelling, pain, inflammation) to remain undetected during the feeding period. Furthermore, the parasites have to take measures to inhibit the normal reactions in host tissues to blood vessel damage, namely hemostasis and blood coagulation (platelet aggregation and activation, activation of thrombin and formation of fibrin clots). During evolution, leeches have acquired the ability to control these processes in their hosts by transferring various bioactive substances to the host. These substances are supposedly produced in unicellular salivary gland cells and injected into the wound at the feeding site through tiny salivary ductule openings in the jaws that the leech uses to slice open the host body surface and to cut blood vessels in the depth of the wound. This review summarizes current knowledge about the salivary gland cells and the biological effects of individual saliva components as well as hints to the potential usefulness of some of these compounds for medical purposes.

  8. Molecular basis of gap junctional communication in the CNS of the leech Hirudo medicinalis.

    PubMed

    Dykes, Iain M; Freeman, Fiona M; Bacon, Jonathan P; Davies, Jane A

    2004-01-28

    Gap junctions are intercellular channels that allow the passage of ions and small molecules between cells. In the nervous system, gap junctions mediate electrical coupling between neurons. Despite sharing a common topology and similar physiology, two unrelated gap junction protein families exist in the animal kingdom. Vertebrate gap junctions are formed by members of the connexin family, whereas invertebrate gap junctions are composed of innexin proteins. Here we report the cloning of two innexins from the leech Hirudo medicinalis. These innexins show a differential expression in the leech CNS: Hm-inx1 is expressed by every neuron in the CNS but not in glia, whereas Hm-inx2 is expressed in glia but not neurons. Heterologous expression in the paired Xenopus oocyte system demonstrated that both innexins are able to form functional homotypic gap junctions. Hm-inx1 forms channels that are not strongly gated. In contrast, Hm-inx2 forms channels that are highly voltage-dependent; these channels demonstrate properties resembling those of a double rectifier. In addition, Hm-inx1 and Hm-inx2 are able to cooperate to form heterotypic gap junctions in Xenopus oocytes. The behavior of these channels is primarily that predicted from the properties of the constituent hemichannels but also demonstrates evidence of an interaction between the two. This work represents the first demonstration of a functional gap junction protein from a Lophotrochozoan animal and supports the hypothesis that connexin-based communication is restricted to the deuterostome clade.

  9. Historical Article: Hirudo medicinalis: ancient origins of, and trends in the use of medicinal leeches throughout history.

    PubMed

    Whitaker, I S; Rao, J; Izadi, D; Butler, P E

    2004-04-01

    Blood letting and the therapeutic use of Hirudo medicinalis date back to ancient Egypt and the beginning of civilisation. Their popularity has varied over the years, reaching such a peak in Europe between 1825 and 1850 that supplies were exhausted. Towards the end of the century they fell out of favour and, during this period, the leech, once used by the physicians of emperors and influential academic surgeons, became associated with lay therapists and quackery. Leeches have enjoyed a renaissance in reconstructive microsurgery during the last 15 years, having been used by maxillofacial [Br. J. Oral Maxillofac. Surg 41 (2003) 44] and other reconstructive surgeons to aid salvage of compromised microvascular free tissue transfers [Laryngoscope 108 (1998) 1129; Br. J. Plast. Surg. 34 (1984) 358], replanted digits [Int. J. Microsurg. 3 (1981) 265], ears [Ann. Plast. Surg. 43 (1999) 427], lips [Plast. Reconstr. Surg. 102 (1998) 358; J. Reconstr. Microsurg. 9 (1993) 327] and nasal tips [Br. J. Oral Maxillofac. Surg. 36 (1998) 462]. Peer-reviewed evidence suggests that the survival of compromised, venous-congested tissues is improved by early application of a leech [J. Reconstr. Microsurg. 12 (1996) 165; Arch. Otolaryngol. Head Neck Surg. 114 (1988) 1395; Br. J. Plast. Surg. 45 (1992) 235]. Leeches have also recently been used to treat a wide range of conditions, including periorbital haematomas [Br. J. Ophthalmol. 75 (1991) 755], severe macroglossia [Otolaryngol. Head Neck Surg. 125 (2001) 649; J. Laryngol. Otol. 109 (1995) 442] and purpura fulminans [Ann. Plast. Surg. 35 (1995) 300]. The first medicinal leech farm, Biopharm, was set up in Swansea in 1981 by Dr Roy Sawyer, and now supplies leeches to hospitals all over the world. In this paper, we summarise the history of treatment with Hirudo medicinalis from its origin to the present day, and take a brief look at the possible future of the annelid.

  10. Acetyl-L-carnitine affects nonassociative learning processes in the leech Hirudo medicinalis.

    PubMed

    Ristori, C; Cataldo, E; Zaccardi, M L; Traina, G; Calvani, M; Lombardo, P; Scuri, R; Brunelli, M

    2006-11-03

    Acetyl-L-carnitine is a natural molecule widely distributed in vertebrate and invertebrate nervous system. It is known to have significant effects on neuronal activity playing a role as neuroprotective and anti-nociceptive agent, as well as neuromodulatory factor. About its capability of affecting learning processes the available data are controversial. In the present study, we utilized the simplified model system of the leech Hirudo medicinalis to analyze the effects of acetyl-L-carnitine, assessing whether and how it might affect elementary forms of nonassociative learning processes. In leeches with the head ganglion disconnected from the first segmental ganglion, repetitive application of weak electrical shocks onto the caudal portion of the body wall induces habituation of swim induction whereas brush strokes on the dorsal skin produces sensitization or dishabituation when the nociceptive stimulus is delivered on previously habituated animals. Herein, the effects of different concentrations of acetyl-L-carnitine (2 mM - 0.05 mM) have been tested at different times on both sensitization and dishabituation. The results show that a single treatment of acetyl-L-carnitine blocked the onset of sensitization in a dose- and time-dependent manner. In fact, the most effective concentration able to block this process was 2 mM, which induced its major effects 11 days after the treatment, whereas 0.05 mM was unable to affect the sensitization process at all considered time points. On the contrary, acetyl-L-carnitine did not completely abolish dishabituation at the tested concentrations and at every time point. Finally, acetyl-L-carnitine also impaired the habituation of swim induction, but only 11 days after treatment.

  11. On exploration of geometrically constrained space by medicinal leeches Hirudo verbana.

    PubMed

    Adamatzky, Andrew

    2015-04-01

    Leeches are fascinating creatures: they have simple modular nervous circuitry yet exhibit a rich spectrum of behavioural modes. Leeches could be ideal blue-prints for designing flexible soft robots which are modular, multi-functional, fault-tolerant, easy to control, capable for navigating using optical, mechanical and chemical sensorial inputs, have autonomous inter-segmental coordination and adaptive decision-making. With future designs of leech-robots in mind we study how leeches behave in geometrically constrained spaces. Core results of the paper deal with leeches exploring a row of rooms arranged along a narrow corridor. In laboratory experiments we find that rooms closer to ends of the corridor are explored by leeches more often than rooms in the middle of the corridor. Also, in series of scoping experiments, we evaluate leeches capabilities to navigating in mazes towards sources of vibration and chemo-attraction. We believe our results lay foundation for future developments of robots mimicking behaviour of leeches.

  12. Solubilization, molecular forms, purification and substrate specificity of two acetylcholinesterases in the medicinal leech (Hirudo medicinalis).

    PubMed Central

    Talesa, V; Grauso, M; Giovannini, E; Rosi, G; Toutant, J P

    1995-01-01

    Two acetylcholinesterases (AChE) differing in substrate and inhibitor specificities have been characterized in the medical leech (Hirudo medicinalis). A 'spontaneously-soluble' portion of AChE activity (SS-AChE) was recovered from haemolymph and from tissues dilacerated in low-salt buffer. A second portion of AChE activity was obtained after extraction of tissues in low-salt buffer alone or containing 1% Triton X-100 [detergent-soluble (DS-) AChE). Both enzymes were purified to homogeneity by affinity chromatography on edrophonium- and concanavalin A-Sepharose columns. Denaturing SDS/PAGE under reducing conditions gave one band at 30 kDa for purified SS-AChE and 66 kDa for DS-AChE. Sephadex G-200 chromatography indicated a molecular mass of 66 kDa for native SS-AChE and of 130 kDa for DS-AChE. SS-AChE showed a single peak sedimenting at 5.0 S in sucrose gradients with or without Triton X-100, suggesting that it was a hydrophylic monomer (G1). DS-AChE sedimented as a single 6.1-6.5 S peak in the presence of Triton X-100 and aggregated in the absence of detergent. A treatment with phosphatidylinositol-specific phospholipase C suppressed aggregation and gave a 7 S peak. DS-AChE was thus an amphiphilic glycolipid-anchored dimer. Substrate specificities were studied using p-nitrophenyl esters (acetate, propionate and butyrate) and corresponding thiocholine esters as substrates. SS-AChE displayed only limited variations in Km values with charged and uncharged substrates, suggesting a reduced influence of electrostatic interactions in the enzyme substrate affinity. By contrast, DS-AChE displayed higher Km values with uncharged than with charged substrates. SS-AChE was more sensitive to eserine and di-isopropyl fluorophosphate (IC50 5 x 10(-8) and 10(-8) M respectively) than DS-AChE (5 x 10(-7) and 5 x 10(-5) M. Images Figure 2 Figure 3 Figure 4 PMID:7702560

  13. Sodium-magnesium antiport in Retzius neurones of the leech Hirudo medicinalis.

    PubMed Central

    Günzel, D; Schlue, W R

    1996-01-01

    1. Intracellular free magnesium ([Mg2+]i) and sodium ([Na+]i) concentrations were measured in Retzius neurones of the leech Hirudo medicinalis using ion-sensitive microelectrodes. 2. The mean steady-state values for [Mg2+]i and [Na+]i were 0.46 mM (pMg, 3.34 +/- 0.23; range, 0.1-1.2 mM; n = 32) and 8.95 mM (pNa, 2.05 +/- 0.15; range, 5.1-15.5 mM, n = 21), respectively, at a mean membrane potential (Em) of -35.6 +/- 6.1 mV (n = 32). Thus, [Mg2+]i is far below the value calculated for a passive distribution (16.9 mM) but close to the equilibrium value calculated for a hypothetical 1 Na(+)-1 Mg2+ antiport (0.41 mM). 3. Simultaneous measurements of [Mg2+]i, [Na+]i and Em in Retzius neurones showed that an increase in the extracellular Mg2+ concentration ([Mg2+]o) resulted in an increase in [Mg2+]i, a parallel decrease in [Na+]i and a membrane depolarization, while a decrease in [Mg2+]o had opposite effects. These results are compatible with calculations based on a 1 Na(+)-1 Mg2+ antiport. 4. Na+ efflux at high [Mg2+]o still occurred when the Na(+)-K+ pump was inhibited by the application of ouabain or in K(+)-free solutions. This efflux was blocked by amiloride. 5. In the absence of extracellular Na+ ([Na+]o), no Mg2+ influx occurred. Mg2+ influx at high [Mg2+]o was even lower than in the presence of [Na+]o. Mg2+ efflux was blocked in the absence of [Na+]o. 6. The rate of Mg2+ extrusion was reduced by lowering [Na+]o, even if the Na+ gradient across the membrane remained almost unchanged. 7. Mg2+ efflux was blocked by amiloride (half-maximal effect at 0.25 mM amiloride; Hill coefficient, 1.3) but not by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA). 8. No changes in intracellular Ca2+ and pH (pHi) could be detected when [Mg2+]o was varied between 1 and 30 mM. 9. Changing pHi by up to 0.4 pH units had no effect on [Mg2+]i. 10. The results suggest the presence of an electrogenic 1 Na(+)-1 Mg2+ antiport in leech Retzius neurones. This antiport can be reversed and is inhibited

  14. Ultrastructural study of spermatogenesis and sperm in the African medicinal leech Hirudo troctina Johnson, 1816 (Annelida, Hirudinida).

    PubMed

    Ben Ahmed, Raja; Tekaya, Saïda; Urbisz, Anna Z; Świątek, Piotr

    2015-06-01

    This paper presents the process of spermatogenesis in the leech Hirudo troctina Johnson, 1816 using light, fluorescent and transmission electron microscopy. At the onset of spermatogenesis in testes, the pear-shaped spermatogonia divide mitotically without full cytokinesis and as a result isogenic groups are formed (clusters, clones) with 2, 4, 8, 16, 32, 64, 128 spermatogonia and, finally, 256 primary spermatocytes occur. The final meiotic divisions of spermatocytes give rise to clones with 1024 spermatids. There are hundreds of developing germ-line clones in each testis. In each clone, the male germ cells divide in full synchrony and they are in the same phase of spermatogenesis. During complex spermiogenesis each spermatid becomes a filiform spermatozoon with a helicoid nucleus, which is characterized by the presence of a long acrosome with two regions - anterior and posterior, which are followed by a helicoid nucleus, a midpiece with only one mitochondrion and a long flagellum. Our results were compared to those on other clitellate annelids that have been studied to date, especially to sperm formation in Hirudo medicinalis Linnaeus, 1785. Only minor differences were found in the length and the diameter of different organelles and the number of spermatids in germ-line clones.

  15. Symbiosis of Aeromonas veronii Biovar sobria and Hirudo medicinalis, the Medicinal Leech: a Novel Model for Digestive Tract Associations

    PubMed Central

    Graf, Joerg

    1999-01-01

    Hirudo medicinalis, the medicinal leech, is applied postoperatively in modern medicine. Infections by Aeromonas occur in up to 20% of patients unless a preemptive antibiotic treatment is administered. The associated infections demonstrate the need for a better understanding of the digestive tract flora of H. medicinalis. Early studies reported the presence of a single bacterial species in the digestive tract and suggested that these bacteria were endosymbionts contributing to the digestion of blood. In this study, we cultivated bacteria from the digestive tract and characterized them biochemically. The biochemical test results identified the isolates as Aeromonas veronii biovar sobria. This species identification was supported by sequence comparison of a variable region of the genes coding for 16S rRNA. In a colonization assay, a rifampin-resistant derivative of a symbiotic isolate was fed in a blood meal to H. medicinalis. The strain colonized the digestive tract rapidly and reached a concentration similar to that of the native bacterial flora. For the first 12 h, the in vivo doubling time was 1.2 h at 23°C. After 12 h, at a density of 5 × 107 CFU/ml, the increase in viable counts ceased, suggesting a dramatic reduction in the bacterial growth rate. Two human fecal isolates, identified as Aeromonas hydrophila and A. veronii biovar sobria, were also able to colonize the digestive tract. These data demonstrate that the main culturable bacterium in the crop of H. medicinalis is A. veronii biovar sobria and that the medicinal leech can be used as a model for digestive tract association of Aeromonas species. PMID:9864188

  16. Effects of 5-hydroxytryptamine on the dorsal muscle of the leech (hirudo medicinalis)

    PubMed Central

    Schain, R. J.

    1961-01-01

    5-Hydroxytryptamine has an inhibiting effect on the leech muscle. It reduces the contractions produced by acetylcholine or nicotine and accelerates the relaxation of the muscle when these substances are washed out. This acceleration of relaxation allows a more rapid assay of acetylcholine in this preparation. PMID:13747232

  17. Mucinivorans hirudinis gen. nov., sp. nov., an anaerobic, mucin-degrading bacterium isolated from the digestive tract of the medicinal leech Hirudo verbana

    PubMed Central

    Nelson, Michael C.; Bomar, Lindsey; Maltz, Michele

    2015-01-01

    Three anaerobic bacterial strains were isolated from the digestive tract of the medicinal leech Hirudo verbana, using mucin as the primary carbon and energy source. These strains, designated M3T, M4 and M6, were Gram-stain-negative, non-spore-forming and non-motile. Cells were elongated bacilli approximately 2.4 µm long and 0.6 µm wide. Growth only occurred anaerobically under mesophilic and neutral pH conditions. All three strains could utilize multiple simple and complex sugars as carbon sources, with glucose fermented to acid by-products. The DNA G+C contents of strains M3T, M4 and M6 were 44.9, 44.8 and 44.8 mol%, respectively. The major cellular fatty acid of strain M3T was iso-C15 : 0. Phylogenetic analysis of full-length 16S rRNA gene sequences revealed that the three strains shared >99 % similarity with each other and represent a new lineage within the family Rikenellaceae of the order Bacteroidales, phylum Bacteroidetes. The most closely related bacteria to strain M3T based on 16S rRNA gene sequences were Rikenella microfusus DSM 15922T (87.3 % similarity) and Alistipes finegoldii AHN 2437T (87.4 %). On the basis of phenotypic, genotypic and physiological evidence, strains M3T, M4 and M6 are proposed as representing a novel species of a new genus within the family Rikenellaceae, for which the name Mucinivorans hirudinis gen. nov., sp. nov. is proposed. The type strain of Mucinivorans hirudinis is M3T ( = ATCC BAA-2553T = DSM 27344T). PMID:25563920

  18. Reciprocal immune benefit based on complementary production of antibiotics by the leech Hirudo verbana and its gut symbiont Aeromonas veronii

    PubMed Central

    Tasiemski, Aurélie; Massol, François; Cuvillier-Hot, Virginie; Boidin-Wichlacz, Céline; Roger, Emmanuel; Rodet, Franck; Fournier, Isabelle; Thomas, Frédéric; Salzet, Michel

    2015-01-01

    The medicinal leech has established a long-term mutualistic association with Aeromonas veronii, a versatile bacterium which can also display free-living waterborne and fish- or human-pathogenic lifestyles. Here, we investigated the role of antibiotics in the dynamics of interaction between the leech and its gut symbiont Aeromonas. By combining biochemical and molecular approaches, we isolated and identified for the first time the antimicrobial peptides (AMPs) produced by the leech digestive tract and by its symbiont Aeromonas. Immunohistochemistry data and PCR analyses evidenced that leech AMP genes are induced in the gut epithelial cells when Aeromonas load is low (starved animals), while repressed when Aeromonas abundance is the highest (post blood feeding). The asynchronous production of AMPs by both partners suggests that these antibiotic substances (i) provide them with reciprocal protection against invasive bacteria and (ii) contribute to the unusual simplicity of the gut microflora of the leech. This immune benefit substantially reinforces the evidence of an evolutionarily stable association between H. verbana and A. veronii. Altogether these data may provide insights into the processes making the association with an Aeromonas species in the digestive tract either deleterious or beneficial. PMID:26635240

  19. Reciprocal immune benefit based on complementary production of antibiotics by the leech Hirudo verbana and its gut symbiont Aeromonas veronii.

    PubMed

    Tasiemski, Aurélie; Massol, François; Cuvillier-Hot, Virginie; Boidin-Wichlacz, Céline; Roger, Emmanuel; Rodet, Franck; Fournier, Isabelle; Thomas, Frédéric; Salzet, Michel

    2015-12-04

    The medicinal leech has established a long-term mutualistic association with Aeromonas veronii, a versatile bacterium which can also display free-living waterborne and fish- or human-pathogenic lifestyles. Here, we investigated the role of antibiotics in the dynamics of interaction between the leech and its gut symbiont Aeromonas. By combining biochemical and molecular approaches, we isolated and identified for the first time the antimicrobial peptides (AMPs) produced by the leech digestive tract and by its symbiont Aeromonas. Immunohistochemistry data and PCR analyses evidenced that leech AMP genes are induced in the gut epithelial cells when Aeromonas load is low (starved animals), while repressed when Aeromonas abundance is the highest (post blood feeding). The asynchronous production of AMPs by both partners suggests that these antibiotic substances (i) provide them with reciprocal protection against invasive bacteria and (ii) contribute to the unusual simplicity of the gut microflora of the leech. This immune benefit substantially reinforces the evidence of an evolutionarily stable association between H. verbana and A. veronii. Altogether these data may provide insights into the processes making the association with an Aeromonas species in the digestive tract either deleterious or beneficial.

  20. A large fragment approach to DNA synthesis: total synthesis of a gene for the protease inhibitor eglin c from the leech Hirudo medicinalis and its expression in E. coli.

    PubMed Central

    Rink, H; Liersch, M; Sieber, P; Meyer, F

    1984-01-01

    A DNA containing the coding sequence for the proteinase inhibitor protein, eglin c, from the leech Hirudo medicinalis has been obtained by enzymatic assembly of chemically synthesized DNA fragments. The synthetic gene consists of a 232 base-pair fragment containing initiation and termination codon signals with restriction enzyme recognition sites conveniently placed for cloning into a plasmid vector. Only six oligonucleotides from 34 to 61 bases in length, sharing pairwise stretches of complementary regions at their 3'-termini, were prepared by phosphotriester solid-phase synthesis. The oligomers were annealed pairwise and converted into double stranded DNA fragments by DNA polymerase I mediated repair synthesis. The fragments were assembled by ligation, and the synthetic gene was expressed in high yield in E. coli under the transcriptional control of the E. coli tryptophan promoter. The expression product was purified to homogeneity and was shown to have similar physicochemical and identical biological properties as the authentic protein isolated from the leech. Images PMID:6382168

  1. Role of the tissue free amino acids in adaptation of medicinal leeches Hirudo medicinalis L., 1758 to extreme climatic conditions.

    PubMed

    Chernaya, L V; Kovalchuk, L A; Nokhrina, E S

    2016-01-01

    The first comparison of the spectra of free amino acids in tissues of the medicinal leeches H. medicinalis from different climatic and geographical Eurasian areas has been performed. Adaptation of H. medicinalis to extreme climatic conditions occurs via intensification of the amino acid metabolism resulting from a significant increase in the content of essential amino acids. Accumulation of arginine, histidine, and lysine (3.6-, 3.9-, and 2.0-fold increases, respectively) has proved to play a special protective role in adaptation of H. medicinalis to the low positive temperatures.

  2. Ionotropic and metabotropic activation of a neuronal chloride channel by serotonin and dopamine in the leech Hirudo medicinalis

    PubMed Central

    Ali, Declan W; Catarsi, Stefano; Drapeau, Pierre

    1998-01-01

    Cl− channels on the pressure-sensitive (P) neuron in the leech are directly activated by synaptic release of serotonin (5-HT) and are indirectly stimulated by the cAMP second messenger pathway, suggesting an unusual dual regulation of the channels. We have investigated the mode of action of 5-HT and dopamine (DA) on a Cl− channel in adult P cells in culture by recording from cell-attached patches.5-HT increased Cl− channel activity only when included in the recording pipette and not when applied in the bath.Pipette or, more effectively, bath application of DA led to an increase in Cl− channel activity. This effect was blocked by the potent and specific dopaminergic (DA1) receptor blocker, SCH-23390.The stimulation by DA, but not by 5-HT, was also blocked by the cAMP-dependent protein kinase A (PKA) inhibitor Rp-cAMP and was mimicked by the membrane-permeant cAMP analogue dibutyryl cAMP (db-cAMP).Our results show that 5-HT directly gates a Cl− channel that is also activated by DA via the cAMP pathway. This study demonstrates that a ligand-gated channel can be independently operated by another transmitter acting via a second messenger pathway. PMID:9547394

  3. Detection and selective avoidance of near ultraviolet radiation by an aquatic annelid: the medicinal leech.

    PubMed

    Jellies, John

    2014-03-15

    Medicinal leeches are aquatic predators that inhabit surface waters during daylight and also leave the water where they might be exposed to less screened light. Whereas the leech visual system has been shown to respond to visible light, leeches in the genus Hirudo do not appear to be as negatively phototactic as one might expect in order to avoid potential ultraviolet radiation (UVR)-induced damage. I used high intensity light emitting diodes to test the hypothesis that leeches could detect and specifically avoid near UVR (395-405 nm). Groups of unfed juvenile leeches exhibited a robust negative phototaxis to UVR, but had no behavioral response to blue or red and only a slight negative phototaxis to green and white light. Individual leeches also exhibited a vigorous negative phototaxis to UVR; responding in 100% of trials compared with modest negative responses to visible light (responding in ~8% of the trials). The responses in fed and unfed leeches were comparable for UVR stimuli. The responses depended upon the stimulus site: leeches shortened away from UV light to the head, and extended away from UV light to the tail. Electrophysiological nerve recordings showed that the cephalic eyes responded vigorously to UVR. Additionally, individual leech photoreceptors also showed strong responses to UVR, and a higher-order neuron associated with shortening and rapid behavioral responses, the S-cell, was activated by UVR, on both the head and tail. These results demonstrate that the leech can detect UVR and is able to discriminate behaviorally between UVR and visible light.

  4. Detection and selective avoidance of near ultraviolet radiation by an aquatic annelid: the medicinal leech

    PubMed Central

    Jellies, John

    2014-01-01

    Medicinal leeches are aquatic predators that inhabit surface waters during daylight and also leave the water where they might be exposed to less screened light. Whereas the leech visual system has been shown to respond to visible light, leeches in the genus Hirudo do not appear to be as negatively phototactic as one might expect in order to avoid potential ultraviolet radiation (UVR)-induced damage. I used high intensity light emitting diodes to test the hypothesis that leeches could detect and specifically avoid near UVR (395–405 nm). Groups of unfed juvenile leeches exhibited a robust negative phototaxis to UVR, but had no behavioral response to blue or red and only a slight negative phototaxis to green and white light. Individual leeches also exhibited a vigorous negative phototaxis to UVR; responding in 100% of trials compared with modest negative responses to visible light (responding in ~8% of the trials). The responses in fed and unfed leeches were comparable for UVR stimuli. The responses depended upon the stimulus site: leeches shortened away from UV light to the head, and extended away from UV light to the tail. Electrophysiological nerve recordings showed that the cephalic eyes responded vigorously to UVR. Additionally, individual leech photoreceptors also showed strong responses to UVR, and a higher-order neuron associated with shortening and rapid behavioral responses, the S-cell, was activated by UVR, on both the head and tail. These results demonstrate that the leech can detect UVR and is able to discriminate behaviorally between UVR and visible light. PMID:24265432

  5. Systematics of the freshwater leech genus Hirudinaria Whitman, 1886 (Arhynchobdellida, Hirudinidae) from northeastern Thailand

    PubMed Central

    Tubtimon, Jaruwan; Jeratthitikul, Ekgachai; Sutcharit, Chirasak; Kongim, Bangon; Panha, Somsak

    2014-01-01

    Abstract In total, 435 specimens of the Southeast Asian freshwater leech species within the Hirudinidae family were collected from 17 locations of various types of aquatic habitats in northeastern Thailand. They were all morphologically placed within the genus Hirudinaria Whitman, 1886 and there were three distinct species: the common Hirudinaria manillensis, 78.2% of all collected specimens and at all 17 locations, Hirudinaria javanica at 20.3% of collected samples and from five locations and a rarer unidentified morphospecies (Hirudinaria sp.) with six samples from only two locations. The karyotypes of these three species were examined across their range in this study area for 38, 11 and 6 adult specimens of Hirudinaria manillensis, Hirudinaria javanica and Hirudinaria sp., respectively. This revealed different chromosome numbers among all three species, with Hirudinaria javanica having n = 13, 2n = 26, Hirudinaria manillensis lacked one small chromosome pair with n = 12, 2n = 24, and the unknown Hirudinaria sp. differed from any known Hirudinaria karyotypes in exhibiting a higher chromosome number (n = 14, 2n = 28) and a gradual change in size from large to small chromosomes. This suggests that the unknown Hirudinaria sp. is a new biological species. However, phylogenetic analysis based upon a 658 bp fragment of the cytochrome oxidase subunit I gene placed this unknown morphospecies within the Hirudinaria manillensis clade, perhaps then suggesting a recent sympatric speciation, although this requires further confirmation. Regardless, the chromosomes of all three species were asymmetric, most with telocentric elements. A distinct bi-armed chromosome marker was present on the first chromosome pair in Hirudinaria javanica, whilst it was on pairs 1, 2, 3 and 5 in Hirudinaria manillensis, and on pairs 3 and 5 for the unknown Hirudinaria sp. PMID:25493052

  6. External decontamination of wild leeches with hypochloric acid

    PubMed Central

    Aydin, Atakan; Nazik, Hasan; Kuvat, Samet Vasfi; Gurler, Nezahat; Ongen, Betigul; Tuncer, Serdar; Hocaoglu, Emre; Kesim, Sinan Nur

    2004-01-01

    Background Medicinal leech, Hirudo medicinalis, has been used in plastic and reconstructive surgery, to relieve venous congestion and to improve the microrevascularization of flaps. In many countries, wild leeches are still provided from local markets and utilised with antibiotic prophylaxies. In this research, results of identification of bacteria in the transport fluid is reported, oral and intestinal floras and the antibiograms of the identified microorganisms are investigated. Also, to avoid possible infections, the ability of hypochloric acid, a disinfectant, to suppress the relevant microorganisms without changing the life style and behavior of leeches in terms of sucking function, is investigated. Methods Bacterial identifications and antibiograms of oral and intestinal flora and transport medium were performed for 10 leeches. The optimum concentration of hypochloric acid which eliminated microorganisms without affecting the viability and sucking function of the leeches were determined by dilution of hypochloric acid to 100, 50, 25, 12.5, 6.25 ppm concentrations in different groups of 25 leeches. Finally, 20 leeches were applied atraumatically to the bleeding areas of rats, the duration of suction was determined and compared statistically between the leeches treated and not treated with hypochloric acid solution. Results Aeromonas hydrophilia was the most commonly identified microorganism and found to be resistant to first generation cephalosporins, frequently used in prophylaxis at surgical wards. In the next stages of the study, the leeches were subjected to a series of diluted hypochloric acid solutions. Although disinfection of the transport material and suppression of the oral flora of hirudo medicinalis were successful in 100, 50, 25, 12.5, 6.25 ppm concentrations; 12.5 ppm solution was the greatest concentration in which hirudo medicinalis could survive and sucking function was not affected significantly. Conclusions External decontamination of wild

  7. Host Matters: Medicinal Leech Digestive-Tract Symbionts and Their Pathogenic Potential

    PubMed Central

    Marden, Jeremiah N.; McClure, Emily A.; Beka, Lidia; Graf, Joerg

    2016-01-01

    Digestive-tract microbiota exert tremendous influence over host health. Host-symbiont model systems are studied to investigate how symbioses are initiated and maintained, as well as to identify host processes affected by resident microbiota. The medicinal leech, Hirudo verbana, is an excellent model to address such questions owing to a microbiome that is consistently dominated by two species, Aeromonas veronii and Mucinivorans hirudinis, both of which are cultivable and have sequenced genomes. This review outlines current knowledge about the dynamics of the H. verbana microbiome. We discuss in depth the factors required for A. veronii colonization and proliferation in the leech crop and summarize the current understanding of interactions between A. veronii and its annelid host. Lastly, we discuss leech usage in modern medicine and highlight how leech-therapy associated infections, often attributable to Aeromonas spp., are of growing clinical concern due in part to an increased prevalence of fluoroquinolone resistant strains. PMID:27790190

  8. Microsurgical replantation and postoperative leech treatment of a large severed nasal segment.

    PubMed

    Stemann Andersen, Peter; Elberg, Jens Jørgen

    2012-12-01

    The survival of a microsurgically replanted segment of nose in a 41-year-old woman was facilitated by the assistance of the medicinal leech Hirudo medicinalis. An arterial microanastomosis was made to a severed partial segment of nose with no possibility of recreating a venous anastomosis. The resulting venous congestion was treated with nine days of treatment with a medical leech until venous neovascularisation had been achieved. At follow-up six months after discharge there was a well-heeled nasal segment and a satisfying functional - as well as cosmetic - result.

  9. Annelida, Euhirudinea (leeches)

    EPA Science Inventory

    Worldwide, there are over 600 species of leeches described which occur in freshwater, marine, estuarine, and moist-terrestrial ecosystems. Leeches are included in the Class Clitellata, Subclass Hirudinida, and Superorder Euhirudinea. Seven of the ten families of leeches occur in...

  10. Nanocoax neurointerface array recordings of Hirudo medicinalis neurons

    NASA Astrophysics Data System (ADS)

    Naughton, Jeffrey R.; Rizal, Binod; Aasen, Margaret H.; Burns, Michael J.; Chiles, Thomas C.; Naughton, Michael J.

    2014-03-01

    We report results for a nanocoax-based neuroelectronic array. The device was used in real time to noninvasively couple to a ganglion sac located along the main nerve cord of the leech Hirudo medicinalis. This allowed for extracellular recording of synaptic activity in the form of spontaneous synapse firing in pre- and post-synaptic somata. In addition, we show the ability to actuate localized stimulation (Faradaic regime) which, in some circumstances, appears to facilitate electroporation, which itself enables intracellular measurements. In conjunction with this latter recording with one subarray, we measured changes in the local field potential (extracellular) with another array at a second site, allowing us to calculate the action potential propagation or conduction speed. This work is supported by the Boston College Institute on Aging.

  11. Leech Therapeutic Applications

    PubMed Central

    Abdualkader, A. M.; Ghawi, A. M.; Alaama, M.; Awang, M.; Merzouk, A.

    2013-01-01

    Hematophagous animals including leeches have been known to possess biologically active compounds in their secretions, especially in their saliva. The blood-sucking annelids, leeches have been used for therapeutic purposes since the beginning of civilization. Ancient Egyptian, Indian, Greek and Arab physicians used leeches for a wide range of diseases starting from the conventional use for bleeding to systemic ailments, such as skin diseases, nervous system abnormalities, urinary and reproductive system problems, inflammation, and dental problems. Recently, extensive researches on leech saliva unveiled the presence of a variety of bioactive peptides and proteins involving antithrombin (hirudin, bufrudin), antiplatelet (calin, saratin), factor Xa inhibitors (lefaxin), antibacterial (theromacin, theromyzin) and others. Consequently, leech has made a comeback as a new remedy for many chronic and life-threatening abnormalities, such as cardiovascular problems, cancer, metastasis, and infectious diseases. In the 20th century, leech therapy has established itself in plastic and microsurgery as a protective tool against venous congestion and served to salvage the replanted digits and flaps. Many clinics for plastic surgery all over the world started to use leeches for cosmetic purposes. Despite the efficacious properties of leech therapy, the safety, and complications of leeching are still controversial. PMID:24019559

  12. 3H-GABA uptake selectively labels identifiable neurons in the leech central nervous system

    SciTech Connect

    Cline, H.T.

    1983-04-10

    Segmental ganglia of the leech ventral nerve cord synthesize the neurotransmitter gamma-aminobutyric acid (GABA) when incubated in the presence of the precursor glutamate, suggesting that there may be GABA-ergic neurons in the leech nerve cord. GABA-accumulating neurons of the two taxonomically distant leech species, Haementeria ghilianii and Hirudo medicinalis, have been labeled by taking advantage of their high-affinity uptake system for the neurotransmitter. Autoradiography of sectioned segmental ganglia previously exposed to 3H-GABA reveals a reproducible pattern of about thirty 3H-GABA-labeled neuronal cell bodies per ganglion. The majority of 3H-GABA-labeled neuronal cell bodies are bilaterally paired, although some apparently unpaired cell bodies also accumulate label. Neuronal processes were reproducibly labeled by GABA uptake and could be traced in the neuropil through commissures and fiber tracts into the segmental nerve roots and interganglionic connectives, respectively.

  13. Differentially Expressed Genes in Hirudo medicinalis Ganglia after Acetyl-L-Carnitine Treatment

    PubMed Central

    Federighi, Giuseppe; Macchi, Monica; Bernardi, Rodolfo; Scuri, Rossana; Brunelli, Marcello; Durante, Mauro; Traina, Giovanna

    2013-01-01

    Acetyl-l-carnitine (ALC) is a naturally occurring substance that, when administered at supra-physiological concentration, is neuroprotective. It is involved in membrane stabilization and in enhancement of mitochondrial functions. It is a molecule of considerable interest for its clinical application in various neural disorders, including Alzheimer’s disease and painful neuropathies. ALC is known to improve the cognitive capability of aged animals chronically treated with the drug and, recently, it has been reported that it impairs forms of non-associative learning in the leech. In the present study the effects of ALC on gene expression have been analyzed in the leech Hirudo medicinalis. The suppression subtractive hybridisation methodology was used for the generation of subtracted cDNA libraries and the subsequent identification of differentially expressed transcripts in the leech nervous system after ALC treatment. The method detects differentially but also little expressed transcripts of genes whose sequence or identity is still unknown. We report that a single administration of ALC is able to modulate positively the expression of genes coding for functions that reveal a lasting effect of ALC on the invertebrate, and confirm the neuroprotective and neuromodulative role of the substance. In addition an important finding is the modulation of genes of vegetal origin. This might be considered an instance of ectosymbiotic mutualism. PMID:23308261

  14. Test of a life support system with Hirudo medicinalis in a sounding rocket.

    PubMed

    Lotz, R G; Baum, P; Bowman, G H; Klein, K D; von Lohr, R; Schrotter, L

    1972-01-01

    Two Nike-Tomahawk rockets each carrying two Biosondes were launched from Wallops Island, Virginia, the first on 10 December 1970 and the second on 16 December 1970. The primary objective of both flights was to test the Biosonde life support system under a near weightless environment and secondarily to subject the Hirudo medicinalis to the combined stresses of a rocket flight. The duration of the weightless environment was approximately 6.5 minutes. Data obtained during the flight by telemetry was used to ascertain the operation of the system and the movements of the leeches during flight. Based on the information obtained, it has been concluded that the operation of the Biosondes during the flight was similar to that observed in the laboratory. The experiment and equipment are described briefly and the flight results presented.

  15. Developmental biology of the leech Helobdella

    PubMed Central

    WEISBLAT, DAVID A.; KUO, DIAN-HAN

    2015-01-01

    Glossiphoniid leeches of the genus Helobdella provide experimentally tractable models for studies in evolutionary developmental biology (Evo-Devo). Here, after a brief rationale, we will summarize our current understanding of Helobdella development and highlight the near term prospects for future investigations, with respect to the issues of: D quadrant specification; the transition from spiral to bilaterally symmetric cleavage; segmentation, and the connections between segmental and non-segmental tissues; modifications of BMP signaling in dorsoventral patterning and the O-P equivalence group; germ line specification and genome rearrangements. The goal of this contribution is to serve as a summary of, and guide to, published work. PMID:25690960

  16. Ocular leech infestation

    PubMed Central

    Lee, Yueh-Chang; Chiu, Cheng-Jen

    2015-01-01

    This case report describes a female toddler with manifestations of ocular leech infestation. A 2-year-old girl was brought to our outpatient clinic with a complaint of irritable crying after being taken to a stream in Hualien 1 day previous, where she played in the water. The parents noticed that she rubbed her right eye a lot. Upon examination, the girl had good fix and follow in either eye. Slit-lamp examination showed conjunctival injection with a moving dark black–brown foreign body partly attached in the lower conjunctiva. After applying topical anesthetics, the leech, measuring 1 cm in length, was extracted under a microscope. The patient began using topical antibiotic and corticosteroid agents. By 1 week after extraction, the patient had no obvious symptoms or signs, except for a limited subconjunctival hemorrhage, and no corneal/scleral involvement was observed. PMID:25784786

  17. Satellite stabilization using space leeches

    NASA Technical Reports Server (NTRS)

    Walker, Michael W.; Kim, Dong-Min

    1990-01-01

    A control algorithm for satellite stabilization using a space leech is presented. The space leech is assumed to have n reaction wheels with known moments of inertia about their axis of rotation. All mass properties of the satellite are assumed to be unknown. The algorithm brings the satellite to a specified attitude trajectory. Simulations were performed to demonstrate the controller. The model parameters and specific algorithm used and the results obtained are presented.

  18. LEECHES (ANNELIDA: EUHIRUDINEA) OF NORTHERN ARKANSAS

    EPA Science Inventory

    Twenty-one lotic and lentic environments throughout central and northern Arkansas were surveyed for the presence of leeches during June 2004, and April, July - October, 2005. Fourteen species of leeches (Desserobdella cryptobranchii, Desserobdella phalera, Desserobdella picta, H...

  19. Physical methods for generating and decoding neural activity in Hirudo verbana

    NASA Astrophysics Data System (ADS)

    Migliori, Benjamin John

    The interface between living nervous systems and hardware is an excellent proving ground for precision experimental methods and information classification systems. Nervous systems are complex (104 -- 10 15(!) connections), fragile, and highly active in intricate, constantly evolving patterns. However, despite the conveniently electrical nature of neural transmission, the interface between nervous systems and hardware poses significant experimental difficulties. As the desire for direct interfaces with neural signals continues to expand, the need for methods of generating and measuring neural activity with high spatiotemporal precision has become increasingly critical. In this thesis, I describe advances I have made in the ability to modify, generate, measure, and understand neural signals both in- and ex-vivo. I focus on methods developed for transmitting and extracting signals in the intact nervous system of Hirudo verbana (the medicinal leech), an animal with a minimally complex nervous system (10000 neurons distributed in packets along a nerve cord) that exhibits a diverse array of behaviors. To introduce artificial activity patterns, I developed a photothermal activation system in which a highly focused laser is used to irradiate carbon microparticles in contact with target neurons. The resulting local temperature increase generates an electrical current that forces the target neuron to fire neural signals, thereby providing a unique neural input mechanism. These neural signals can potentially be used to alter behavioral choice or generate specific behavioral output, and can be used endogenously in many animal models. I also describe new tools developed to expand the application of this method. In complement to this input system, I describe a new method of analyzing neural output signals involved in long-range coordination of behaviors. Leech behavioral signals are propagated between neural packets as electrical pulses in the nerve connective, a bundle of

  20. Acetyl-l-carnitine prevents serotonin-induced behavioural sensitization and dishabituation in Hirudo medicinalis.

    PubMed

    Traina, Giovanna; Ristori, Chiara; Brunelli, Marcello; Scuri, Rossana

    2013-09-15

    Several studies suggest that acetyl-l-carnitine (ALC) might influence learning processes. Along this line of investigation, we have previously shown that ALC impaired sensitization and dishabituation induced by nociceptive stimulation of the dorsal skin of the leech Hirudo medicinalis, in the behavioural paradigm of the swim induction (SI). In previous works we showed that 5HT was involved in both sensitization and dishabituation of SI acting through the second messenger cAMP. In this work, we have reported that for given doses and temporal ranges ALC was able to block sensitization and to impair dishabituation mimicked by the injection of 5-HT or 8Br-cAMP, a membrane permeable analogue of cAMP. Our results show that a single treatment with 2mM ALC was the most effective concentration to block the onset of sensitization induced by 5-HT injection and its major effects occurred 11 days after ALC treatment. 2mM ALC also blocked sensitization induced by 8Br-cAMP injection, whereas, ALC did not completely abolish dishabituation induced by 5-HT or 8Br-cAMP injection at the tested concentrations and at every time point.

  1. Effects of Carbon Nanotube Environmental Dispersion on an Aquatic Invertebrate, Hirudo medicinalis.

    PubMed

    Girardello, Rossana; Tasselli, Stefano; Baranzini, Nicolò; Valvassori, Roberto; de Eguileor, Magda; Grimaldi, Annalisa

    2015-01-01

    The recent widespread applications of nanomaterials, because of their properties, opens new scenarios that affect their dispersal in the environment. In particular multiwall carbon nanotubes (MWCNTs), despite their qualities, seem to be harmful for animals and humans. To evaluate possible toxic effects caused by carbon nanotube environmental dispersion, with regard to aquatic compartment, we proposed as experimental model a freshwater invertebrate: Hirudo medicinalis. In the present study we analyse acute and chronic immune responses over a short (1, 3, 6 and 12 hours) and long time (from 1 to 5 weeks) exposure to MWCNTs by optical, electron and immunohistochemical approaches. In the exposed leeches angiogenesis and fibroplasia accompanied by massive cellular migration occur. Immunocytochemical characterization using specific markers shows that in these inflammatory processes the monocyte-macrophages (CD45+, CD68+) are the most involved cells. These immunocompetent cells are characterized by sequence of events starting from the expression of pro-inflammatory cytokines (in particular IL-18), and amyloidogenensis. Our combined experimental approaches, basing on high sensitive inflammatory response can highlight adverse effects of nanomaterials on aquatic organisms and could be useful to assess the MWCNTs impact on aquatic, terrestrial animal and human health.

  2. Effects of Carbon Nanotube Environmental Dispersion on an Aquatic Invertebrate, Hirudo medicinalis

    PubMed Central

    Girardello, Rossana; Tasselli, Stefano; Baranzini, Nicolò; Valvassori, Roberto; de Eguileor, Magda; Grimaldi, Annalisa

    2015-01-01

    The recent widespread applications of nanomaterials, because of their properties, opens new scenarios that affect their dispersal in the environment. In particular multiwall carbon nanotubes (MWCNTs), despite their qualities, seem to be harmful for animals and humans. To evaluate possible toxic effects caused by carbon nanotube environmental dispersion, with regard to aquatic compartment, we proposed as experimental model a freshwater invertebrate: Hirudo medicinalis. In the present study we analyse acute and chronic immune responses over a short (1, 3, 6 and 12 hours) and long time (from 1 to 5 weeks) exposure to MWCNTs by optical, electron and immunohistochemical approaches. In the exposed leeches angiogenesis and fibroplasia accompanied by massive cellular migration occur. Immunocytochemical characterization using specific markers shows that in these inflammatory processes the monocyte-macrophages (CD45+, CD68+) are the most involved cells. These immunocompetent cells are characterized by sequence of events starting from the expression of pro-inflammatory cytokines (in particular IL-18), and amyloidogenensis. Our combined experimental approaches, basing on high sensitive inflammatory response can highlight adverse effects of nanomaterials on aquatic organisms and could be useful to assess the MWCNTs impact on aquatic, terrestrial animal and human health. PMID:26636582

  3. [Design of an electronic leech].

    PubMed

    Lomelí-Mejía, Pedro Alejandro; Domínguez-Rubio, René; Espinosa-Gutiérrez, Alejandro; Lecona-Butrón, Hugo; Rodríguez-Reyna, Reynaldo Manuel

    2014-07-01

    This research presents the development of a continual suction electromechanical device (CSED) which emulates the feeding characteristics of a medicinal leech to drain body fluids. After the research, design and building of the device, its performance in normal conditions with fluids of different viscosity was evaluated. Finally, the device was submitted to a test of blood draining in three adult male rabbits NZW with a weight of three kilograms, obtaining drain.

  4. Leeches run cold, then hot

    PubMed Central

    Petersen, Ann M.; Chin, Wendy; Feilich, Kara L.; Jung, Grace; Quist, Jessica L.; Wang, Jasmine; Ellerby, David J.

    2011-01-01

    Food processing is costly, potentially limiting the energy and time devoted to other essential functions such as locomotion or reproduction. In ectotherms, post-prandial thermophily, the selection of a warm environmental temperature after feeding, may be advantageous in minimizing the duration of this elevated cost. Although present in many vertebrate taxa, this behaviour had not previously been observed in invertebrates. Sanguivorous leeches ingest large blood meals that are costly to process and limit mobility until excess fluid can actively be expelled to reduce body volume. When presented with a temperature gradient from 10°C to 30°C, leeches select a temperature that is significantly warmer (24.3 ± 0.9°C, n = 6) than their acclimation temperature (Ta, 21°C). Unfed leeches preferred temperatures that were significantly cooler than ambient (12.8 ± 0.9°C, n = 6). This behavioural strategy is consistent with minimizing the time course of elevated post-feeding energy costs and reducing energy expenditure during fasting. Our observations raise the possibility that thermoregulatory behaviour of this type is an unrecognized feature of other invertebrate taxa. PMID:21551223

  5. Ciprofloxacin-resistant Aeromonas hydrophila cellulitis following leech therapy.

    PubMed

    Giltner, Carmen L; Bobenchik, April M; Uslan, Daniel Z; Deville, Jaime G; Humphries, Romney M

    2013-04-01

    We report a case of surgical site infection with ciprofloxacin-resistant Aeromonas hydrophila following leech therapy. Antimicrobial and genetic analyses of leech and patient isolates demonstrated that the resistant isolates originated from the leech gut microbiota. These data suggest that ciprofloxacin monotherapy as a prophylaxis regimen prior to leech therapy may not be effective in preventing infection.

  6. Ciprofloxacin-Resistant Aeromonas hydrophila Cellulitis following Leech Therapy

    PubMed Central

    Giltner, Carmen L.; Bobenchik, April M.; Uslan, Daniel Z.; Deville, Jaime G.

    2013-01-01

    We report a case of surgical site infection with ciprofloxacin-resistant Aeromonas hydrophila following leech therapy. Antimicrobial and genetic analyses of leech and patient isolates demonstrated that the resistant isolates originated from the leech gut microbiota. These data suggest that ciprofloxacin monotherapy as a prophylaxis regimen prior to leech therapy may not be effective in preventing infection. PMID:23363826

  7. Genetic variation in Whitmania pigra, Hirudo nipponica and Poecilobdella manillensis, three endemic and endangered species in China using SSR and TRAP markers.

    PubMed

    Liu, Fei; Guo, Qiao-Sheng; Shi, Hong-Zhuan; Cheng, Bo-Xing; Lu, Yu-Xi; Gou, Ling; Wang, Jia; Shen, Wen-Biao; Yan, Shi-Meng; Wu, Man-Jun

    2016-04-01

    Leeches are not only important medicinal animals worldwide but also are endangered. We aimed to (i) explore the level of genetic diversity within/among populations of three leeches, (ii) assess genetic differentiation among these three leeches, and (iii) discuss an appropriate strategy for conserving leech germplasm. A total of 315 individuals of Whitmania pigra, Hirudo nipponica and Poecilobdella manillensis from 21 populations were collected in China and Vietnam. The genetic structure and genetic diversity among and within the 21 populations were evaluated using target region amplified polymorphism (TRAP) and simple sequence repeat (SSR) markers. Sixteen pairs of TRAP primers generated a total of 398 fragments, of which 396 (99.50%) were polymorphic; fourteen pairs of SSR primers generated a total of 60 fragments, of which 59 (98.33%) were polymorphic. Shannon's index (I) and Nei's gene diversity index (H) for the three leeches were high at the species level (I=0.4980 and H=0.3323 for TRAPs, I=0.4487 and H=0.2969 for SSRs in W. pigra; I=0.4147/0.3769, H=0.2788/0.2566 for H. nipponica; and I=0.4616/0.4717, H=0.3099/0.3203 for P. manillensis). However, low genetic diversity was determined at the population level; the average genetic diversity measures within populations were H=0.1767/0.1376, I=0.2589/0.2043 for W. pigra, H=0.2149/0.2021, I=0.3184/0.3000 for H. nipponica and H=0.2850/0.2724, I=0.4152/0.3967 for P. manillensis. We conclude that there was limited gene exchange within/among populations and species, as the gene flow number (Nm) was 0.5493/0.5807. However, for all three species, the genetic diversity was different at the population level. Gene differentiation (Gst) and Nm were 0.4682 /0.5364 and 0.5678/0.4321 for W. pigra, 0.2294/0.2127 and 1.6797/1.8512 for H. nipponica and 0.1214/0.1496 and 3.6202/2.8412 for P. manillensis. STRUCTURE analysis, Unweighted Pair-Group Method with Arithmetic means (UPGMA) cluster analysis and Principal Coordinates Analysis

  8. New species of rhynchobdellid leech (Hirudinea: Glossiphoniidae): a parasite of turtles from Chiapas, Mexico.

    PubMed

    López-Jiménez, Serapio; Oceguera-Figueroa, Alejandro

    2009-12-01

    A new species of rhynchobdellid leech, Placobdella ringueleti n. sp., is described based on the examination of 25 specimens. Leeches were collected from body appendages of freshwater turtles (Kinosternon leucostomum, Dermatemys mawii, and Staurotypus triporcatus ) from Chiapas, Mexico. The new species resembles other members of the genus in the ocular morphology, bilobated ovaries, and presence of 1 pair of elongated mycetomes, but it is distinguished from them by the dorsal papillar pattern, by having a continuous longitudinal mid-dorsal stripe along the dorsal surface and papillae on the dorsal surface of the posterior sucker. Placobdella ringueleti represents the third species of the genus in Mexico. The type locality of the new species is part of the “El Ocote” Biosphere Reserve, Chiapas, Mexico.

  9. The type II secretion system is essential for erythrocyte lysis and gut colonization by the leech digestive tract symbiont Aeromonas veronii.

    PubMed

    Maltz, Michele; Graf, Joerg

    2011-01-01

    Hemolysin and the type II secretion system (T2SS) have been shown to be important for virulence in many pathogens, but very few studies have shown their importance in beneficial microbes. Here, we investigated the importance of the type II secretion pathway in the beneficial digestive-tract association of Aeromonas veronii and the medicinal leech Hirudo verbana and revealed a critical role for the hemolysis of erythrocytes. A mutant with a miniTn5 insertion in exeM, which is involved in forming the inner membrane platform in the T2SS, was isolated by screening mutants for loss of hemolysis on blood agar plates. A hemolysis assay was used to quantify the mutant's deficiency in lysing sheep erythrocytes and revealed a 99.9% decrease compared to the parent strain. The importance of the T2SS in the colonization of the symbiotic host was assessed. Colonization assays revealed that the T2SS is critical for initial colonization of the leech gut. The defect was tied to the loss of hemolysin production by performing a colonization assay with blood containing lysed erythrocytes. This restored the colonization defect in the mutant. Complementation of the mutant using the promoter region and exeMN revealed that the T2SS is responsible for secreting hemolysin into the extracellular space and that both the T2SS and hemolysin export by the T2SS are critical for initial establishment of A. veronii in the leech gut.

  10. Barcoding, types and the Hirudo files: using information content to critically evaluate the identity of DNA barcodes.

    PubMed

    Kvist, Sebastian; Oceguera-Figueroa, Alejandro; Siddall, Mark E; Erséus, Christer

    2010-12-01

    Species identifications based on DNA barcoding rely on the correct identity of previously barcoded specimens, but little attention has been given to whether deposited barcodes include correspondence to the species' name-bearing type. The information content associated with COX1 sequences in the two most commonly used repositories of barcodes, GenBank and the Barcode of Life Data System (BOLD), is often insufficient for subsequent evaluation of the robustness of the identification procedure. We argue that DNA barcoding and taxonomy alike will benefit from more information content in the annotations of barcoded specimens as this will allow for validation and re-evaluation of the initial specimen identification. The aim should be to closely connect specimens from which reference barcodes are generated with the holotype through straight-forward taxonomy, and geographical and genetic correlations. Annotated information should also include voucher specimens and collector/identifier information. We examine two case studies based on empirical data, in which barcoding and taxonomy benefit from increased information content. On the basis of data from the first case study, we designate a barcoded neotype of the European medicinal leech, Hirudo medicinalis, on morphological and geographical grounds.

  11. Forskolin induces NMDA receptor-dependent potentiation at a central synapse in the leech.

    PubMed

    Grey, Kathryn B; Burrell, Brian D

    2008-05-01

    In vertebrate hippocampal neurons, application of forskolin (an adenylyl cyclase activator) and rolipram (a phosphodiesterase inhibitor) is an effective technique for inducing chemical long-term potentiation (cLTP) that is N-methyl-d-aspartate (NMDA) receptor (NMDAR)-dependent. However, it is not known whether forskolin induces a similar potentiation in invertebrate synapses. Therefore, we examined whether forskolin plus rolipram treatment could induce potentiation at a known glutamatergic synapse in the leech (Hirudo sp.), specifically between the pressure (P) mechanosensory and anterior pagoda (AP) neurons. Perfusion of isolated ganglia with forskolin (50 muM) in conjunction with rolipram (0.1 muM) in Mg(2+)-free saline significantly potentiated the P-to-AP excitatory postsynaptic potential. Application of 2-amino-5-phosphonovaleric acid (APV, 100 muM), a competitive NMDAR antagonist, blocked the potentiation, indicating P-to-AP potentiation is NMDAR-dependent. Potentiation was blocked by injection of bis-(o-aminophenoxy)-N,N,N',N'-tetraacetic acid (BAPTA, 1 mM) into the postsynaptic cell, but not by BAPTA injection into the presynaptic neuron, indicating a requirement for postsynaptic elevation of intracellular Ca(2+). Application of db-cAMP mimicked the potentiating effects of forskolin, and Rp-cAMP, an inhibitor of protein kinase A, blocked forskolin-induced potentiation. Potentiation was also blocked by autocamtide-2-related inhibitory peptide (AIP), indicating a requirement for activation of Ca(2+)/calmodulin-dependent kinase II (CaMKII). Finally, potentiation was blocked by botulinum toxin, suggesting that trafficking of glutamate receptors also plays a role in this form of synaptic plasticity. These experiments demonstrate that techniques used to induce cLTP in vertebrate synapses also induce NMDAR-dependent potentiation in the leech CNS and that many of the cellular processes that mediate LTP are conserved between vertebrate and invertebrate phyla.

  12. Identification of iron and heme utilization genes in Aeromonas and their role in the colonization of the leech digestive tract

    PubMed Central

    Maltz, Michele; LeVarge, Barbara L.; Graf, Joerg

    2015-01-01

    It is known that many pathogens produce high-affinity iron uptake systems like siderophores and/or proteins for utilizing iron bound to heme-containing molecules, which facilitate iron-acquisition inside a host. In mutualistic digestive-tract associations, iron uptake systems have not been as well studied. We investigated the importance of two iron utilization systems within the beneficial digestive-tract association Aeromonas veronii and the medicinal leech, Hirudo verbana. Siderophores were detected in A. veronii using chrome azurol S. Using a mini Tn5, a transposon insertion in viuB generated a mutant unable to utilize iron using siderophores. The A. veronii genome was then searched for genes potentially involved in iron utilization bound to heme-containing molecules. A putative outer membrane heme receptor (hgpB) was identified with a transcriptional activator, termed hgpR, downstream. The hgpB gene was interrupted with an antibiotic resistance cassette in both the parent strain and the viuB mutant, yielding an hgpB mutant and a mutant with both iron uptake systems inactivated. In vitro assays indicated that hgpB is involved in utilizing iron bound to heme and that both iron utilization systems are important for A. veronii to grow in blood. In vivo colonization assays revealed that the ability to acquire iron from heme-containing molecules is critical for A. veronii to colonize the leech gut. Since iron and specifically heme utilization is important in this mutualistic relationship and has a potential role in virulence factor of other organisms, genomes from different Aeromonas strains (both clinical and environmental) were queried with iron utilization genes of A. veronii. This analysis revealed that in contrast to the siderophore utilization genes heme utilization genes are widely distributed among aeromonads. The importance of heme utilization in the colonization of the leech further confirms that symbiotic and pathogenic relationships possess similar

  13. Model of intersegmental coordination in the leech heartbeat neuronal network.

    PubMed

    Hill, Andrew A V; Masino, Mark A; Calabrese, Ronald L

    2002-03-01

    We have created a computational model of the timing network that paces the heartbeat of the medicinal leech, Hirudo medicinalis. The rhythmic activity of this network originates from two segmental oscillators located in the third and fourth midbody ganglia. In the intact nerve cord, these segmental oscillators are mutually entrained to the same cycle period. Although experiments have shown that the segmental oscillators are coupled by inhibitory coordinating interneurons, the underlying mechanisms of intersegmental coordination have not yet been elucidated. To help understand this coordination, we have created a simple computational model with two variants: symmetric and asymmetric. In the symmetric model, neurons within each segmental oscillator called oscillator interneurons, inhibit the coordinating interneurons. In contrast, in the asymmetric model only the oscillator interneurons of one segmental oscillator inhibit the coordinating interneurons. In the symmetric model, when two segmental oscillators with different inherent periods are coupled, the faster one leads in phase, and the period of the coupled system is equal to the period of the faster oscillator. This behavior arises because, during each oscillation cycle, the oscillator interneurons of the faster segmental oscillator begin to burst before those of the slower oscillator, thereby terminating spike activity in the coordinating interneurons. Thus there is a brief period of time in each cycle when the oscillator interneurons of the slower segmental oscillator are relieved of inhibition from the coordinating interneurons. This "removal of synaptic inhibition" allows, within certain limits, the slower segmental oscillator to be sped to the period of the faster one. Thus the symmetric model demonstrates a plausible biophysical mechanism by which one segmental oscillator can entrain the other. In general the asymmetric model, in which only one segmental oscillator has the ability to inhibit the

  14. Embryonic electrical connections appear to pre-figure a behavioral circuit in the leech CNS.

    PubMed

    Marin-Burgin, Antonia; Eisenhart, F James; Kristan, William B; French, Kathleen A

    2006-02-01

    During development, many embryos show electrical coupling among neurons that is spatially and temporally regulated. For example, in vertebrate embryos extensive dye coupling is seen during the period of circuit formation, suggesting that electrical connections could pre-figure circuits, but it has been difficult to identify which neuronal types are coupled. We have used the leech Hirudo medicinalis to follow the development of electrical connections within the circuit that produces local bending. This circuit consists of three layers of neurons: four mechanosensory neurons (P cells), 17 identified interneurons, and approximately 24 excitatory and inhibitory motor neurons. These neurons can be identified in embryos, and we followed the spatial and temporal dynamics as specific connections developed. Injecting Neurobiotin into identified cells of the circuit revealed that electrical connections were established within this circuit in a precise manner from the beginning. Connections first appeared between motor neurons; mechanosensory neurons and interneurons started to connect at least a day later. This timing correlates with the development of behaviors, so the pattern of emerging connectivity could explain the appearance first of spontaneous behaviors (driven by a electrically coupled motor network) and then of evoked behaviors (when sensory neurons and interneurons are added to the circuit).

  15. Transcription and protein synthesis inhibitors influence long-term effects of acetyl-l-carnitine on non-associative learning in the leech.

    PubMed

    Traina, Giovanna; Scuri, Rossana

    2015-01-01

    Acetyl-l-carnitine (ALC) is the principal acetyl ester of L-carnitine and it plays an essential role in intermediary metabolism. ALC affects several targets in the nervous system. Along this line of investigation, we analyzed the long-term effects of ALC on elementary nonassociative learning in the swimming induction model of the leech Hirudo medicinalis, in which nociceptive stimulation of the dorsal skin produces a more rapid swim response to a test stimulus (sensitization). In this simplified model a single ALC administration blocked the sensitizing effects of nociceptive stimulation in swim induction showing increasingly long lasting effects. Herein, we have analyzed the long-term effects of ALC on sensitization and dishabituation. Leeches were treated with inhibitors of either transcription or protein synthesis 30 min after the administration of ALC and, subsequently, subjected to noxious stimuli: the animals exhibited a sensitized swimming response 6 days after ALC treatment but not after 2 hours indicating that the long-term suppressive effects of ALC on sensitization/dishabituation needed mRNA and protein synthesis.

  16. Reproductive strategies of the kangaroo leech, Marsupiobdella africana (Glossiphoniidae)

    PubMed Central

    Kruger, Natasha; Du Preez, Louis

    2015-01-01

    The Kangaroo Leech, Marsupiobdella africana, is a hermaphroditic organism, with insemination taking place by the planting of a spermatophore on another leech. Spermatophores are mostly planted on the anterior of the recipient leech, but not always. Several spermatophores may be planted by different leeches on a single recipient. The spermatophore consists of two side by side lobes. Within minutes from planting of the spermatophore, the contents are squeezed out and into the body of the recipient. Sperm are believed to find the way to the ova by following chemical cues. Kangaroo Leeches display advanced parental care by transferring fertilized eggs from the reproductive opening to a brood pouch on the ventral side. Fully developed leeches may copulate after detaching from the amphibian host Xenopus laevis, or from the Cape River Crab Potamonautes perlatus with which it maintains a phoretic association. PMID:25830114

  17. A new lineage of trypanosomes from Australian vertebrates and terrestrial bloodsucking leeches (Haemadipsidae).

    PubMed

    Hamilton, P B; Stevens, J R; Gidley, J; Holz, P; Gibson, W C

    2005-04-01

    Little is known about the trypanosomes of indigenous Australian vertebrates and their vectors. We surveyed a range of vertebrates and blood-feeding invertebrates for trypanosomes by parasitological and PCR-based methods using primers specific to the small subunit ribosomal RNA (SSU rRNA) gene of genus Trypanosoma. Trypanosome isolates were obtained in culture from two common wombats, one swamp wallaby and an Australian bird (Strepera sp.). By PCR, blood samples from three wombats, one brush-tailed wallaby, three platypuses and a frog were positive for trypanosome DNA. All the blood-sucking invertebrates screened were negative for trypanosomes both by microscopy and PCR, except for specimens of terrestrial leeches (Haemadipsidae). Of the latter, two Micobdella sp. specimens from Victoria and 18 Philaemon sp. specimens from Queensland were positive by PCR. Four Haemadipsa zeylanica specimens from Sri Lanka and three Leiobdella jawarerensis specimens from Papua New Guinea were also PCR positive for trypanosome DNA. We sequenced the SSU rRNA and glycosomal glyceraldehyde phosphate dehydrogenase (gGAPDH) genes in order to determine the phylogenetic positions of the new vertebrate and terrestrial leech trypanosomes. In trees based on these genes, Australian vertebrate trypanosomes fell in several distinct clades, for the most part being more closely related to trypanosomes outside Australia than to each other. Two previously undescribed wallaby trypanosomes fell in a clade with Trypanosoma theileri, the cosmopolitan bovid trypanosome, and Trypanosoma cyclops from a Malaysian primate. The terrestrial leech trypanosomes were closely related to the wallaby trypanosomes, T. cyclops and a trypanosome from an Australian frog. We suggest that haemadipsid leeches may be significant and widespread vectors of trypanosomes in Australia and Asia.

  18. Field and experimental evidence of a new caiman trypanosome species closely phylogenetically related to fish trypanosomes and transmitted by leeches.

    PubMed

    Fermino, Bruno R; Paiva, Fernando; Soares, Priscilla; Tavares, Luiz Eduardo R; Viola, Laerte B; Ferreira, Robson C; Botero-Arias, Robinson; de-Paula, Cátia D; Campaner, Marta; Takata, Carmen S A; Teixeira, Marta M G; Camargo, Erney P

    2015-12-01

    Trypanosoma terena and Trypanosoma ralphi are known species of the South American crocodilians Caiman crocodilus, Caiman yacare and Melanosuchus niger and are phylogenetically related to the tsetse-transmitted Trypanosoma grayi of the African Crocodylus niloticus. These trypanosomes form the Crocodilian clade of the terrestrial clade of the genus Trypanosoma. A PCR-survey for trypanosomes in caiman blood samples and in leeches taken from caimans revealed unknown trypanosome diversity and frequent mixed infections. Phylogenies based on SSU (small subunit) of rRNA and gGAPDH (glycosomal Glyceraldehyde Phosphate Dehydrogenase) gene sequences revealed a new trypanosome species clustering with T. terena and T. ralphi in the crocodilian clade and an additional new species nesting in the distant Aquatic clade of trypanosomes, which is herein named Trypanosoma clandestinus n. sp. This new species was found in Caiman yacare, Caiman crocodilus and M. niger from the Pantanal and Amazonian biomes in Brazil. Large numbers of dividing epimastigotes and unique thin and long trypomastigotes were found in the guts of leeches (Haementeria sp.) removed from the mouths of caimans. The trypanosomes recovered from the leeches had sequences identical to those of T. clandestinus of caiman blood samples. Experimental infestation of young caimans (Caiman yacare) with infected leeches resulted in long-lasting T. clandestinus infections that permitted us to delineate its life cycle. In contrast to T. terena, T. ralphi and T. grayi, which are detectable by hemoculturing, microscopy and standard PCR of caiman blood, T. clandestinus passes undetected by these methods due to very low parasitemia and could be detected solely by the more sensitive nested PCR method. T. clandestinus n. sp. is the first crocodilian trypanosome known to be transmitted by leeches and positioned in the aquatic clade closest to fish trypanosomes. Our data show that caimans can host trypanosomes of the aquatic or

  19. Field and experimental evidence of a new caiman trypanosome species closely phylogenetically related to fish trypanosomes and transmitted by leeches

    PubMed Central

    Fermino, Bruno R.; Paiva, Fernando; Soares, Priscilla; Tavares, Luiz Eduardo R.; Viola, Laerte B.; Ferreira, Robson C.; Botero-Arias, Robinson; de-Paula, Cátia D.; Campaner, Marta; Takata, Carmen S.A.; Teixeira, Marta M.G.; Camargo, Erney P.

    2015-01-01

    Trypanosoma terena and Trypanosoma ralphi are known species of the South American crocodilians Caiman crocodilus, Caiman yacare and Melanosuchus niger and are phylogenetically related to the tsetse-transmitted Trypanosoma grayi of the African Crocodylus niloticus. These trypanosomes form the Crocodilian clade of the terrestrial clade of the genus Trypanosoma. A PCR-survey for trypanosomes in caiman blood samples and in leeches taken from caimans revealed unknown trypanosome diversity and frequent mixed infections. Phylogenies based on SSU (small subunit) of rRNA and gGAPDH (glycosomal Glyceraldehyde Phosphate Dehydrogenase) gene sequences revealed a new trypanosome species clustering with T. terena and T. ralphi in the crocodilian clade and an additional new species nesting in the distant Aquatic clade of trypanosomes, which is herein named Trypanosoma clandestinus n. sp. This new species was found in Caiman yacare, Caiman crocodilus and M. niger from the Pantanal and Amazonian biomes in Brazil. Large numbers of dividing epimastigotes and unique thin and long trypomastigotes were found in the guts of leeches (Haementeria sp.) removed from the mouths of caimans. The trypanosomes recovered from the leeches had sequences identical to those of T. clandestinus of caiman blood samples. Experimental infestation of young caimans (Caiman yacare) with infected leeches resulted in long-lasting T. clandestinus infections that permitted us to delineate its life cycle. In contrast to T. terena, T. ralphi and T. grayi, which are detectable by hemoculturing, microscopy and standard PCR of caiman blood, T. clandestinus passes undetected by these methods due to very low parasitemia and could be detected solely by the more sensitive nested PCR method. T. clandestinus n. sp. is the first crocodilian trypanosome known to be transmitted by leeches and positioned in the aquatic clade closest to fish trypanosomes. Our data show that caimans can host trypanosomes of the aquatic or

  20. The eyes have it: long-distance dispersal by an intraorbital leech parasite of birds.

    PubMed

    Siddall, Mark E; Rood-Goldman, Rebecca; Barrio, Amalie; Barboutis, Christos

    2013-12-01

    A leech was found parasitizing the ocular orbit of a common redstart captured during a faunistic survey of Antikythira in the Aegean Sea during the spring migration of 2012. Morphological and molecular characterizations placed the leech in the mucous-membrane specific leech family Praobdellidae and definitively as the species Parapraobdella lineata. This is the first record of any leech parasitizing a passerine bird, Phoenicurus phoenicurus , and the first of a praobdellid leech on any avian host.

  1. 33 CFR 207.330 - Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech...

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 33 Navigation and Navigable Waters 3 2014-07-01 2014-07-01 false Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech Lake and Mississippi River, and Pokegama... OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.330 Mississippi River...

  2. 33 CFR 207.330 - Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech...

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 33 Navigation and Navigable Waters 3 2013-07-01 2013-07-01 false Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech Lake and Mississippi River, and Pokegama... OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.330 Mississippi River...

  3. 33 CFR 207.330 - Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech Lake and Mississippi River, and Pokegama... OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.330 Mississippi River...

  4. 33 CFR 207.330 - Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech...

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 33 Navigation and Navigable Waters 3 2012-07-01 2012-07-01 false Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech Lake and Mississippi River, and Pokegama... OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.330 Mississippi River...

  5. 33 CFR 207.330 - Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech...

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 33 Navigation and Navigable Waters 3 2011-07-01 2011-07-01 false Mississippi River between Winnibigoshish and Pokegama dams, Leech River between outlet of Leech Lake and Mississippi River, and Pokegama... OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.330 Mississippi River...

  6. Leeches--the good, the bad and the wiggly.

    PubMed

    O'Dempsey, Tim

    2012-11-01

    Leeches have been making a remarkable come-back in medical practice in recent years, particularly in reconstructive surgery. This paper opens with a brief review of the historical aspects of the medicinal use of leeches and their recent renaissance in modern medical practice. We then embark on a journey through the murky waters of leech infestation and the potentially life-threatening complications arising from close encounters with these extraordinary creatures. Finally, we get to grips with the tricky issue of safely apprehending and removing uninvited hangers-on.

  7. Micromere lineages in the glossiphoniid leech Helobdella

    NASA Technical Reports Server (NTRS)

    Huang, Francoise Z.; Kang, Dongmin; Ramirez-Weber, Felipe-Andres; Bissen, Shirley T.; Weisblat, David A.

    2002-01-01

    In leech embryos, segmental mesoderm and ectoderm arise from teloblasts by lineages that are already relatively well characterized. Here, we present data concerning the early divisions and the definitive fate maps of the micromeres, a group of 25 small cells that arise during the modified spiral cleavage in leech (Helobdella robusta) and contribute to most of the nonsegmental tissues of the adult. Three noteworthy results of this work are as follows. (1) The c"' and dm' clones (3d and 3c in traditional nomenclature) give rise to a hitherto undescribed network of fibers that run from one end of the embryo to the other. (2) The clones of micromeres b" and b"' (2b and 3b in traditional nomenclature) die in normal development; the b" clone can be rescued to assume the normal c" fate if micromere c" or its clone are ablated in early development. (3) Two qualitative differences in micromere fates are seen between H. robusta (Sacramento) and another Helobdella sp. (Galt). First, in Helobdella sp. (Galt), the clone of micromere b" does not normally die, and contributes a subset of the cells arising exclusively from c" in H. robusta (Sacramento). Second, in Helobdella sp. (Galt), micromere c"' makes no definitive contribution, whereas micromere dm' gives rise to cells equivalent to those arising from c"' and dm' in H. robusta (Sacramento).

  8. Calcium dynamics and compartmentalization in leech neurons.

    PubMed

    Andjelic, Sofija; Torre, Vincent

    2005-12-01

    Calcium dynamics in leech neurons were studied using a fast CCD camera. Fluorescence changes (DeltaF/F) of the membrane impermeable calcium indicator Oregon Green were measured. The dye was pressure injected into the soma of neurons under investigation. DeltaF/F caused by a single action potential (AP) in mechanosensory neurons had approximately the same amplitude and time course in the soma and in distal processes. By contrast, in other neurons such as the Anterior Pagoda neuron, the Annulus Erector motoneuron, the L motoneuron, and other motoneurons, APs evoked by passing depolarizing current in the soma produced much larger fluorescence changes in distal processes than in the soma. When APs were evoked by stimulating one distal axon through the root, DeltaF/F was large in all distal processes but very small in the soma. Our results show a clear compartmentalization of calcium dynamics in most leech neurons in which the soma does not give propagating action potentials. In such cells, the soma, while not excitable, can affect information processing by modulating the sites of origin and conduction of AP propagation in distal excitable processes.

  9. Comparative Mitogenomics of Leeches (Annelida: Clitellata): Genome Conservation and Placobdella-Specific trnD Gene Duplication

    PubMed Central

    Moya, Andrés; Siddall, Mark E.; Latorre, Amparo

    2016-01-01

    Mitochondrial DNA sequences, often in combination with nuclear markers and morphological data, are frequently used to unravel the phylogenetic relationships, population dynamics and biogeographic histories of a plethora of organisms. The information provided by examining complete mitochondrial genomes also enables investigation of other evolutionary events such as gene rearrangements, gene duplication and gene loss. Despite efforts to generate information to represent most of the currently recognized groups, some taxa are underrepresented in mitochondrial genomic databases. One such group is leeches (Annelida: Hirudinea: Clitellata). Herein, we expand our knowledge concerning leech mitochondrial makeup including gene arrangement, gene duplication and the evolution of mitochondrial genomes by adding newly sequenced mitochondrial genomes for three bloodfeeding species: Haementeria officinalis, Placobdella lamothei and Placobdella parasitica. With the inclusion of three new mitochondrial genomes of leeches, a better understanding of evolution for this organelle within the group is emerging. We found that gene order and genomic arrangement in the three new mitochondrial genomes is identical to previously sequenced members of Clitellata. Interestingly, within Placobdella, we recovered a genus-specific duplication of the trnD gene located between cox2 and atp8. We performed phylogenetic analyses using 12 protein-coding genes and expanded our taxon sampling by including GenBank sequences for 39 taxa; the analyses confirm the monophyletic status of Clitellata, yet disagree in several respects with other phylogenetic hypotheses based on morphology and analyses of non-mitochondrial data. PMID:27176910

  10. Comparative Mitogenomics of Leeches (Annelida: Clitellata): Genome Conservation and Placobdella-Specific trnD Gene Duplication.

    PubMed

    Oceguera-Figueroa, Alejandro; Manzano-Marín, Alejandro; Kvist, Sebastian; Moya, Andrés; Siddall, Mark E; Latorre, Amparo

    2016-01-01

    Mitochondrial DNA sequences, often in combination with nuclear markers and morphological data, are frequently used to unravel the phylogenetic relationships, population dynamics and biogeographic histories of a plethora of organisms. The information provided by examining complete mitochondrial genomes also enables investigation of other evolutionary events such as gene rearrangements, gene duplication and gene loss. Despite efforts to generate information to represent most of the currently recognized groups, some taxa are underrepresented in mitochondrial genomic databases. One such group is leeches (Annelida: Hirudinea: Clitellata). Herein, we expand our knowledge concerning leech mitochondrial makeup including gene arrangement, gene duplication and the evolution of mitochondrial genomes by adding newly sequenced mitochondrial genomes for three bloodfeeding species: Haementeria officinalis, Placobdella lamothei and Placobdella parasitica. With the inclusion of three new mitochondrial genomes of leeches, a better understanding of evolution for this organelle within the group is emerging. We found that gene order and genomic arrangement in the three new mitochondrial genomes is identical to previously sequenced members of Clitellata. Interestingly, within Placobdella, we recovered a genus-specific duplication of the trnD gene located between cox2 and atp8. We performed phylogenetic analyses using 12 protein-coding genes and expanded our taxon sampling by including GenBank sequences for 39 taxa; the analyses confirm the monophyletic status of Clitellata, yet disagree in several respects with other phylogenetic hypotheses based on morphology and analyses of non-mitochondrial data.

  11. NEW HOST DATA FOR THE LEECH OLIGOBDELLA BIANNULATE (EUHIRUDINEA: GLOSSIPHONIIDAE)

    EPA Science Inventory

    The leech Oligobdella biannulata is a relatively rare species, endemic to mountain streams of the Southern Blue Ridge Physiographic Zone, exclusive of Virginia. Oligobdella biannulata was originally thought to be host specific to Desmognathus quadramaculatus. However, the host ...

  12. Intermediate filament genes as differentiation markers in the leech Helobdella.

    PubMed

    Kuo, Dian-Han; Weisblat, David A

    2011-10-01

    The intermediate filament (IF) cytoskeleton is a general feature of differentiated cells. Its molecular components, IF proteins, constitute a large family including the evolutionarily conserved nuclear lamins and the more diverse collection of cytoplasmic intermediate filament (CIF) proteins. In vertebrates, genes encoding CIFs exhibit cell/tissue type-specific expression profiles and are thus useful as differentiation markers. The expression of invertebrate CIFs, however, is not well documented. Here, we report a whole-genome survey of IF genes and their developmental expression patterns in the leech Helobdella, a lophotrochozoan model for developmental biology research. We found that, as in vertebrates, each of the leech CIF genes is expressed in a specific set of cell/tissue types. This allows us to detect earliest points of differentiation for multiple cell types in leech development and to use CIFs as molecular markers for studying cell fate specification in leech embryos. In addition, to determine the feasibility of using CIFs as universal metazoan differentiation markers, we examined phylogenetic relationships of IF genes from various species. Our results suggest that CIFs, and thus their cell/tissue-specific expression patterns, have expanded several times independently during metazoan evolution. Moreover, comparing the expression patterns of CIF orthologs between two leech species suggests that rapid evolutionary changes in the cell or tissue specificity of CIFs have occurred among leeches. Hence, CIFs are not suitable for identifying cell or tissue homology except among very closely related species, but they are nevertheless useful species-specific differentiation markers.

  13. Coding and adaptation during mechanical stimulation in the leech nervous system.

    PubMed

    Pinato, G; Torre, V

    2000-12-15

    The experiments described here were designed to characterise sensory coding and adaptation during mechanical stimulation in the leech (Hirudo medicinalis). A chain of three ganglia and a segment of the body wall connected to the central ganglion were used. Eight extracellular suction pipettes and one or two intracellular electrodes were used to record action potentials from all mechanosensory neurones of the three ganglia. When the skin of the body wall was briefly touched with a filament exerting a force of about 2 mN, touch (T) cells in the central ganglion, but also those in adjacent ganglia (i.e. anterior and posterior), fired one or two action potentials. However, the threshold for action potential initiation was lower for T cells in the central ganglion than for those in adjacent ganglia. The timing of the first evoked action potential in a T cell was very reproducible with a jitter often lower than 100 us. Action potentials in T cells were not significantly correlated. When the force exerted by the filament was increased above 20 mN, pressure (P) cells in the central and neighbouring ganglia fired action potentials. Action potentials in P cells usually followed those evoked in T cells with a delay of about 20 ms and had a larger jitter of 0.5-10 ms. With stronger stimulations exceeding 50 mN, noxious (N) cells also fired action potentials. With such stimulations the majority of mechanosensory neurones in the three ganglia fired action potentials. The spatial properties of the whole receptive field of the mechanosensory neurones were explored by touching different parts of the skin. When the mechanical stimulation was applied for a longer time, i.e. 1 s, only P cells in the central ganglion continued to fire action potentials. P cells in neighbouring ganglia fully adapted after firing two or three action potentials.P cells in adjacent ganglia, having fully adapted to a steady mechanical stimulation of one part of the skin, fired action potentials following

  14. Bed bugs, leeches and hookworm larvae in the skin.

    PubMed

    Heukelbach, Jorg; Hengge, Ulrich R

    2009-01-01

    Bed bugs, leeches, and hookworm-related cutaneous larva migrans are skin infestations that are usually considered of minor importance because they produce discomfort rather than cause or transmit disease. Bed bugs have been increasing tremendously in high-income countries in recent years, causing distress to affected individuals and economic loss. Infestation by land leeches causes mainly unpleasant skin reactions, whereas infestation by aquatic leeches may be more dangerous, leading to anemia and in severe cases, to death. Cutaneous larva migrans produces an intense pruritus that can be exasperating for the patient and cause sleep disturbance. An overview is given of these three infestations with a discussion of the causative agents, transmission, clinical manifestations, diagnosis, and treatment.

  15. Bronchial Leech Infestation in a 15-Year-Old Female

    PubMed Central

    Moslehi, Mohammad Ashkan; Imanieh, Mohammad Hadi

    2016-01-01

    Foreign body aspiration (FBA) is a common incidence in young children. Leeches are rarely reported as FBA at any age. This study describes a 15-year-old female who presented with hemoptysis, hematemesis, coughs, melena, and anemia seven months prior to admission. Chest X-ray showed a round hyperdensity in the right lower lobe. A chest computed tomography (CT) demonstrated an area of consolidation and surrounding ground glass opacities in the right lower lobe. Hematological investigations revealed anemia. Finally, bronchoscopy was performed and a 5 cm leech was found within the right B7-8 bronchus and removed by forceps and a Dormia basket. PMID:27752380

  16. Bronchial Leech Infestation in a 15-Year-Old Female.

    PubMed

    Moslehi, Mohammad Ashkan; Imanieh, Mohammad Hadi; Adib, Ali

    2016-01-01

    Foreign body aspiration (FBA) is a common incidence in young children. Leeches are rarely reported as FBA at any age. This study describes a 15-year-old female who presented with hemoptysis, hematemesis, coughs, melena, and anemia seven months prior to admission. Chest X-ray showed a round hyperdensity in the right lower lobe. A chest computed tomography (CT) demonstrated an area of consolidation and surrounding ground glass opacities in the right lower lobe. Hematological investigations revealed anemia. Finally, bronchoscopy was performed and a 5 cm leech was found within the right B7-8 bronchus and removed by forceps and a Dormia basket.

  17. Entrainment of leech swimming activity by the ventral stretch receptor.

    PubMed

    Yu, Xintian; Friesen, W Otto

    2004-11-01

    Rhythmic animal movements originate in CNS oscillator circuits; however, sensory inputs play an important role in shaping motor output. Our recent studies demonstrated that leeches with severed nerve cords swim with excellent coordination between the two ends, indicating that sensory inputs are sufficient for maintaining intersegmental coordination. In this study, we examined the neuronal substrates that underlie intersegmental coordination via sensory mechanisms. Among the identified sensory neurons in the leech, we found the ventral stretch receptor (VSR) to be the best candidate for our study because of its sensitivity to tension in longitudinal muscle. Our experiments demonstrate that (1) the membrane potential of the VSR is depolarized during swimming and oscillates with an amplitude of 1.5-5.0 mV, (2) rhythmic currents injected into the VSR can entrain ongoing swimming over a large frequency range (0.9-1.8 Hz), and (3) large current pulses injected into the VSR shift the phase of the swimming rhythm. These results suggest that VSRs play an important role in generating and modulating the swim rhythm. We propose that coordinated swimming in leech preparations with severed nerve cords results from mutual entrainment between the two ends of the leech mediated by stretch receptors.

  18. Host specificity in Metamera sillasenorum, n. sp., a gregarine parasite of the leech Helobdella triserialis with notes on transmission dynamics.

    PubMed

    Wise, M R; Janovy, J; Wise, J C

    2000-06-01

    Eugregarines of the suborder Septatorina are apicomplexan parasites that are found mainly in arthropods. Some exceptions are species in the Metameridae that contains the only 5 septate gregarines recorded from annelids. The type genus is Metamera Duke, 1910 with 2 species, Metamera schubergi Duke, 1910, in European Glossiphonia complanata, and Metamera reynoldsi Jones, 1943, from North American G. complanata. Over the summers of 1995-1998, in Keith County, Nebraska, septate gregarines were found in the glossiphoniid leech Helobdella triserialis. The gregarines were determined to be a new species of Metamera, herein named Metamera sillasenorum. Measurements of size and body proportions of over 600 gregarines and 50 oocysts showed differences from measurements of M. schubergi and M. reynoldsi, and secondary septa in the deutomerite were rarely observed. Field observations indicated that M. sillasenorum is probably host specific. In the laboratory, leeches also exhibited strong feeding preferences; e.g., H. triserialis and G. complanata consumed only snails, whereas Helobdella stagnalis consumed only oligochaetes. Infection experiments demonstrated that freshwater snails ingest the oocysts and are required as mechanical vectors. Oocysts were passed unaltered through the snails' intestines. Glossiphonia complanata did not become infected regardless of heavy exposure to oocysts, although only 5 G. complanata were used in the experiments. The results show that host specificity of M. sillasenorum is most likely due to a combination of host-feeding habits and host-parasite compatibility.

  19. [Study on the processing of leech by FTIR and 2D-IR correlation spectroscopy].

    PubMed

    Li, Bing-Ning; Wu, Yan-Wen; Ouyang, Jie; Sun, Su-Qin; Chen, Shun-Cong

    2011-04-01

    The chemical differences of traditional Chinese medicine leech before and after processing were analyzed by FTIR and two-dimensional correlation infrared (2D-IR) spectroscopy. The result showed that the leech was high in protein, with characteristic peaks of amide I, II bands. Comparing the IR spectra of samples, the primary difference was that the characteristic peak of fresh leech was at 1 543 cm(-1), while that of crude and processed leech was at 1 535 cm(-1). A 2D-IR spectrum with heating perturbation was used to track the processing dynamics of leech In the 2D-IR correlation spectra, fresh leech exhibited stronger automatic peaks of the amide I and II bands than that of processed leech, which indicates that the protein components of the fresh leech were more sensitive to heat perturbation than the processed one. Moreover, the result of FTIR and 2D-IR correlation spectra validated that the 3-dimensional structure of protein was damaged and hydrogen bonds were broken after processing, which resulted in the inactivation of protein. The fatty acids and cholesterol components of leech were also oxidized in this process.

  20. An improved anti-leech mechanism based on session identifier

    NASA Astrophysics Data System (ADS)

    Zhang, Jianbiao; Zhu, Tong; Zhang, Han; Lin, Li

    2011-12-01

    With the rapid development of information technology and extensive requirement of network resource sharing, plenty of resource hotlinking phenomenons appear on the internet. The hotlinking problem not only harms the interests of legal websites but also leads to a great affection to fair internet environment. The anti-leech technique based on session identifier is highly secure, but the transmission of session identifier in plaintext form causes some security flaws. In this paper, a proxy hotlinking technique based on session identifier is introduced firstly to illustrate these security flaws; next, this paper proposes an improved anti-leech mechanism based on session identifier, the mechanism takes the random factor as the core and detects hotlinking request using a map table that contains random factor, user's information and time stamp; at last the paper analyzes the security of mechanism in theory. The result reveals that the improved mechanism has the merits of simple realization, high security and great flexibility.

  1. An improved anti-leech mechanism based on session identifier

    NASA Astrophysics Data System (ADS)

    Zhang, Jianbiao; Zhu, Tong; Zhang, Han; Lin, Li

    2012-01-01

    With the rapid development of information technology and extensive requirement of network resource sharing, plenty of resource hotlinking phenomenons appear on the internet. The hotlinking problem not only harms the interests of legal websites but also leads to a great affection to fair internet environment. The anti-leech technique based on session identifier is highly secure, but the transmission of session identifier in plaintext form causes some security flaws. In this paper, a proxy hotlinking technique based on session identifier is introduced firstly to illustrate these security flaws; next, this paper proposes an improved anti-leech mechanism based on session identifier, the mechanism takes the random factor as the core and detects hotlinking request using a map table that contains random factor, user's information and time stamp; at last the paper analyzes the security of mechanism in theory. The result reveals that the improved mechanism has the merits of simple realization, high security and great flexibility.

  2. Occurrence of three leech species (Annelida: Hirudinida) on fishes in the Kentucky River

    EPA Science Inventory

    Leeches were collected from six fish species distributed among four of ten sites sampled. The leech species observed were Myzobdella reducta (Meyer, 1940) and Myzobdella lugubris Leidy, 1851 of the family Piscicolidae and Placobdella pediculata Hemingway, 1908 of the family Gloss...

  3. Johann Friedrich Dieffenbach: successful use of leeches in plastic surgery in the 1820s.

    PubMed

    Sawyer, R T

    2000-04-01

    Johann Friedrich Dieffenbach (1792-1847) regularly and successfully utilised leeches in sophisticated plastic surgery in Berlin in the 1820s and 1830s, well before anaesthesia, antisepsis and antibiotics. Inexplicably, it took nearly another 150 years before the use of leeches in this context was revived.

  4. OCCURRENCE OF TWO LEECH SPECIES (ANNELIDA: HIRUDINEA) ON FISHES IN THE KENTUCKY RIVER

    EPA Science Inventory

    Little is known specifically on the feeding relationships between parasitic leeches and fish in North America. During an electrofishing survey conducted on the main stem of the Kentucky River in the summer of 2000, the presence of leeches was documented on six species of fish. ...

  5. Chinese Medicinal Leech: Ethnopharmacology, Phytochemistry, and Pharmacological Activities

    PubMed Central

    Dong, Han; Ren, Ji-Xiang; Wang, Jing-Jing; Ding, Li-Shuai; Zhao, Jian-Jun; Liu, Song-Yan; Gao, Hui-Min

    2016-01-01

    Hirudo (Shuizhi in Chinese) is an important Chinese medicine, which possesses many therapeutic properties for the treatment of the cerebral hemorrhage and other thrombosis-related diseases. The phytochemical investigation gave more than 51 compounds including pteridines, phosphatidylcholines, glycosphingolipids, and sterols, as well as some bioactive peptides from the Shuizhi derived from three animal species recorded in the current Chinese Pharmacopoeia. The pharmacological studies on the Shuizhi have revealed various activities such as anticoagulation, antithrombosis, antiatherosclerosis, antiplatelet aggregation, antitumor and anti-inflammatory as well as hemorheology improvement, and protective effects against cerebral ischemia-reperfusion injury. However, some important issues based on the traditional uses of Shuizhi are still not clear. The aim of the present review is to provide comprehensive knowledge on the ethnopharmacology, phytochemistry, and pharmacological activities of Shuizhi. It will provide a potential guidance in exploring main active compounds of Shuizhi and interpreting the action mechanism for the further research. PMID:27274755

  6. Central nervous system regeneration: from leech to opossum.

    PubMed

    Mladinic, M; Muller, K J; Nicholls, J G

    2009-06-15

    A major problem of neurobiology concerns the failure of injured mammalian spinal cord to repair itself. This review summarizes work done on two preparations in which regeneration can occur: the central nervous system of an invertebrate, the leech, and the spinal cord of an immature mammal, the opossum. The aim is to understand cellular and molecular mechanisms that promote and prevent regeneration. In the leech, an individual axon regrows successfully to re-establish connections with its synaptic target, while avoiding other neurons. Functions that were lost are thereby restored. Moreover, pairs of identified neurons become re-connected with appropriate synapses in culture. It has been shown that microglial cells and nitric oxide play key roles in leech CNS regeneration. In the opossum, the neonatal brain and spinal cord are so tiny that they survive well in culture. Fibres grow across spinal cord lesions in neonatal animals and in vitro, but axon regeneration stops abruptly between postnatal days 9 and 12. A comprehensive search has been made in spinal cords that can and cannot regenerate to identify genes and establish their locations. At 9 days, growth-promoting genes, their receptors and key transcription molecules are up-regulated. By contrast at 12 days, growth-inhibitory molecules associated with myelin are prominent. The complete sequence of the opossum genome and new methods for transfecting genes offer ways to determine which molecules promote and which inhibit spinal cord regeneration. These results lead to questions about how basic research on mechanisms of regeneration could be 'translated' into effective therapies for patients with spinal cord injuries.

  7. Central nervous system regeneration: from leech to opossum

    PubMed Central

    Mladinic, M; Muller, K J; Nicholls, J G

    2009-01-01

    A major problem of neurobiology concerns the failure of injured mammalian spinal cord to repair itself. This review summarizes work done on two preparations in which regeneration can occur: the central nervous system of an invertebrate, the leech, and the spinal cord of an immature mammal, the opossum. The aim is to understand cellular and molecular mechanisms that promote and prevent regeneration. In the leech, an individual axon regrows successfully to re-establish connections with its synaptic target, while avoiding other neurons. Functions that were lost are thereby restored. Moreover, pairs of identified neurons become re-connected with appropriate synapses in culture. It has been shown that microglial cells and nitric oxide play key roles in leech CNS regeneration. In the opossum, the neonatal brain and spinal cord are so tiny that they survive well in culture. Fibres grow across spinal cord lesions in neonatal animals and in vitro, but axon regeneration stops abruptly between postnatal days 9 and 12. A comprehensive search has been made in spinal cords that can and cannot regenerate to identify genes and establish their locations. At 9 days, growth-promoting genes, their receptors and key transcription molecules are up-regulated. By contrast at 12 days, growth-inhibitory molecules associated with myelin are prominent. The complete sequence of the opossum genome and new methods for transfecting genes offer ways to determine which molecules promote and which inhibit spinal cord regeneration. These results lead to questions about how basic research on mechanisms of regeneration could be ‘translated’ into effective therapies for patients with spinal cord injuries. PMID:19525562

  8. Control of epileptiform bursting in the leech heart interneuron

    NASA Astrophysics Data System (ADS)

    Barnett, William; Anquez, Martin; Harris, Torrey; Cymbalyuk, Gennady

    2009-11-01

    The network controlling heartbeat in the medicinal leech contains leech heart interneurons (HNs). We modeled them under specific pharmacological conditions. The Ca^2+ currents were blocked by Co^2+. The K^+ currents, apart from the non-inactivating current, IK2, were blocked by 4AP. The hyperpolarization-activated current, Ih, was blocked by Cs^+. Under these conditions, epileptiform bursting characterized by long interburst intervals (IBI) has been shown. We considered three distinct cases. Model 1 included IK2, Ih, and the fast Na^+ current, INa. Model 2 was characterized by INa, IK2, and the persistent Na^+ current, INaP. Model 3 consisted of INa, IK2, Ih, and INaP. We also investigated the bi-stability of bursting and silence as the leak conductance, gleak, was varied. We showed that in 1 and 3, model HNs demonstrated bi-stability of silence and bursting. We analyzed how IBI and burst duration are controlled by the manipulation of Ih and INaP. In 1, as V1/2 of Ih decreased, IBI grew towards infinity one over the square root of the parameter difference. In 2, we showed that as gNaP decreased from 6.156 nS to 6.155 nS, IBI grew in accordance with the one over square root law. The system underwent a saddle-node bifurcation just below 6.155 nS. Supported by NSF PHY-0750456.

  9. STUDIES ON RARE AND POORLY KNOWN LEECHES (ANNELIDA: HIRUDINEA: GLOSSIPHONIIDAE) IN EASTERN NORTH AMERICA

    EPA Science Inventory

    Three taxa within the leech family Glossiphoniidae, Actinobdella inequiannulata, Placobdella hollensis, and Theromyzon spp., though widespread in eastern North America, remain poorly known with respect to their biology and systematics. All three taxa have been collected in New E...

  10. A new species of glossiphoniid leech from Rana pretiosa (Amphibia: Ranidae) in Oregon.

    PubMed

    Siddall, Mark E; Bowerman, Jay

    2006-08-01

    A new species of ectoparasitic glossiphoniid leech was found feeding on frogs in the Nature Center Pond and elsewhere in Deschutes County, Oregon. The new species of Placobdella resembles the southern alligator leech, Placobdella multilineata Moore, 1953, notwithstanding their vast geographic separation in North America. The new species is readily distinguished by possessing subdivided annuli, by its papillation and pigmentation patterns as well as by the arrangement of ovarian tissues. There is strong evidence of nocturnality and of the potential for parasitizing humans.

  11. Extracellular recording of Hirudo medicinalis neurons using high density, nanocoax neurointerface array

    NASA Astrophysics Data System (ADS)

    Naughton, Jeffrey R.; Aasen, Margaret H.; Burns, Michael J.; Chiles, Thomas C.; Naughton, Michael J.

    2013-03-01

    We describe the development of a nanocoax-based neuroelectronic array with submicron pixelation with potential for recording and stimulation with high spatial and temporal resolution. Our device is composed of an array of nanoscale open-ended coaxial electrodes addressed in either a group or individual configuration. As a neuroelectronic interface, our device is characterized by noninvasive real-time coupling to the ganglion sac located along the main nerve cord of the Hirudo medicinalis. This allows for extracellular recording of interneural synaptic activity, while also showing the capability of actuating precisely-localized stimulation (faradaic regime). We report on initial results from measurements of electrical signals associated with induced and spontaneous synapse firing in pre- and post-synaptic somata. This work is partially supported by the BC Institute on Aging.

  12. New Records of Lake Baikal Leech Fauna: Species Diversity and Spatial Distribution in Chivyrkuy Gulf

    PubMed Central

    Kaygorodova, Irina A.; Pronin, Nikolay M.

    2013-01-01

    The study of several Lake Baikal leech collections offered us the possibility to determine species diversity in the Chivyrkuy Gulf, the biggest one in the lake. As a result, the first information on the Chivyrkuy Hirudinea fauna (Annelida, Clitellata) has been revealed. There are two orders and four families of leeches in the Chivyrkuy Gulf: order Rhynchobdellida (families Glossiphoniidae and Piscicolidae) and order Arhynchobdellida (families Erpobdellidae and Haemopidae). In total, 22 leech species and 2 subspecies belonging to 11 genera were identified. Of these, 4 taxa belong to the family Glossiphoniidae (G. concolor, A. hyalina, A. heteroclita f. papillosa, and A. heteroclita f. striata) recorded in Baikal for the first time. Representatives of 8 unidentified species (Glossophinia sp., Baicaloclepsis sp., Baicalobdella sp., Piscicola sp. 1, Piscicola sp. 2, Erpobdella sp. 1, Erpobdella sp. 2, and Erpobdella sp. 3) have been also recorded. The checklist gives a contemporary overview of the species composition of leech parasites, their hosts, and distribution within the Chivyrkuy Gulf. The analysis of spatial distribution has shown that the leech species diversity is correlated with the biological productivity of the bay. The most diverse community of leech species is detected in the eutrophic zone of the lake. PMID:23844382

  13. Detection of Viral Hemorrhagic Septicemia virus (VHSV) from the leech Myzobdella lugubris Leidy, 1851.

    PubMed

    Faisal, Mohamed; Schulz, Carolyn A

    2009-09-28

    The leech Myzobdella lugubris is widespread in the Lake Erie Watershed, especially Lake St. Clair. However, its role in pathogen transmission is not fully understood. In this same watershed, several widespread fish mortalities associated with the Viral Hemorrhagic Septicemia virus (VHSV) were recorded. Viral Hemorrhagic Septicemia is an emerging disease in the Great Lakes Basin that is deadly to the fish population, yet little is known about its mode of transmission. To assess the potential role of M. lugubris in VHSV transmission, leeches were collected from Lake St. Clair and Lake Erie and pooled into samples of five. Cell culture and reverse transcriptase polymerase chain reaction (RT-PCR) were used to determine the presence of the virus and its identity. Results showed that 57 of the 91 pooled leech samples were positive by cell culture for VHSV and 66 of the 91 pooled leech samples were positive by RT-PCR for the VHSV. Two representative virus isolates were sequenced for further genetic confirmation and genotype classification. VHSV detected within M. lugubris was homologous to the Great Lakes strain of VHSV genotype IVb. This is the first record of the VHSV being detected from within a leech, specifically M. lugubris, and suggests the potential of M. lugubris being involved in VHSV transmission.

  14. Specialized brain regions and sensory inputs that control locomotion in leeches

    PubMed Central

    Mullins, Olivia J.; Brodfuehrer, Peter D.; Jusufović, Saša; Hackett, John T.; Friesen, W. Otto

    2011-01-01

    Locomotor systems are often controlled by specialized cephalic neurons and undergo modulation by sensory inputs. In many species, dedicated brain regions initiate and maintain behavior and set the duration and frequency of the locomotor episode. In the leech, removing the entire head brain enhances swimming, but the individual roles of its components, the supra- and subesophageal ganglia, in the control of locomotion are unknown. Here we describe the influence of these two structures and that of the tail brain on rhythmic swimming in isolated nerve cord preparations and in nearly-intact leeches suspended in an aqueous, “swim-enhancing” environment. We found that, in isolated preparations, swim episode duration and swim burst frequency are greatly increased when the supraesophageal ganglion is removed, but the subesophageal ganglion is intact. The prolonged swim durations observed with the anterior-most ganglion removed were abolished by removal of the tail ganglion. Experiments on the nearly intact leeches show that, in these preparations, the subesophageal ganglion acts to decrease cycle period but, unexpectedly, also decreases swim duration. These results suggest that the supraesophageal ganglion is the primary structure that constrains leech swimming; however, the control of swim duration in the leech is complex, especially in the intact animal. PMID:22037913

  15. Detection of Viral Hemorrhagic Septicemia virus (VHSV) from the leech Myzobdella lugubris Leidy, 1851

    PubMed Central

    Faisal, Mohamed; Schulz, Carolyn A

    2009-01-01

    The leech Myzobdella lugubris is widespread in the Lake Erie Watershed, especially Lake St. Clair. However, its role in pathogen transmission is not fully understood. In this same watershed, several widespread fish mortalities associated with the Viral Hemorrhagic Septicemia virus (VHSV) were recorded. Viral Hemorrhagic Septicemia is an emerging disease in the Great Lakes Basin that is deadly to the fish population, yet little is known about its mode of transmission. To assess the potential role of M. lugubris in VHSV transmission, leeches were collected from Lake St. Clair and Lake Erie and pooled into samples of five. Cell culture and reverse transcriptase polymerase chain reaction (RT-PCR) were used to determine the presence of the virus and its identity. Results showed that 57 of the 91 pooled leech samples were positive by cell culture for VHSV and 66 of the 91 pooled leech samples were positive by RT-PCR for the VHSV. Two representative virus isolates were sequenced for further genetic confirmation and genotype classification. VHSV detected within M. lugubris was homologous to the Great Lakes strain of VHSV genotype IVb. This is the first record of the VHSV being detected from within a leech, specifically M. lugubris, and suggests the potential of M. lugubris being involved in VHSV transmission. PMID:19785752

  16. Allium sativum L.: the anti-immature leech (Limnatis nilotica) activity compared to Niclosomide.

    PubMed

    Bahmani, Mahmoud; Abbasi, Javad; Mohsenzadegan, Ava; Sadeghian, Sirous; Ahangaran, Majid Gholami

    2013-03-01

    This study was carried out to determine the effects of methanolic extracts of Allium sativum L. on Limnatis nilotica compared with Niclosomide. In this experimental study in September 2010, a number of leeches (70 in total) from the southern area of Ilam province were prepared, and the effects of methanolic extract of A. sativum L. with Niclosomide as the control drug were compared and distilled water was evaluated as the placebo group which investigated L. nilotica using anti-leech assay. The average time of paralysis and death of L. nilotica for Niclosomide (1,250 mg/kg) and the methanol extract of A. sativum L. (600 μg/ml) were 6.22 ± 2.94 and 68.44 ± 28.39 min, respectively. Distilled water and garlic tablets at a dose of 400 mg were determined as the inert group. In this research, the attraction time of the leeches' death among different treatments is significant. In this study, it was determined that Niclosomide, with an intensity of 4+, and methanolic extracts of A. sativum L., with an intensity of 3+, have a good anti-leech effect and can be shown to be effective in cases of leech biting, while distilled water was negative.

  17. Bugs as drugs, part two: worms, leeches, scorpions, snails, ticks, centipedes, and spiders.

    PubMed

    Cherniack, E Paul

    2011-03-01

    In this second of a two-part series analyzing the evidence for the use of organisms as medicine, the use of a number of different "bugs" (worms, leeches, snails, ticks, centipedes, and spiders) is detailed. Several live organisms are used as treatments: leeches for plastic surgery and osteoarthritis and the helminths Trichuris suis and Necator americanus for inflammatory bowel disease. Leech saliva is the source of a number of anticoagulants, including the antithrombin agent hirudin and its synthetic analogues, which have been approved for human use. Predatory arthropods, such as certain species of snails, spiders, scorpions, centipedes, and ticks provide a trove of potential analgesic peptides in their venom. A synthetic analogue of a snail venom peptide, ziconotide, has been approved for human use and is used as an alternative to opioids in severe pain cases. Arthropods, such as ticks, have venom that contains anticoagulants and centipede venom has a protein that corrects abnormalities in lipid metabolism.

  18. Triassic leech cocoon from Antarctica contains fossil bell animal

    NASA Astrophysics Data System (ADS)

    Bomfleur, Benjamin; Kerp, Hans; Taylor, Thomas N.; Moestrup, Øjvind; Taylor, Edith L.

    2012-12-01

    Our understanding of the evolution of life on Earth is limited by the imperfection of the fossil record. One reason for this imperfect record is that organisms without hard parts, such as bones, shells, and wood, have a very low potential to enter the fossil record. Occasionally, however, exceptional fossil deposits that preserve soft-bodied organisms provide a rare glimpse of the true biodiversity during past periods of Earth history. We here present an extraordinary find of a fossil ciliate that is encased inside the wall layer of a more than 200 Ma leech cocoon from Antarctica. The microfossil consists of a helically contractile stalk that attaches to a main body with a peristomial feeding apparatus and a large C-shaped macronucleus. It agrees in every aspect with the living bell animals, such as Vorticella. Vorticellids and similar peritrichs are vital constituents of aquatic ecosystems worldwide, but so far have lacked any fossil record. This discovery offers a glimpse of ancient soft-bodied protozoan biotas, and also highlights the potential of clitellate cocoons as microscopic "conservation traps" comparable to amber.

  19. Channel modulation by tyrosine phosphorylation in an identified leech neuron.

    PubMed Central

    Aniksztejn, L; Catarsi, S; Drapeau, P

    1997-01-01

    1. We have examined the effects of tyrosine phosphorylation on a spontaneously active cation channel that also participates in the modulation of pressure-sensitive (P) neurons in the leech. Cation channel activity in cell-attached or isolated, inside-out membrane patches from P cells in culture was monitored before and after treatments that altered the level of tyrosine phosphorylation. 2. In cell-attached recordings from intact P cells, bath application of genistein, an inhibitor of tyrosine kinases, resulted in a 6.6 +/- 2.6-fold increase in channel activity with no change in the mean open time or amplitude. Daidzein, an inactive form of genistein, was without effect. Addition of pervanadate, a membrane-permeant inhibitor of tyrosine phosphatases, had no effect on its own and blocked the effect of subsequent addition of genistein. 3. In inside-out P cell membrane patch recordings, exposure to a catalytically active fragment of a tyrosine phosphatase resulted in a 10.3 +/- 3.6-fold increase in channel activity with no change in the mean open time or amplitude. Orthovanadate had no effect on channel activity and, when added with the phosphatase, prevented the increase in activity. 4. Our results demonstrate that the basal activity of cation channels is increased by tyrosine dephosphorylation, suggesting a constitutive modulation of channel activity under resting conditions. PMID:9023773

  20. Triassic leech cocoon from Antarctica contains fossil bell animal.

    PubMed

    Bomfleur, Benjamin; Kerp, Hans; Taylor, Thomas N; Moestrup, Øjvind; Taylor, Edith L

    2012-12-18

    Our understanding of the evolution of life on Earth is limited by the imperfection of the fossil record. One reason for this imperfect record is that organisms without hard parts, such as bones, shells, and wood, have a very low potential to enter the fossil record. Occasionally, however, exceptional fossil deposits that preserve soft-bodied organisms provide a rare glimpse of the true biodiversity during past periods of Earth history. We here present an extraordinary find of a fossil ciliate that is encased inside the wall layer of a more than 200 Ma leech cocoon from Antarctica. The microfossil consists of a helically contractile stalk that attaches to a main body with a peristomial feeding apparatus and a large C-shaped macronucleus. It agrees in every aspect with the living bell animals, such as Vorticella. Vorticellids and similar peritrichs are vital constituents of aquatic ecosystems worldwide, but so far have lacked any fossil record. This discovery offers a glimpse of ancient soft-bodied protozoan biotas, and also highlights the potential of clitellate cocoons as microscopic "conservation traps" comparable to amber.

  1. Triassic leech cocoon from Antarctica contains fossil bell animal

    PubMed Central

    Bomfleur, Benjamin; Kerp, Hans; Taylor, Thomas N.; Moestrup, Øjvind; Taylor, Edith L.

    2012-01-01

    Our understanding of the evolution of life on Earth is limited by the imperfection of the fossil record. One reason for this imperfect record is that organisms without hard parts, such as bones, shells, and wood, have a very low potential to enter the fossil record. Occasionally, however, exceptional fossil deposits that preserve soft-bodied organisms provide a rare glimpse of the true biodiversity during past periods of Earth history. We here present an extraordinary find of a fossil ciliate that is encased inside the wall layer of a more than 200 Ma leech cocoon from Antarctica. The microfossil consists of a helically contractile stalk that attaches to a main body with a peristomial feeding apparatus and a large C-shaped macronucleus. It agrees in every aspect with the living bell animals, such as Vorticella. Vorticellids and similar peritrichs are vital constituents of aquatic ecosystems worldwide, but so far have lacked any fossil record. This discovery offers a glimpse of ancient soft-bodied protozoan biotas, and also highlights the potential of clitellate cocoons as microscopic “conservation traps” comparable to amber. PMID:23213234

  2. Sibling competition in a brood-tending leech

    PubMed Central

    Burd, Martin; Govedich, Fredric R; Bateson, Laura

    2006-01-01

    Conflict among siblings over parental investment, particularly over parental feeding, is a feature of family life in many kinds of animals. In some bird species, the size of prey items provided to juveniles has been implicated as a cause of aggressive competition among sibling chicks, because prey size determines whether dominance allows monopolization of parental offerings. Our experiment was meant to test the generality of this factor in creating intrafamilial conflict. We investigated sibling competition in relation to prey size using the carnivorous, brood-tending leech Helobdella papillornata. We equalized the total amount of food available to H. papillornata broods, but varied the size of individual prey items. Competition, measured by disparity in body size at independence, was more intense in broods provisioned with small items than in broods receiving large items, but similar between broods receiving large items and broods fed ad libitum. These patterns suggest that the intensity of conflict did not depend only on the total food amount, but was enhanced by small prey size. Our results indicate that conflict over the provision of parental resources to offspring can have a similar basis across very dissimilar organisms. PMID:16959636

  3. Excitotoxicity of lathyrus sativus neurotoxin in leech retzius neurons.

    PubMed

    Cemerikic, D; Nedeljkov, V; Lopicic, S; Dragovic, S; Beleslin, B

    2001-01-01

    The effects of Lathyrus sativus neurotoxin were studied on the cell membrane potential and cellular cation composition in Retzius nerve cells of the leech Haemopis sanguisuga, with ion-selective microelectrodes using liquid ion-exchangers. Bath application of 10(-4) mol/l Lathyrus sativus neurotoxin for 3 min depolarized the cell membrane potential and decreased the input resistance of directly polarized membrane in Retzius neurons. At the same time the cellular Na+ activity increased and cellular K+ activity decreased with slow but complete recovery, while the intracellular Ca2+ concentration was not changed. Na+-free Ringer solutions inhibited the depolarizing effect of the neurotoxin on the cell membrane potential. Zero-Ca2+ Ringer solution or Ni2+-Ringer solution had no influence on the depolarizing effect of the neurotoxin on the cell membrane potential. It is obvious that the increase in membrane conductance and depolarization of the cell membrane potential are due to an influx of Na+ into the cell accompanied by an efflux of K+ from the cell.

  4. Medicinal Leech Therapy for Glans Penis Congestion After Primary Bladder Exstrophy-Epispadias Repair in an Infant: A Case Report.

    PubMed

    Wagenheim, Gavin N; Au, Jason; Gargollo, Patricio C

    2016-01-01

    Many postoperative complications have been reported after repair of classic bladder exstrophy. We present a case of medicinal leech therapy for glans penis congestion following exstrophy repair in an infant. A 2-week-old male with classic bladder exstrophy underwent complete primary repair. On postoperative day 1, he developed rapidly worsening glans penis venous congestion. Medicinal leech therapy was instituted with antibiotics and blood transfusions to maintain a hematocrit >30%. After 24 hours, venous congestion improved and therapy was discontinued. The patient's remaining hospital course was uncomplicated. Medicinal leeches are an effective therapy to relieve glans penis venous congestion.

  5. Free Flap Salvage after Recurrent Venous Thrombosis by Means of Large-Scale Treatment with Medical Leeches

    PubMed Central

    Fujiki, Masahide; Arikawa, Masaki; Kagaya, Yu; Miyamoto, Shimpei

    2016-01-01

    Summary: An anterolateral thigh flap was salvaged using 110 medical leeches in the absence of an available vein for reanastomosis. After surgical construction of the flap for full-thickness thoracic wall reconstruction, the patient developed complete venous occlusion. Specifically, the anastomotic vein developed complete occlusion, and the internal jugular vein had a thrombus. In addition, because the lung was posterior to the flap, the angiogenic area of the flap was very small. When the medical leeches were first applied, the flap showed prominent venous congestion. However, the congestion began to resolve by day 6 of leech use, leading to complete survival of the flap. PMID:28293509

  6. Experimental infection of yellow stingrays Urobatis jamaicensis with the marine leech Branchellion torpedinis.

    PubMed

    Marancik, David P; Dove, Alistair D; Camus, Alvin C

    2012-10-10

    Infestations of elasmobranchs by the marine leech Branchellion torpedinis can be problematic in aquaria and negatively affect host health. To better characterize the extent and pathogenesis of disease, 12 yellow stingrays Urobatis jamaicensis were infected with 1 or 3 leeches for 14 d. Leeches were associated with anorexia, extensive cutaneous ulceration, decreased host packed cell volume (PCV) and serum total solids (TS), and mortality in 3 rays. Average decrease in host PCV positively correlated with ulcer size and parasite:host ratio. Average decrease in host serum TS positively correlated with parasite:host ratio. Blood chemistry and total white blood cell counts revealed no significant trends. Additional necropsy findings included gill and splenic pallor, pericardial edema, perirenal edema, and decreased hepatocellular lipid deposits. Microscopic evaluation of leeches demonstrated host erythrocytes and proteinaceous fluid within parasite intestines, confirming active blood feeding. Results indicate B. torpedinis has the potential to cause significant disease in elasmobranchs, including death in as few as 5 d, and identifies ulcer size and parasite:host ratio as risk factors for disease. Elucidation of this host-parasite interaction helps characterize host response to parasites and facilitate care of parasitized elasmobranchs in aquarium and wild settings.

  7. High contrast imaging at the LBT: the LEECH exoplanet imaging survey

    NASA Astrophysics Data System (ADS)

    Skemer, Andrew J.; Hinz, Philip; Esposito, Simone; Skrutskie, Michael F.; Defrère, Denis; Bailey, Vanessa; Leisenring, Jarron; Apai, Daniel; Biller, Beth; Bonnefoy, Mickaël.; Brandner, Wolfgang; Buenzli, Esther; Close, Laird; Crepp, Justin; De Rosa, Robert J.; Desidera, Silvano; Eisner, Josh; Fortney, Jonathan; Henning, Thomas; Hofmann, Karl-Heinz; Kopytova, Taisiya; Maire, Anne-Lise; Males, Jared R.; Millan-Gabet, Rafael; Morzinski, Katie; Oza, Apurva; Patience, Jenny; Rajan, Abhijith; Rieke, George; Schertl, Dieter; Schlieder, Joshua; Su, Kate; Vaz, Amali; Ward-Duong, Kimberly; Weigelt, Gerd; Woodward, Charles E.; Zimmerman, Neil

    2014-07-01

    In Spring 2013, the LEECH (LBTI Exozodi Exoplanet Common Hunt) survey began its ~130-night campaign from the Large Binocular Telescope (LBT) atop Mt Graham, Arizona. This survey benefits from the many technological achievements of the LBT, including two 8.4-meter mirrors on a single fixed mount, dual adaptive secondary mirrors for high Strehl performance, and a cold beam combiner to dramatically reduce the telescope's overall background emissivity. LEECH neatly complements other high-contrast planet imaging efforts by observing stars at L' (3.8 μm), as opposed to the shorter wavelength near-infrared bands (1-2.4 μm) of other surveys. This portion of the spectrum offers deep mass sensitivity, especially around nearby adolescent (~0.1-1 Gyr) stars. LEECH's contrast is competitive with other extreme adaptive optics systems, while providing an alternative survey strategy. Additionally, LEECH is characterizing known exoplanetary systems with observations from 3-5μm in preparation for JWST.

  8. Avulsion of the auricle in an anticoagulated patient: is leeching contraindicated? A review and a case.

    PubMed

    Mommsen, Jens; Rodríguez-Fernández, Javier; Mateos-Micas, Mario; Vázquez-Bouso, Olga; Gumbao-Grau, Victor; Forteza-Gonzalez, Gabriel

    2011-06-01

    Amputation of the auricle is a periodic occurrence leading to disfigurement if not treated properly. Venous stasis is a common complication in reattachments and requires decongestant and anticoagulant treatment. Today, leech therapy is the treatment of choice. Common problems are that it is not available everywhere and that it is usually contraindicated in anticoagulated patients. The peculiarities of leech therapy and the various aspects of surgical management are reviewed. A case of a partial amputation of the auricle in a patient under concomitant anticoagulation therapy with warfarin is presented. The amputated part was reattached in another hospital without microvascular anastomosis. The patient presented to our department with early signs of venous congestion. Leech therapy was started 35 hours after trauma, and the patient continued his anticoagulation therapy. With this treatment, 90% of the amputated part was rescued. The anticoagulation therapy of the patient may have played an important role in the first hours after reattachment, preventing capillary thrombosis and in consequence facilitating the minimal oxygenation necessary. The claim that anticoagulation therapy is a contraindication to leeching should be questioned in cases of reattachments in well-controllable locations without arterial anastomosis.

  9. Avulsion of the Auricle in an Anticoagulated Patient: Is Leeching Contraindicated? A Review and a Case

    PubMed Central

    Mommsen, Jens; Rodríguez-Fernández, Javier; Mateos-Micas, Mario; Vázquez-Bouso, Olga; Gumbao-Grau, Victor; Forteza-Gonzalez, Gabriel

    2011-01-01

    Amputation of the auricle is a periodic occurrence leading to disfigurement if not treated properly. Venous stasis is a common complication in reattachments and requires decongestant and anticoagulant treatment. Today, leech therapy is the treatment of choice. Common problems are that it is not available everywhere and that it is usually contraindicated in anticoagulated patients. The peculiarities of leech therapy and the various aspects of surgical management are reviewed. A case of a partial amputation of the auricle in a patient under concomitant anticoagulation therapy with warfarin is presented. The amputated part was reattached in another hospital without microvascular anastomosis. The patient presented to our department with early signs of venous congestion. Leech therapy was started 35 hours after trauma, and the patient continued his anticoagulation therapy. With this treatment, 90% of the amputated part was rescued. The anticoagulation therapy of the patient may have played an important role in the first hours after reattachment, preventing capillary thrombosis and in consequence facilitating the minimal oxygenation necessary. The claim that anticoagulation therapy is a contraindication to leeching should be questioned in cases of reattachments in well-controllable locations without arterial anastomosis. PMID:22655116

  10. The Physiology and Mechanics of Undulatory Swimming: A Student Laboratory Exercise Using Medicinal Leeches

    ERIC Educational Resources Information Center

    Ellerby, David J.

    2009-01-01

    The medicinal leech is a useful animal model for investigating undulatory swimming in the classroom. Unlike many swimming organisms, its swimming performance can be quantified without specialized equipment. A large blood meal alters swimming behavior in a way that can be used to generate a discussion of the hydrodynamics of swimming, muscle…

  11. LIFE HISTORY AND DISTRIBUTION OF THE LEECH OLIGOBDELLA BIANNULATA (MOORE, 1900) (EUHIRUDINEA: GLOSSIPHONNIDAE)

    EPA Science Inventory

    Oligobdella biannulata (Moore, 1900) is a rare, endemic leech species originally described from a mountain stream near Blowing Rock, North Carolina. Specimens of O. biannulata were collected seasonally from Fall 1999, to Summer 2002, with new county records in North Carolina and ...

  12. ERPOBDELLA LAHONTANA (ANNELIDA: HIRUDINEA: ARHYNCHOBDELLIDA: ERPOBDELLIDAE), A NEW SPECIES OF FRESHWATER LEECH FROM NORTH AMERICA

    EPA Science Inventory

    New species of a leech, Erpobdella lahontana, is described from the Lahontan Basin in California and Nevada of the western United States. This species has four pairs of eyes, the preatrial loops of male paired ducts extend to ganglion XI, and the male and female gonopores are loc...

  13. A review of Luxiaria Walker and its allied genus Calletaera Warren (Lepidoptera, Geometridae, Ennominae) from China.

    PubMed

    Jiang, Nan; Xue, Dayong; Han, Hongxiang

    2014-08-21

    The genus Luxiaria Walker and its allied genus Calletaera Warren in China, including 16 species in all, are reviewed. Five new species are described: C. obvia sp. nov., C. acuticornuta sp. nov., C. rotundicornuta sp. nov., C. dentata sp. nov., C. trigonoprocessus sp. nov. The species L. acutaria (Snellen, 1877) and L. tephrosaria (Moore, 1868) are newly recorded for China. Two new combinations are established: C. obliquata (Moore, 1888) comb. nov. and C. consimilaria (Leech, 1897) comb. nov. Four new synonyms are established: Eutoea Walker, 1860 (= Bithiodes Warren, 1894 syn. nov.); Calletaera Warren, 1895 (=Bithiodes Warren, 1899 syn. nov.), based on the fixation of nominal type Acidalia inexactata Walker, 1861, for the genus name Bithiodes Warren, 1894; L. emphatica Prout, 1925 (= L. costinota Inoue, 1978 syn. nov.); C. subexpressa (Walker, 1861) (= C. digrammata Wehrli, 1925 syn. nov.). Diagnoses for all Chinese species are provided. Illustrations of external features and genitalia are presented. 

  14. Infections following the application of leeches: two case reports and review of the literature

    PubMed Central

    2012-01-01

    Introduction Since the 1980s, leeches have been ingeniously used in the management of venous flap congestion. The presence of anticoagulative substances in their saliva improves the blood drainage. Their digestive tract contains several bacterial species, the main ones being Aeromonas hydrophila and Aeromonas veronii biovar sobria, which contribute to the digestion of ingested blood. These bacteria can be the cause of infections. Case presentation We report two cases of septicemia related to Aeromonas veronii biovar sobria that presented after leeches had been applied to congested transverse rectus abdominis myocutaneous flaps for delayed mammary reconstructions. Patient number 1 was a 55-year-old Caucasian woman who underwent a delayed breast reconstruction procedure. On the sixth postoperative day she showed a clinical presentation of septicemia. Aeromonas veronii biovar sobria was identified in the patient’s skin and blood bacteriological samples. Her fever ceased after 4 days of antibiotic treatment. Patient number 2 was a 56-year-old Caucasian woman who underwent a delayed breast reconstruction procedure. On the seventh postoperative day we noticed that she showed a clinical presentation of septicemia. Aeromonas veronii biovar sobria was identified in the patient’s blood cultures and local bacteriological samples. An antibiogram showed resistance to amoxicillin/clavulanic acid. Her fever ceased on the eleventh postoperative day after 4 days of antibiotic treatment. Conclusion The rate of infection after application of leeches is not negligible. The concentration of Aeromonas inside the digestive tracts of leeches largely decreases when the patient is under antibiotic therapy. These germs are sensitive to third-generation cephalosporins and fluoroquinolones and resistant to amoxicillin/clavulanic acid. We recommend preventive treatment based on classical measures of asepsis and on oral antibioprophylaxy with a fluoroquinolone during the whole period of

  15. BIOLOGY AND OCCURRENCE OF THE LEECH, ACTINOBDELLA INEQUIANNULATA (ANNELIDA: HIRUDINEA: GLOSSIPHONIIDAE) PARASITIC ON TWO SPECIES OF SUCKERS

    EPA Science Inventory

    Actinobdella inequiannulata was found on the white sucker, Catostomus commersoni, and less frequently on the longnose sucker, Catostomus catostomus, in Algonquin Provincial Park, Ontario, Canada. This study established the presence of only one species of leech, Actinobdela inequ...

  16. A new leech species (Hirudinida: Erpobdellidae: Erpobdella) from a cave in the West Azerbaijan province of Iran.

    PubMed

    Cichocka, Joanna M; Bielecki, Aleksander; Kur, Jarosław; Pikuła, Dorota; Kilikowska, Adrianna; Biernacka, Beata

    2015-09-09

    Erpobdella borisi n. sp. is a predatory leech inhabiting cave waters in Iran. Probably, it is either a troglobiont or troglophile. The leech has no eyes, and the complete mid-body somite is divided unequally into five annuli. Results of phylogenetic analysis based on morphological characters and COI gene sequence indicate the species to be closely related to Erpobdella japonica, E. octoculata and E. testacea.

  17. Earthquake relocation near the Leech River Fault, southern Vancouver Island

    NASA Astrophysics Data System (ADS)

    Li, G.; Liu, Y.; Regalla, C.

    2015-12-01

    The Leech River Fault (LRF), a northeast dipping thrust, extends across the southern tip of Vancouver Island in Southwest British Columbia, where local tectonic regime is dominated by the subduction of the Juan de Fuca plate beneath the North American plate at the present rate of 40-50 mm/year. British Columbia geologic map (Geoscience Map 2009-1A) shows that this area also consists of many crosscutting minor faults in addition to the San Juan Fault north of the LRF. To investigate the seismic evidence of the subsurface structures of these minor faults and of possible hidden active structures in this area, precise earthquake locations are required. In this study, we relocate 941 earthquakes reported by Canadian National Seismograph Network (CNSN) catalog from 2000 to 2015 within a 100km x 55km study area surrounding the LRF. We use HypoDD [Waldhauser, F., 2001] double-difference relocation method by combining P/S phase arrivals provided by the CNSN at 169 stations and waveform data with correlation coefficient values greater than 0.7 at 50 common stations and event separation less than 10km. A total of 900 out of the 931 events satisfy the above relocation criteria. Velocity model used is a 1-D model extracted from the Ramachandran et al. (2005) model. Average relative location errors estimated by the bootstrap method are 546.5m (horizontal) and 1128.6m (in depth). Absolute errors reported by SVD method for individual clusters are ~100m in both dimensions. We select 5 clusters visually according to their epicenters (see figure). Cluster 1 is parallel to the LRF and a thrust FID #60. Clusters 2 and 3 are bounded by two faults: FID #75, a northeast dipping thrust marking the southwestern boundary of the Wrangellia terrane, and FID #2 marking the northern boundary. Clusters 4 and 5, to the northeast and northwest of Victoria respectively, however, do not represent the surface traces of any mapped faults. The depth profile of Cluster 5 depicts a hidden northeast

  18. Humoral response of captive zebra sharks Stegostoma fasciatum to salivary gland proteins of the leech Branchellion torpedinis.

    PubMed

    Marancik, David P; Leary, John H; Fast, Mark M; Flajnik, Martin F; Camus, Alvin C

    2012-10-01

    Parasitism by the marine leech Branchellion torpedinis is known to cause disease and mortality in captive elasmobranchs and is difficult to control when inadvertently introduced into public aquaria. Preliminary characterization of the salivary gland transcriptome of B. torpedinis has identified anticoagulants, proteases, and immunomodulators that may be secreted into host tissues to aid leech feeding. This retrospective study examined antigen-specific serum IgM responses in captive zebra sharks Stegostoma fasciatum to leech salivary gland extract. Antibody response was examined by ELISA and Western blot assays in 20 serum samples from six zebra sharks, with a 5 year history of leech infection, and 18 serum samples from 8 captive bred zebra sharks, with no history of leech exposure. ELISA demonstrated significantly higher serum IgM titers to salivary gland extract in exposed zebra sharks compared to the non-exposed population. No obvious trends in antibody titers were appreciated in exposed zebra sharks over a four-year period. One-dimensional and two-dimensional Western blot assays revealed IgM targeted specific salivary gland proteins within the 40, 55, 70 and 90 kD range. Antigenic proteins identified by liquid chromatography-tandem mass spectrometry and de novo peptide sequencing include a secreted disintegrin, metalloproteinase and thrombospondin motif containing protein (ADAMTS), tubulin, aldehyde dehydrogenase and two unknown proteins. Humoral immune responses to leech salivary gland proteins warrants further investigation as there may be options to exploit immune mechanisms to reduce parasite burdens in aquaria.

  19. A new species and two new combinations in the genus Strotihypera Kononenko & Han, 2011 (Lepidoptera, Noctuidae, Noctuinae: Elaphriini). A postscript to the description of the genus Strotihypera.

    PubMed

    Han, H L; Kononenko, V S

    2015-10-30

    Elaphriini is a small tribe of the subfamily Noctuinae with predominantly New World distribution. Only three genera, Elaphria Hübner, 1818 with four species, Galgula Guenée, 1852 with one species (Fibiger & Hacker 2010) and Strotihypera Kononenko & Han, 2011 with one species are known from the Eurasia. The majority of species occurs in tropical and subtropical regions. The review of Eurasian Elaphriini with description of the new genus Strotihypera has recently been published by Kononenko & Han (2011). In the subsequent years in the result of intensive collecting in South West China we found a new species allied to Strotihypera flavipuncta (Leech, 1889) and two related species Strotihypera ochreipuncta (Wileman, 1914), comb. n. and "Hyperstrotia" macroplaga (Hampson, 1907), comb. n. The description of a new species and the review of two of its allies are presented here as a postscript to the description of the genus Strotihypera (Kononenko & Han 2011).

  20. Morphological and molecular characterization of a marine fish trypanosome from South Africa, including its development in a leech vector

    PubMed Central

    2014-01-01

    Background Trypanosomes are ubiquitous blood parasites of marine and freshwater fishes, typically transmitted by aquatic leeches. Phylogenetic studies have been dominated by examples derived from freshwater fishes, with few marine representatives. Furthermore, life cycle studies on marine fish trypanosomes have focused on those of the northern hemisphere. In this investigation, we have examined the life cycle and molecular taxonomy of a marine fish trypanosome from South Africa. Methods To locate trypanosome stages, leeches were removed from fishes captured on the west and south coasts of South Africa, and fish blood films and leech squashes were Giemsa-stained and screened; leeches were also examined histologically. To determine whether trypanosome stages in fishes and leeches were of the same genotype, DNA was extracted from Giemsa-stained fish blood films and leech squashes, and from fish whole blood. Fragments of the 18S rRNA gene were amplified by PCR using trypanosome-specific primers and sequenced. Resulting sequence data were compared with each other and with published trypanosome 18S rDNA sequences, and used for phylogenetic analysis. Results Trypanosomes were detected in blood films from fishes of the families Clinidae, Blenniidae and Gobiidae. The flagellates ranged in size and staining properties within the films and across fish hosts. In squashes and histological sections of adult and juvenile leeches, identified as Zeylanicobdella arugamensis, trypanosome developmental stages were predominantly slender epimastigotes. Sequence data showed that trypanosomes derived from fishes were identical, irrespective of whether they were small or large forms; sequences derived largely from leech epimastigotes were also identical to those obtained from fish trypanosomes. Fish and leech trypanosome sequences fell into a marine fish aquatic clade, and aligned most closely with two trypanosome sequences from marine fishes off Norway. Conclusions Combined morphological

  1. Annotated checklist of the leech species diversity in the Maloe More Strait of Lake Baikal, Russia

    PubMed Central

    Kaygorodova, Irina A.

    2015-01-01

    Abstract In this paper, the very first checklist of the freshwater leeches of Maloe More Strait, a special part of Lake Baikal, is presented. It includes 14 free-living and parasitic species, of which four species belong to endemic Baikal genera – two species from Baicalobdella and one species each from Baicaloclepsis and Codonobdella. The checklist highlights six potentially new morphological species recorded for the first time in the area. The exact systematic position is stated for all leech species. Each species from the list is provided with information on taxonomic synonymy, data on its geographic distribution, and ecological characteristics. New species records are additionally provided with brief morphological characteristics and photos of their external morphology. PMID:26798292

  2. A mathematical model of motorneuron dynamics in the heartbeat of the leech

    NASA Astrophysics Data System (ADS)

    Buono, Pietro-Luciano; Palacios, A.

    2004-02-01

    The heartbeat of the medicinal leech is driven by direct contact between two arrays of motorneurons and two lateral blood vessels. At any given time, motorneurons exhibit one of two alternating states so that, on one side of the animal, the heart beats in a rear-to-front fashion (peristaltic), while on the other side the heart beats synchronously. Every 20 heartbeats, approximately, the two sides switch modes. It is known that the heartbeat rhythm is generated through burst of oscillatory activity produced by a central pattern generator (CPG) network of neurons. However, to the best of our knowledge, how the CPG activity is translated into peristaltic and synchronous rhythms in the motorneurons is yet unknown. In this work, we use symmetric systems of differential equations, accompanied with computational simulations, to investigate possible mechanisms for generating the motorneuron activity that characterizes the heartbeat of leeches and in particular the switching scenario.

  3. Human recombinant RNASET2-induced inflammatory response and connective tissue remodeling in the medicinal leech.

    PubMed

    Baranzini, Nicolò; Pedrini, Edoardo; Girardello, Rossana; Tettamanti, Gianluca; de Eguileor, Magda; Taramelli, Roberto; Acquati, Francesco; Grimaldi, Annalisa

    2017-01-09

    In recent years, several studies have demonstrated that the RNASET2 gene is involved in the control of tumorigenicity in ovarian cancer cells. Furthermore, a role in establishing a functional cross-talk between cancer cells and the surrounding tumor microenvironment has been unveiled for this gene, based on its ability to act as an inducer of the innate immune response. Although several studies have reported on the molecular features of RNASET2, the details on the mechanisms by which this evolutionarily conserved ribonuclease regulates the immune system are still poorly defined. In the effort to clarify this aspect, we report here the effect of recombinant human RNASET2 injection and its role in regulating the innate immune response after bacterial challenge in an invertebrate model, the medicinal leech. We found that recombinant RNASET2 injection induces fibroplasias, connective tissue remodeling and the recruitment of numerous infiltrating cells expressing the specific macrophage markers CD68 and HmAIF1. The RNASET2-mediated chemotactic activity for macrophages has been further confirmed by using a consolidated experimental approach based on injection of the Matrigel biomatrice (MG) supplemented with recombinant RNASET2 in the leech body wall. One week after injection, a large number of CD68(+) and HmAIF-1(+) macrophages massively infiltrated MG sponges. Finally, in leeches challenged with lipopolysaccharides (LPS) or with the environmental bacteria pathogen Micrococcus nishinomiyaensis, numerous macrophages migrating to the site of inoculation expressed high levels of endogenous RNASET2. Taken together, these results suggest that RNASET2 is likely involved in the initial phase of the inflammatory response in leeches.

  4. Identification and quantification of nucleosides and nucleobases in Geosaurus and Leech by hydrophilic-interaction chromatography.

    PubMed

    Chen, Pei; Li, Wei; Li, Qin; Wang, Yinghua; Li, Zhenguo; Ni, Yefeng; Koike, Kazuo

    2011-09-15

    A simple hydrophilic-interaction chromatography (HILIC) method was developed for the identification and quantification of 14 nucleosides and nucleobases, namely cytosine, uracil, cytidine, guanine, hypoxanthine, xanthine, uridine, thymine, inosine, guanosine, thymidine, 2'-deoxyadenosine, 2'-deoxyinosine and 2'-deoxyuridine in two traditional Chinese medicines, Geosaurus and Leech. The separation was achieved on a TSKgel Amide-80 column (150 mm × 2.0 mm, 3.0 μm) with a mixture of acetonitrile and 10 mM aqueous ammonium acetate as the mobile phase at a flow rate of 0.2 mL/min. The temperature was set at 30°C and UV detection wavelength was set at 260 nm. All calibration curves showed good linearity (R(2)>0.9957) within the test ranges. The overall intra- and inter-day RSD ranged from 0.4 to 3.4% and from 0.7 to 3.3%, respectively. The LOD and LOQ were in the range of 0.07-30.49 ng/mL and 0.26-60.98 ng/mL, respectively. The repeatability of the method was in the range of 2.2-5.8% for Geosaurus and 1.4-5.5% for Leech. The recoveries of the samples were in the range of 91.4-100.9% for Geosaurus, and 91.9-99.3% for Leech. The established method was applied successfully for the analysis of nucleosides and nucleobases in 22 commercially available samples collected from different regions in China and Japan. Our data showed that HILIC had advantages as a useful tool for the study of the bioactive components in Geosaurus and Leech as well as their quality control, and could therefore be used for the determination of the analytes in pharmaceutical products and biological fluids.

  5. Land Leeches of the g. Haemadipsa (Haemadipsoidea: Haemadipsidae). I. Conditions Essential to Laboratory Colonization.

    DTIC Science & Technology

    1982-05-01

    segmented aquatic and terrestrial worms that belong to the Order Hirudinea, ( Annelida : Clitellata, Scriban and Autrum (2)) and are most closely related to the...WORTH, C.B. Description and discussion of the biting of an Indian land leech. ( Annelida : Hirudinea). J Bombay Nat Hist Soc 50:423-426, 1951 39...Haemadlpsidae and their Suborder, the Gnathobdellae (after 2-6,60). Phylum: Annelida Class: Clitellata Order: Ifirudinea (=Hirudiniformes) Suborder 1

  6. Multiple Changes in Peptide and Lipid Expression Associated with Regeneration in the Nervous System of the Medicinal Leech

    PubMed Central

    Meriaux, Céline; Arafah, Karim; Tasiemski, Aurélie; Wisztorski, Maxence; Bruand, Jocelyne; Boidin-Wichlacz, Céline; Desmons, Annie; Debois, Delphine; Laprévote, Olivier; Brunelle, Alain; Gaasterland, Terry; Macagno, Eduardo; Fournier, Isabelle; Salzet, Michel

    2011-01-01

    Background The adult medicinal leech central nervous system (CNS) is capable of regenerating specific synaptic circuitry after a mechanical lesion, displaying evidence of anatomical repair within a few days and functional recovery within a few weeks. In the present work, spatiotemporal changes in molecular distributions during this phenomenon are explored. Moreover, the hypothesis that neural regeneration involves some molecular factors initially employed during embryonic neural development is tested. Results Imaging mass spectrometry coupled to peptidomic and lipidomic methodologies allowed the selection of molecules whose spatiotemporal pattern of expression was of potential interest. The identification of peptides was aided by comparing MS/MS spectra obtained for the peptidome extracted from embryonic and adult tissues to leech transcriptome and genome databases. Through the parallel use of a classical lipidomic approach and secondary ion mass spectrometry, specific lipids, including cannabinoids, gangliosides and several other types, were detected in adult ganglia following mechanical damage to connected nerves. These observations motivated a search for possible effects of cannabinoids on neurite outgrowth. Exposing nervous tissues to Transient Receptor Potential Vanilloid (TRPV) receptor agonists resulted in enhanced neurite outgrowth from a cut nerve, while exposure to antagonists blocked such outgrowth. Conclusion The experiments on the regenerating adult leech CNS reported here provide direct evidence of increased titers of proteins that are thought to play important roles in early stages of neural development. Our data further suggest that endocannabinoids also play key roles in CNS regeneration, mediated through the activation of leech TRPVs, as a thorough search of leech genome databases failed to reveal any leech orthologs of the mammalian cannabinoid receptors but revealed putative TRPVs. In sum, our observations identify a number of lipids and

  7. Experimental Investigation on the Morphology and Adhesion Mechanism of Leech Posterior Suckers

    PubMed Central

    Dong, Wenhao

    2015-01-01

    The posterior sucker of a leech represents a fascinating natural system that allows the leech to adhere to different terrains and substrates. However, the mechanism of adhesion and desorption has not yet to be elucidated. In order to better understand how the adhesion is performed, we analyzed the surface structure, adsorption movements, the muscles’ distribution, physical characteristics, and the adsorption force of the leech posterior suckers by experimental investigation. Three conclusions can be drawn based on the obtained experimental results. First, the adhesion by the posterior sucker is wet adhesion, because the surface of the posterior sucker is smooth and the sealing can only be achieved on wet surfaces. Second, the deformation texture, consisting of soft collagen tissues and highly ductile epidermal tissues, plays a key role in adhering to rough surfaces. Finally, the adhesion and desorption is achieved by the synergetic operation of six muscle fibers working in different directions. Concrete saying, directional deformation of the collagen/epithermal interface driven by spatially-distributed muscle fibers facilitates the excretion of fluids in the sucker venter, thus allowing liquid sealing. Furthermore, we found that the adhesion strength is directly related to the size of the contact surface which is generated and affected by the sucker deformation. Such an underlying physical mechanism offers potential cues for developing innovative bio-inspired artificial adhesion systems. PMID:26536352

  8. Prevalence, Abundance, and Intensity of Implanted Spermatophores in the Leech Haementeria officinalis (Glossiphoniidae: Hirudinida) from Guanajuato, Mexico.

    PubMed

    Salas-Montiel, Ricardo; Phillips, Anna J; Contreras-Mirón, Samantha; Oceguera-Figueroa, Alejandro

    2017-02-01

    Fertilization through hypodermic implantation of spermatophores has been recorded in at least 4 groups of leeches: Glossiphoniidae, Piscicolidae, Ozobranchidae, and Erpobdelliformes. In Piscicola respirans (Piscicolidae), vector tissue responsible for sperm transfer from a specialized region of the body to the ovaries has led to the non-random attachment of spermatophores on the body surface of the recipient leech. It has been suggested that in glossiphoniid leeches, spermatophores are implanted in any part of the body surface of the recipient leech without a clear pattern or preference for region. In order to determine if the donor leech implants its spermatophores in a specific area of the conspecific recipient's body, we surveyed 81 specimens of Haementeria officinalis (Clitellata: Glossiphoniidae) from a wild population in Guanajuato, Mexico, and recorded the distribution of the spermatophores over the recipient's body surface. We describe for the first time a spermatophore of H. officinalis using scanning electron and light microscopy. Spermatophores were found attached dorsally between somites XVII and XXI 59.57% of the time, and the rest were found in other parts of the body, including on the ventral surface. The non-specific attachment for spermatophores does not support the presence of specialized tissue responsible for sperm transfer and instead attributes the placement of implantation to mechanical characteristics of the copulation process.

  9. Differential Expression of Conserved Germ Line Markers and Delayed Segregation of Male and Female Primordial Germ Cells in a Hermaphrodite, the Leech Helobdella

    PubMed Central

    Cho, Sung-Jin; Vallès, Yvonne; Weisblat, David A.

    2014-01-01

    In sexually reproducing animals, primordial germ cells (PGCs) are often set aside early in embryogenesis, a strategy that minimizes the risk of genomic damage associated with replication and mitosis during the cell cycle. Here, we have used germ line markers (piwi, vasa, and nanos) and microinjected cell lineage tracers to show that PGC specification in the leech genus Helobdella follows a different scenario: in this hermaphrodite, the male and female PGCs segregate from somatic lineages only after more than 20 rounds of zygotic mitosis; the male and female PGCs share the same (mesodermal) cell lineage for 19 rounds of zygotic mitosis. Moreover, while all three markers are expressed in both male and female reproductive tissues of the adult, they are expressed differentially between the male and female PGCs of the developing embryo: piwi and vasa are expressed preferentially in female PGCs at a time when nanos is expressed preferentially in male PGCs. A priori, the delayed segregation of male and female PGCs from somatic tissues and from one another increases the probability of mutations affecting both male and female PGCs of a given individual. We speculate that this suite of features, combined with a capacity for self-fertilization, may contribute to the dramatically rearranged genome of Helobdella robusta relative to other animals. PMID:24217283

  10. Description of a new leech species of Helobdella (Clitellata: Glossiphoniidae) from Mexico with a review of Mexican congeners and a taxonomic key.

    PubMed

    Salas-Montiel, Ricardo; Phillips, Anna J; De Leon, Gerardo Perez-Ponce; Oceguera-Figueroa, Alejandro

    2014-12-19

    To date, six species of the leech genus Helobdella have been recorded from Mexico: Helobdella atli, Helobdella elongata, Helobdella octatestisaca, Helobdella socimulcensis, Helobdella virginiae and Helobdella temiscoensis n. sp. This new species is characterized by a lanceolate body, the presence of a nuchal scute, uniform brown pigment on both dorsal and ventral surfaces, the absence of papillae, well-separated eyespots, six pairs of testisacs and five pairs of crop caeca, the last of which forms posterior caeca. In addition, we provide new geographic records for Helobdella species from Mexico resulting from our own collections, vouchers deposited at the Colección Nacional de Helmintos from the Instituto de Biología, UNAM, Mexico and vouchers at the Invertebrate Zoology Collection of the Smithsonian's National Museum of Natural History (USNM) Washington D.C., USA. We present a comprehensive review of Mexican Helobdella species, including the new species, with notes on the characteristic morphology and geographic distribution of each species with 91 new records from 20 states. In addition, we provide a taxonomic key for the identification of the Mexican species.

  11. The genus Bipolaris

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Bipolaris includes important plant pathogens with worldwide distribution. Species recognition in the genus has been uncertain due to the lack of molecular data from ex-type cultures as well as overlapping morphological characteristics. In this study, we revise the genus Bipolaris based on ...

  12. Occurrence of the Leech, Pontobdella muricata Linnaeus, on Elasmobranch Species in the Northern and Central Adriatic Sea.

    PubMed

    Bolognini, Luca; Leoni, Simone; Polidori, Piero; Grati, Fabio; Scarcella, Giuseppe; Pellini, Giulio; Domenichetti, Filippo; Ferrà, Carmen; Fabi, Gianna

    2016-12-01

    This study provides a parasitological analysis of the elasmobranch species caught in the northern and central Adriatic Sea. Sixty-two marine leeches were recorded on 747 individuals of Raja clavata Linnaeus, 1758 (thornback ray), Myliobatis aquila Linnaeus, 1758 (common eagle ray), and Torpedo marmorata Risso, 1810 (marbled torpedo ray) caught in 56 hauls over a 5 yr period. All leeches were identified as Pontobdella muricata, which is a typical ectoparasite of benthic elasmobranchs. The prevalence of infection ranged from 7.11% on R. clavata to 12.00% on M. aquila. The intensity of infection, the preferential sites of attachment to the host, and the periodicity of infection were evaluated.

  13. Establishment of segment polarity in the ectoderm of the leech Helobdella

    NASA Technical Reports Server (NTRS)

    Seaver, E. C.; Shankland, M.

    2001-01-01

    The segmented ectoderm and mesoderm of the leech arise via a stereotyped cell lineage from embryonic stem cells called teloblasts. Each teloblast gives rise to a column of primary blast cell daughters, and the blast cells generate descendant clones that serve as the segmental repeats of their particular teloblast lineage. We have examined the mechanism by which the leech primary blast cell clones acquire segment polarity - i.e. a fixed sequence of positional values ordered along the anteroposterior axis of the segmental repeat. In the O and P teloblast lineages, the earliest divisions of the primary blast cell segregate anterior and posterior cell fates along the anteroposterior axis. Using a laser microbeam, we ablated single cells from both o and p blast cell clones at stages when the clone was two to four cells in length. The developmental fate of the remaining cells was characterized with rhodamine-dextran lineage tracer. Twelve different progeny cells were ablated, and in every case the ablation eliminated the normal descendants of the ablated cell while having little or no detectable effect on the developmental fate of the remaining cells. This included experiments in which we specifically ablated those blast cell progeny that are known to express the engrailed gene, or their lineal precursors. These findings confirm and extend a previous study by showing that the establishment of segment polarity in the leech ectoderm is largely independent of cell interactions conveyed along the anteroposterior axis. Both intercellular signaling and engrailed expression play an important role in the segment polarity specification of the Drosophila embryo, and our findings suggest that there may be little or no conservation of this developmental mechanism between those two organisms.

  14. Isolation of infectious hematopoietic necrosis virus from a leech (Piscicola salmositica) and a copepod (Salmincola sp.), ectoparasites of sockeye salmon Oncorhynchus nerka

    USGS Publications Warehouse

    Mulcahy, D.; Klaybor, D.; Batts, W.N.

    1990-01-01

    ectious hematopoietic necrosis (IHN) virus was isolated from freshwater leeches Piscicola salmositica and copepods Salmincola sp. removed from the gills of spawning sockeye salmon Oncorhynchus nerka. This is the first report of the isolation of IHN virus from an animal other than salmonid fishes. High levels of IHN virus were also found in leeches taken from the bottom gravel of the spawning area. The prevalence of IHN virus in samples of individual leeches was as high as 100 "/o and the virus was isolated from 95 % of pooled samples of copepods. The highest level of virus was 8.7 X lo5 pfu (plaque forming units) g-' in the copepod and 1.5 X 10"fu g-' in the leech. The level of virus in leeches removed from fish gills was sometimes higher than the level of virus in the gill tissue itself. Virus persisted for at least 16 d in leeches held in the laboratory without feeding. Transmission of IHN virus by leeches probably increases the infection rate of spawning sockeye salmon.

  15. iDNA from terrestrial haematophagous leeches as a wildlife surveying and monitoring tool - prospects, pitfalls and avenues to be developed.

    PubMed

    Schnell, Ida Bærholm; Sollmann, Rahel; Calvignac-Spencer, Sébastien; Siddall, Mark E; Yu, Douglas W; Wilting, Andreas; Gilbert, M Thomas P

    2015-01-01

    Invertebrate-derived DNA (iDNA) from terrestrial haematophagous leeches has recently been proposed as a powerful non-invasive tool with which to detect vertebrate species and thus to survey their populations. However, to date little attention has been given to whether and how this, or indeed any other iDNA-derived data, can be combined with state-of-the-art analytical tools to estimate wildlife abundances, population dynamics and distributions. In this review, we discuss the challenges that face the application of existing analytical methods such as site-occupancy and spatial capture-recapture (SCR) models to terrestrial leech iDNA, in particular, possible violations of key assumptions arising from factors intrinsic to invertebrate parasite biology. Specifically, we review the advantages and disadvantages of terrestrial leeches as a source of iDNA and summarize the utility of leeches for presence, occupancy, and spatial capture-recapture models. The main source of uncertainty that attends species detections derived from leech gut contents is attributable to uncertainty about the spatio-temporal sampling frame, since leeches retain host-blood for months and can move after feeding. Subsequently, we briefly address how the analytical challenges associated with leeches may apply to other sources of iDNA. Our review highlights that despite the considerable potential of leech (and indeed any) iDNA as a new survey tool, further pilot studies are needed to assess how analytical methods can overcome or not the potential biases and assumption violations of the new field of iDNA. Specifically we argue that studies to compare iDNA sampling with standard survey methods such as camera trapping, and those to improve our knowledge on leech (and other invertebrate parasite) physiology, taxonomy, and ecology will be of immense future value.

  16. Physiological, pharmacological and behavioral evidence for a TRPA1 channel that can elicit defensive responses in the medicinal leech.

    PubMed

    Summers, Torrie; Wang, Yanqing; Hanten, Brandon; Burrell, Brian D

    2015-10-01

    Transient receptor potential ankyrin subtype 1 (TRPA1) channels are chemosensitive to compounds such as allyl isothiocyanate (AITC, the active component of mustard oil) and other reactive electrophiles and may also be thermodetectors in many animal phyla. In this study, we provide the first pharmacological evidence of a putative TRPA1-like channel in the medicinal leech. The leech's polymodal nociceptive neuron was activated by both peripheral and central application of the TRPA1 agonist AITC in a concentration-dependent manner. Responses to AITC were inhibited by the selective TRPA1 antagonist HC030031, but also by the TRPV1 antagonist SB366791. Other TRPA1 activators - N-methylmaleimide (NMM) and cinnamaldehyde (CIN) - also activated this nociceptive neuron, although HC030031 only inhibited the effects of NMM. The polymodal nociceptive neurons responded to moderately cold thermal stimuli (<17°C) and these responses were blocked by HC030031. AITC sensitivity was also found in the pressure-sensitive sensory neurons and was blocked by HC030031, but not by SB366791. AITC elicited a nocifensive withdrawal of the posterior sucker in a concentration-dependent manner that could be attenuated with HC030031. Peripheral application of AITC in vivo also produced swimming-like behavior that was attenuated by HC030031. These results suggest the presence of a TRPA1-like channel in the medicinal leech nervous system that responds to cold temperatures and may interact with the leech TRPV-like channel.

  17. Purification and Characterization of a Novel Kazal-Type Trypsin Inhibitor from the Leech of Hirudinaria manillensis

    PubMed Central

    Lai, Yanmei; Li, Bowen; Liu, Weihui; Wang, Gan; Du, Canwei; Ombati, Rose; Lai, Ren; Long, Chengbo; Li, Hongyuan

    2016-01-01

    Kazal-type serine proteinase inhibitors are found in a large number of living organisms and play crucial roles in various biological and physiological processes. Although some Kazal-type serine protease inhibitors have been identified in leeches, none has been reported from Hirudinaria manillensis, which is a medically important leech. In this study, a novel Kazal-type trypsin inhibitor was isolated from leech H. manillensis, purified and named as bdellin-HM based on the sequence similarity with bdellin-KL and bdellin B-3. Structural analysis revealed that bdellin-HM was a 17,432.8 Da protein and comprised of 149 amino acid residues with six cysteines forming three intra-molecular disulfide bonds. Bdellin-HM showed similarity with the Kazal-type domain and may belong to the group of “non-classical” Kazal inhibitors according to its CysI-CysII disulfide bridge position. Bdellin-HM had no inhibitory effect on elastase, chymotrypsin, kallikrein, Factor (F) XIIa, FXIa, FXa, thrombin and plasmin, but it showed a potent ability to inhibit trypsin with an inhibition constant (Ki) of (8.12 ± 0.18) × 10−9 M. These results suggest that bdellin-HM from the leech of H. manillensis plays a potent and specific inhibitory role towards trypsin. PMID:27455325

  18. Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris.

    PubMed

    Liu, Wei-Hui; Chen, Yan; Bai, Xue-Wei; Yao, Hui-Min; Zhang, Xu-Guang; Yan, Xiu-Wen; Lai, Ren

    2016-09-01

    The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.

  19. Spatial-specific action of serotonin within the leech midbody ganglion.

    PubMed

    Calviño, María Ana; Szczupak, Lidia

    2008-06-01

    Serotonin is a conspicuous neuromodulator in the nervous system of many vertebrates and invertebrates. In previous experiments performed in the leech nervous system, we compared the effect of the amine released from endogenous sources [using selective serotonin reuptake inhibitors (SSRIs), e.g. fluoxetine] with that of bath-applied serotonin. The results suggested that the amine does not reach all its targets in a uniform way, but produces the activation of an interneuronal pathway that generated specific synaptic responses on different neurons. Taking into account that the release of the amine is often regulated at the presynaptic level, we have investigated whether autoreceptor antagonists mimic the SSRIs effect. We found that methiothepin (100 microM) produced similar effects than fluoxetine. To further test the hypothesis that endogenous serotonin produce its effect by acting locally at specific sites, we analyzed the effect of iontophoretic applications of serotonin. We found a site in the neuropil of the leech ganglia where serotonin application mimicked the effect of the SSRIs and the 5-HT antagonist. The results further support the view that the effect of serotonin exhibits a spatial specificity that can be relevant to understand its modulatory actions.

  20. Toxicity induced by cumene hydroperoxide in leech Retzius nerve cells: the protective role of glutathione.

    PubMed

    Jovanovic, Zorica; Jovanovic, Svetlana

    2013-01-01

    In the present study, we studied the ability of glutathione (GSH) to detoxify exogenously applied cumene hydroperoxide (CHP). Exposure of leech Retzius nerve cells to CHP (1.5 mM) induced a marked prolongation of the spontaneous spike potential of these cells. Early after depolarization, and a cardiac-like action potential with a rapid depolarization followed by a sustained depolarization or plateau, which is terminated by a rapid repolarization were recorded. GSH (0.2 mM) significantly inhibited the effects of CHP on the duration of the action potential and suppressed CHP-induced spontaneous repetitive activity. Voltage-clamp recordings showed that CHP (1.5 mM) caused significant changes in the outward potassium currents. The fast and slow steady part of the potassium outward current was reduced by 46% and 39%, respectively. GSH applied in a concentration of 0.2 mM partially blocked the effect of CHP on the calcium-activated potassium currents. The fast and slow calcium-activated potassium currents were suppressed by about 20% and 15%, respectively. These results suggest that the neurotoxic effect of CHP on spontaneous spike electrogenesis and calcium-activated potassium currents of leech Retzius nerve cells was reduced in the presence of GSH.

  1. New host and geographical records for the leech Acanthobdella peledina Grube 1851 (Hirudinea, Acanthobdellidae)

    USGS Publications Warehouse

    Hauck, A. K.; Fallon, Michael J.; Burger, Carl V.

    1979-01-01

    A total of four leeches (Acanthobdella peledina), parasitizing four specimens of the least cisco (Coregonus sardinella), were found during July and August 1977. The hosts and parasites were collected during a fishery survey by the U.S. Fish and Wildlife Service in the North Slope waters of Naval Petroleum Reserve, Alaska. Two host fishes were collected from the Chipp River (70035' latitude, 155012' longitude) and two from an unnamed, landlocked lake (69054' latitude, 153o23' longitude). The Chipp River collection site is about 130 km southeast of Barrow, and the unnamed lake about 200 km southeast of Barrow. The leeches, which were fixed in situ with neutral formalin, appeared to have penetrated the integument and were embedded in subcutaneous tissues and white muscle at the base of the pelvic fins. The specimens were cylindrical and about 23 mm long and 2-3 mm wide. Color before fixation was olive-green. The five anterior segments each had four pairs of hooked setae at the ventral surface. Our identification was based on a description in Bykhovskaya-Pavlovskaya et al., 1962, Key to parasites of freshwater fish of the USSR (Transl. from Russian), NTIS TT-64-11040.

  2. Expression and function of an even-skipped homolog in the leech Helobdella robusta.

    PubMed

    Song, Mi Hye; Huang, Françoise Z; Chang, Gwendolen Y; Weisblat, David A

    2002-08-01

    We have identified homologs of the Drosophila pair-rule gene even-skipped in the glossiphoniid leeches Helobdella robusta and Theromyzon trizonare. In leech embryos, segments arise sequentially from five pairs of embryonic stem cells (teloblasts) that undergo iterated divisions to generate columns (bandlets) of segmental founder cells (primary blast cells), which in turn generate segmentally iterated sets of definitive progeny. In situ hybridization revealed that Hro-eve is expressed in the teloblasts and primary blast cells, and that these transcripts appear to be associated with mitotic chromatin. In more advanced embryos, Hro-eve is expressed in segmentally iterated sets of cells in the ventral nerve cord. Lineage analysis revealed that neurons expressing Hro-eve arise from the N teloblast. To assess the function of Hro-eve, we examined embryos in which selected blastomeres had been injected with antisense Hro-eve morpholino oligonucleotide (AS-Hro-eve MO), concentrating on the primary neurogenic (N teloblast) lineage. Injection of AS-Hro-eve MO perturbed the normal patterns of teloblast and blast cell divisions and disrupted gangliogenesis. These results suggest that Hro-eve is important in regulating early cell divisions through early segmentation, and that it also plays a role in neuronal differentiation.

  3. The European land leech: biology and DNA-based taxonomy of a rare species that is threatened by climate warming

    NASA Astrophysics Data System (ADS)

    Kutschera, U.; Pfeiffer, I.; Ebermann, E.

    2007-12-01

    The European land leech Xerobdella lecomtei was discovered in 1868 and is one of the rarest animals on Earth. During the 1960s, several individuals of these approx. 40 mm long, cold-adapted terrestrial annelids that inhabit the moist soils of birch forests around Graz, Austria, were investigated. Only one original research paper has been published on the biology of this species. Between 2001 and 2005, we re-investigated the morphology of preserved specimens and searched for living individuals in their natural habitat that appeared to be intact. We found only one juvenile individual (length approx. 10 mm), indicating that this local leech population became largely extinct over the past four decades. The feeding behaviour of our ‘lonesome George of the annelids’ was studied and is described here in detail. After its death, the Xerobdella individual was used for chemical extraction and molecular studies (deoxyribonucleic acid [DNA] barcoding, based on one gene, the mitochondrial cytochrome c oxidase subunit I). In addition, novel DNA barcodes for a land leech from Madagascar and a recently discovered species from Europe were obtained. Our phylogenetic tree shows that X. lecomtei is not a member of the tropical land leeches (family Haemadipsidae), as previously thought, but represents a separate line of descent (family Xerobdellidae). The decline of the local leech population around Graz correlates with a rise in average summer temperatures of +3°C between 1961 and 2004. This warming led to a drastic reduction in the moisture content of the soil where X. lecomtei lives. We suggest that human-induced climate change without apparent habitat destruction can lead to the extinction of populations of cold-adapted species that have a low colonization ability.

  4. Helminth and leech community structure in tadpoles and caudatan larvae of two amphibian species from Western Nebraska.

    PubMed

    Rhoden, Heather R; Bolek, Matthew G

    2012-04-01

    Currently no comparative studies exist on helminth and leech community structure among sympatric anuran tadpoles and salamander larvae. During June-August 2007-2009, we examined 50 bullfrog tadpoles, Rana catesbeiana , 50 barred tiger salamander larvae, Ambystoma mavortium , and 3 species of snails from Nevens Pond, Keith County, Nebraska for helminth and leech infections. The helminth and leech compound community of this larval amphibian assemblage consisted of at least 7 species, 4 in bullfrog tadpoles and 4 in barred tiger salamander larvae. Bullfrog tadpoles were infected with 2 species of nematodes ( Gyrinicola batrachiensis and Spiroxys sp.) and 2 types of metacercariae ( Telorchis sp. and echinostomatids), whereas barred tiger salamander larva were infected with 1 species of leech ( Placobdella picta ), 2 species of adult trematodes ( Telorchis corti and Halipegus sp.), and 1 species of an unidentified metacercaria. The component community of bullfrog tadpoles was dominated by helminths acquired through active penetration, or incidentally ingested through respiratory currents, or both, whereas the component community of larval salamanders was dominated by helminths acquired through ingestion of intermediate hosts (χ²  =  3,455.00, P < 0.00001). Differences in amphibian larval developmental time (2-3 yr for bullfrog tadpoles versus 2-5 mo for salamander larvae), the ephemeral nature of intermediate hosts in Nevens Pond, and the ability of bullfrog tadpole to eliminate echinostome infections had significant effects on mean helminth species richness among amphibian species and years (t  =  12.31, P < 0.0001; t  =  2.09, P  =  0.04). Differences in herbivorous and carnivorous diet and time to metamorphosis among bullfrog tadpoles and barred tiger salamander larvae were important factors in structuring helminth communities among the larval stages of these 2 sympatric amphibian species, whereas size was important in structuring helminth and leech

  5. The European land leech: biology and DNA-based taxonomy of a rare species that is threatened by climate warming.

    PubMed

    Kutschera, U; Pfeiffer, I; Ebermann, E

    2007-12-01

    The European land leech Xerobdella lecomtei was discovered in 1868 and is one of the rarest animals on Earth. During the 1960s, several individuals of these approx. 40 mm long, cold-adapted terrestrial annelids that inhabit the moist soils of birch forests around Graz, Austria, were investigated. Only one original research paper has been published on the biology of this species. Between 2001 and 2005, we re-investigated the morphology of preserved specimens and searched for living individuals in their natural habitat that appeared to be intact. We found only one juvenile individual (length approx. 10 mm), indicating that this local leech population became largely extinct over the past four decades. The feeding behaviour of our 'lonesome George of the annelids' was studied and is described here in detail. After its death, the Xerobdella individual was used for chemical extraction and molecular studies (deoxyribonucleic acid [DNA] barcoding, based on one gene, the mitochondrial cytochrome c oxidase subunit I). In addition, novel DNA barcodes for a land leech from Madagascar and a recently discovered species from Europe were obtained. Our phylogenetic tree shows that X. lecomtei is not a member of the tropical land leeches (family Haemadipsidae), as previously thought, but represents a separate line of descent (family Xerobdellidae). The decline of the local leech population around Graz correlates with a rise in average summer temperatures of +3 degrees C between 1961 and 2004. This warming led to a drastic reduction in the moisture content of the soil where X. lecomtei lives. We suggest that human-induced climate change without apparent habitat destruction can lead to the extinction of populations of cold-adapted species that have a low colonization ability.

  6. The genus Bipolaris

    PubMed Central

    Manamgoda, D.S.; Rossman, A.Y.; Castlebury, L.A.; Crous, P.W.; Madrid, H.; Chukeatirote, E.; Hyde, K.D.

    2014-01-01

    The genus Bipolaris includes important plant pathogens with worldwide distribution. Species recognition in the genus has been uncertain due to the lack of molecular data from ex-type cultures as well as overlapping morphological characteristics. In this study, we revise the genus Bipolaris based on DNA sequence data derived from living cultures of fresh isolates, available ex-type cultures from worldwide collections and observation of type and additional specimens. Combined analyses of ITS, GPDH and TEF gene sequences were used to reconstruct the molecular phylogeny of the genus Bipolaris for species with living cultures. The GPDH gene is determined to be the best single marker for species of Bipolaris. Generic boundaries between Bipolaris and Curvularia are revised and presented in an updated combined ITS and GPDH phylogenetic tree. We accept 47 species in the genus Bipolaris and clarify the taxonomy, host associations, geographic distributions and species’ synonymies. Modern descriptions and illustrations are provided for 38 species in the genus with notes provided for the other taxa when recent descriptions are available. Bipolaris cynodontis, B. oryzae, B. victoriae, B. yamadae and B. zeicola are epi- or neotypified and a lectotype is designated for B. stenospila. Excluded and doubtful species are listed with notes on taxonomy and phylogeny. Seven new combinations are introduced in the genus Curvularia to accomodate the species of Bipolaris transferred based on the phylogenetic analysis. A taxonomic key is provided for the morphological identification of species within the genus. PMID:25492990

  7. Encoding of Tactile Stimuli by Mechanoreceptors and Interneurons of the Medicinal Leech

    PubMed Central

    Kretzberg, Jutta; Pirschel, Friederice; Fathiazar, Elham; Hilgen, Gerrit

    2016-01-01

    For many animals processing of tactile information is a crucial task in behavioral contexts like exploration, foraging, and stimulus avoidance. The leech, having infrequent access to food, developed an energy efficient reaction to tactile stimuli, avoiding unnecessary muscle movements: The local bend behavior moves only a small part of the body wall away from an object touching the skin, while the rest of the animal remains stationary. Amazingly, the precision of this localized behavioral response is similar to the spatial discrimination threshold of the human fingertip, although the leech skin is innervated by an order of magnitude fewer mechanoreceptors and each midbody ganglion contains only 400 individually identified neurons in total. Prior studies suggested that this behavior is controlled by a three-layered feed-forward network, consisting of four mechanoreceptors (P cells), approximately 20 interneurons and 10 individually characterized motor neurons, all of which encode tactile stimulus location by overlapping, symmetrical tuning curves. Additionally, encoding of mechanical force was attributed to three types of mechanoreceptors reacting to distinct intensity ranges: T cells for touch, P cells for pressure, and N cells for strong, noxious skin stimulation. In this study, we provide evidences that tactile stimulus encoding in the leech is more complex than previously thought. Combined electrophysiological, anatomical, and voltage sensitive dye approaches indicate that P and T cells both play a major role in tactile information processing resulting in local bending. Our results indicate that tactile encoding neither relies on distinct force intensity ranges of different cell types, nor location encoding is restricted to spike count tuning. Instead, we propose that P and T cells form a mixed type population, which simultaneously employs temporal response features and spike counts for multiplexed encoding of touch location and force intensity. This hypothesis

  8. Characterization of a voltage-dependent conductance in the basolateral membrane of leech skin epithelium.

    PubMed

    Schnizler, M; Clauss, W

    1998-05-01

    Voltage clamp studies were performed on the dorsal integument of Hirudo medicinalis. Under apical calcium-free conditions an inward-directed component of transepithelial current was activated by changes of transepithelial voltage. Depolarization caused up to 50% increase of the transepithelial sodium current. Hyperpolarization had no comparable effects. With calcium (1.8 mM) or amiloride (100 microM) in the apical solution and in sodium-free solutions the inward-directed current failed to increase after depolarization. Activation also occurred under chloride-free conditions. Permeabilization of the apical membrane by nystatin (5 microM) increased the current activation significantly. After nystatin, calcium as well as amiloride lost their inhibitory effects. This indicates a basolateral localization of the voltage-dependent conductance. Vesicle insertion or cytoskeletal structures are probably not involved in regulation, as seen by the lack of effects of brefeldin A and the cytochalasins B and D. However, serosal hyposmolar solutions (170 mosmol.1(-1)) caused a reinforced activation of the current. Our results indicate a voltage-dependent conductance in a tight sodium-absorbing epithelium.

  9. Effect of a nonspiking neuron on motor patterns of the leech.

    PubMed

    Rodriguez, Mariano J; Alvarez, Rodrigo J; Szczupak, Lidia

    2012-04-01

    Premotor and motoneurons could play regulatory roles in motor control. We have investigated the role of a premotor nonspiking (NS) neuron of the leech nervous system in two locomotive patterns: swimming and crawling. The NS neuron is coupled through rectifying electrical junctions to all the excitatory motoneurons examined. In addition, activation of motoneurons evokes chemically mediated inhibitory responses in NS. During swimming and crawling, the NS membrane potential (Vm(NS)) oscillated phase locked to the motor output. Hyperpolarization or depolarization of NS had no effect on swimming, but hyperpolarization of NS slowed down the crawling activity and decreased the motoneuron firing frequency. Depolarization of NS increased the motoneuron activity, and, at stages where the crawling pattern was fading, depolarization of NS reinstated it. Future work should determine if NS is actually a member of the central pattern generator or a regulatory element.

  10. Widespread inhibition proportional to excitation controls the gain of a leech behavioral circuit

    PubMed Central

    Kristan, William B.

    2014-01-01

    SUMMARY Changing gain in a neuronal system has important functional consequences, but the underlying mechanisms have been elusive. Models have suggested a variety of neuronal and systems properties to accomplish gain control. Here, we show that the gain of the neuronal network underlying local bending behavior in leeches depends on widespread inhibition. Using behavioral analysis, intracellular recordings, and voltage-sensitive dye imaging, we compared the effects of blocking just the known lateral inhibition with blocking all GABAergic inhibition. This revealed an additional source of inhibition, which was widespread and increased in proportion to increasing stimulus intensity. In a model of the input/output functions of the three-layered local bending network, we showed that inhibiting all interneurons in proportion to the stimulus strength produces the experimentally observed change in gain. This relatively simple mechanism for controlling behavioral gain could be prevalent in vertebrate as well as invertebrate nervous systems. PMID:18215624

  11. Development of swimming in the medicinal leech, the gradual acquisition of a behavior.

    PubMed

    French, K A; Chang, J; Reynolds, S; Gonzalez, R; Kristan, W B; Kristan, W B

    2005-09-01

    Observing the development of behavior provides an assay for the developmental state of an embryo's nervous system. We have previously described the development of behaviors that were largely confined to one or a few segments. We now extend the work to a kinematic analysis of the development of swimming, a behavior that requires coordination of the entire body. When leech embryos first begin to swim they make little forward progress, but within several days they swim as effectively as adults. This increase in efficacy depends on changes in body shape and on improved intersegmental coordination of the swim central pattern generator. These kinematic details suggest how the swim central pattern generating circuit is assembled during embryogenesis.

  12. Dextran backfill tracers combined with Lucifer yellow injections for neuroanatomic studies of the leech head ganglion.

    PubMed

    Daberkow, D P; Vaughan, D K

    1996-08-01

    Several neuronal tracing substances were applied to the cut ends of leech cephalic nerves and the resulting backfills into the subesophageal ganglion (sbEG) were mapped. A 12 h incubation in 3 kDa dextrans conjugated either to a fluorochrome or to biotin (subsequently tagged with peroxidase) was satisfactory. In separate experiments, possible targets of cephalic nerve afferents (R3 Retzius neurons) were injected with Lucifer Yellow (LY) to visualize their projections. Comparison of the LY-R3 Retzius neuron map with that of the dextran-backfilled D1 nerve revealed extensive overlap in the sbEG. Experiments were performed combining the two protocols, confirming this observation. Moreover, confocal microscopy placed D1 nerve processes in close proximity to R3 Retzius neuron processes, suggesting that they could make synaptic contact with one another in the sbEG. With modifications, this method could be used to identify such contacts using electron microscopy.

  13. Leech segmental repeats develop normally in the absence of signals from either anterior or posterior segments

    NASA Technical Reports Server (NTRS)

    Seaver, E. C.; Shankland, M.

    2000-01-01

    We have investigated whether the development of segmental repeats is autonomous in the embryo of the leech Helobdella robusta. The segmental tissues of the germinal band arise from progeny of five stem cells called teloblasts. Asymmetric divisions of the teloblasts form chains of segment founder cells (called primary blast cells) that divide in a stereotypical manner to produce differentiated descendants. Using two distinct techniques, we have looked for potential interactions between neighboring blast cell clones along the anterior-posterior axis. In one technique, we prevented the birth of primary blast cells by injection of DNase I into the teloblast, thereby depriving the last blast cell produced before the ablation of its normal posterior neighbors. We also ablated single blast cells with a laser microbeam, which allowed us to assess potential signals acting on either more anterior or more posterior primary blast cell clones. Our results suggest that interactions along the anterior-posterior axis between neighboring primary blast cell clones are not required for development of normal segmental organization within the blast cell clone. We also examined the possibility that blast cells receive redundant signals from both anterior and posterior neighboring clones and that either is sufficient for normal development. Using double blast cell laser ablations to isolate a primary blast cell clone by removal of both its anterior and its posterior neighbor, we found that the isolated clone still develops normally. These results reveal that the fundamental segmental repeat in the leech embryo, the primary blast cell clone, can develop normally in the apparent absence of signals from adjacent repeats along the anterior-posterior axis.

  14. From the Worm in a Bottle of Mezcal: iDNA Confirmation of a Leech Parasitizing the Antillean Manatee.

    PubMed

    Pérez-Flores, J; Rueda-Calderon, H; Kvist, S; Siddall, M E; Oceguera-Figueroa, A

    2016-10-01

    Invertebrate-derived ingested DNA (iDNA) is quickly proving to be a valuable, non-invasive tool for monitoring vertebrate species of conservation concern. Using the DNA barcoding locus, we successfully identified both the blood-feeding leech Haementeria acuecueyetzin and its blood meal-the latter is shown to be derived from the Caribbean manatee, Trichechus manatus . DNA amplification was successful despite the fact that the specimen was fixed in Mezcal (a beverage distilled from agave). We report the first confirmed case of a leech feeding on a manatee, the first record of H. acuecueyetzin for the State of Chiapas and, to our knowledge, the first case of successful DNA amplification of a biological sample fixed in Mezcal other than the caterpillar "worms" more commonly found in that beverage.

  15. Sublethal effects of crude oil on a cold-water marine leech, Johanssonia arcitca, following chronic exposure

    SciTech Connect

    Khan, R.A. ); Kiceniuk, J.W. )

    1989-10-01

    Petroleum polyaromatic hydrocarbons (PAH) are known to affect many species of animals. Mortality and/or morbidity from acute toxicity are usually restricted to the immediate vicinity of a spill, seep or discharge. Subtle effects are sometimes not recognized unless long term observations are made. Several studies have shown that some species of invertebrates tend to accumulate and retain petroleum hydrocarbons for varying periods, sometimes with detrimental effects. In a previous communication, it was noted that water soluble fractions (WSF) of a crude oil distributed digestion and affected reproduction of a hematophagous marine leech, Johanssonia arctica. This leech is a benthic, cold-adapted species that is widely distributed on the continental shelf off eastern Canada especially on the Grand Banks where petroleum reserves have been recently discovered. The present study provides additional evidence that crude oil fractions not only alters egg production but also hatching of eggs and survival of the progeny.

  16. Distribution and functional properties of glutamate receptors in the leech central nervous system.

    PubMed

    Dierkes, P W; Hochstrate, P; Schlue, W R

    1996-06-01

    1. The effect of kainate and other glutamatergic agonists on the membrane potential (Em), the intracellular Na+ activity (aNai), and the intracellular free Ca2+ concentration ([Ca2+]i) of identified leech neurons and neuropile glial cells was measured with conventional and ion-sensitive microelectrodes, as well as with the use of the iontophoretically injected fluorescent indicators sodium-binding benzofuran isophthalate and Fura-2. 2. In Retzius neurons, AE, L, 8, and 101 motoneurons, and in the unclassified 50 neurons (Leydig cells) and AP neurons, as well as in neuropile glial cells, bath application of 100 microM kainate evoked a marked membrane depolarization and an increase in aNai and [Ca2+]i. The kainate-induced aNai increase persisted in solutions with high Mg2+ concentration in which synaptic transmission is blocked. 3. A membrane depolarization as well as an increase in aNai and [Ca2+]i was also evoked by L-glutamate, quisqualate, and L-alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA). The agonist-induced [Ca2+]i increase was inhibited by 6,7-dinitroquinoxaline-2,3-dione (DNQX). 4. In Ca(2+)-free solution, the kainate-induced [Ca2+]i increase was abolished in the neurons and in neuropile glial cells, whereas membrane depolarization and aNai increase were unchanged. In Na(+)-free solution, kainate had no effect on Em, aNai, or [Ca2+]i in the neurons. 5. In the mechanosensory T, P, and N neurons, kainate induced considerably smaller membrane depolarizations than in the other neurons or in neuropile glial cells, and it had no significant effect on aNai or [Ca2+]i. 6. It is concluded that in leech segmental ganglia the majority of the neurons and the neuropile glial cells, but probably not the mechanosensory neurons, possess glutamate receptors of the AMPA-kainate type. In the neurons, the [Ca2+]i increase caused by glutamatergic agonists is due to Ca2+ influx through voltage-dependent Ca2+ channels that are activated by the agonist

  17. The Ozobranchus leech as a mechanical vector for the fibropapilloma-associated turtle herpes virus found latently infecting skin tumors on Hawaiian green turtles (Chelonia mydas)

    USGS Publications Warehouse

    Greenblatt, R.J.; Work, T.M.; Balazs, G.; Sutton, C.A.; Casey, R.N.; Casey, J.W.

    2004-01-01

    Fibropapillomatosis (FP) of marine turtles is a neoplastic disease of ecological concern. A fibropapilloma-associated turtle herpesvirus (FPTHV) is consistently present, usually at loads exceeding one virus copy per tumor cell. DNA from an array of parasites of green turtles (Chelonia mydas) was examined with quantitative PCR (qPCR) to determine whether any carried viral loads are sufficient to implicate them as vectors for FPTHV. Marine leeches (Ozobranchus spp.) were found to carry high viral DNA loads; some samples approached 10 million copies per leech. Isopycnic sucrose density gradient/qPCR analysis confirmed that some of these copies were associated with particles of the density of enveloped viruses. The data implicate the marine leech Ozobranchus as a mechanical vector for FPTHV. Quantitative RT-PCR analysis of FPTHV gene expression indicated that most of the FPTHV copies in a fibropapilloma have restricted DNA polymerase expression, suggestive of latent infection.

  18. Genus I. Leptospira

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Leptospira comprise a diverse group of bacteria. Some species cause serious infections in animals and humans. These bacteria are aerobes that consume long-chain fatty acids and alcohols as carbon and energy sources. This genus is distinguished from Leptonema or Turneriella by lack of similarity u...

  19. Asymmetric cell divisions in the early embryo of the leech Helobdella robusta.

    PubMed

    Weisblat, David A

    2007-01-01

    The small glossiphoniid leech Helobdella robusta is among the best-studied representatives of the super-phylum Lophotrochozoa in terms of early development. The Helobdella embryo undergoes a modified version of spiral cleavage, characterized by stereotyped cell lineages comprising multiple examples of equal and unequal divisions, many of which are well-conserved with respect to those of other clitellate annelids, such as the oligochaete Tubifex. Here, we review the early development of Helobdella, focusing on the variety of unequal cell divisions. We then summarize an experimental analysis of the mechanisms underlying the unequal first cleavage in Helobdella, concluding that the unequal first cleavages in Helobdella and Tubifex proceed by different mechanisms. This result demonstrates the evolvability of the basic cell biological mechanisms underlying well-conserved developmental processes. Finally, we propose a model in which the unequal second cleavage in Helobdella may be regulated by the polarized distribution of PAR protein homologs, convergent with the unequal first cleavage of the nematode Caenorhabditis elegans (super-phylum Ecdysozoa).

  20. Maintenance of Fura-2 fluorescence in glial cells and neurons of the leech central nervous system.

    PubMed

    Munsch, T; Deitmer, J W

    1995-04-01

    Identified glial cells and neurones of the leech central nervous system (CNS) were injected iontophoretically with the calcium indicator dye Fura-2 to measure intracellular Ca2+, while simultaneously recording the membrane potential using a double-barrelled theta-type microelectrode. Both glial cells and neurones responded with Ni(2+)-sensitive Ca2+ transients upon membrane depolarization, indicating Ca2+ influx through voltage-gated Ca2+ channels. In contrast to neurones, the glial cells showed a rapid loss of fluorescence with a half-time of 6.3 +/- 1.8 min (n = 6) after dye injection. Both kinetics and amplitudes of the stimulus-induced Ca2+ transients were affected by this rapid dye loss. The anion exchange inhibitor probenicid (2 mM) significantly reduced, but did not prevent, the loss of Fura-2 fluorescence, suggesting that some dye left the glial cell via an anion exchanger. In order to compensate this fluorescence loss, we injected Fura-2 throughout the experiment. Under this condition, similar Ca2+ transients could be elicited repeatedly for more than 1 h. In Retzius neurones single injections of Fura-2 yielded enough intracellularly trapped dye to allow measurement of intracellular Ca2+ for up to 30 min after the end of injection without large decrease in absolute fluorescence.

  1. From synapses to behavior: development of a sensory-motor circuit in the leech.

    PubMed

    Marin-Burgin, Antonia; Kristan, William B; French, Kathleen A

    2008-05-01

    The development of neuronal circuits has been advanced greatly by the use of imaging techniques that reveal the activity of neurons during the period when they are constructing synapses and forming circuits. This review focuses on experiments performed in leech embryos to characterize the development of a neuronal circuit that produces a simple segmental behavior called "local bending." The experiments combined electrophysiology, anatomy, and FRET-based voltage-sensitive dyes (VSDs). The VSDs offered two major advantages in these experiments: they allowed us to record simultaneously the activity of many neurons, and unlike other imaging techniques, they revealed inhibition as well as excitation. The results indicated that connections within the circuit are formed in a predictable sequence: initially neurons in the circuit are connected by electrical synapses, forming a network that itself generates an embryonic behavior and prefigures the adult circuit; later chemical synapses, including inhibitory connections, appear, "sculpting" the circuit to generate a different, mature behavior. In this developmental process, some of the electrical connections are completely replaced by chemical synapses, others are maintained into adulthood, and still others persist and share their targets with chemical synaptic connections.

  2. Transmission at a 'direct' electrical connexion mediated by an interneurone in the leech.

    PubMed Central

    Muller, K J; Scott, S A

    1981-01-01

    1. Touch sensory neurones in the leech excite a rapidly conducting interneurone called the S-cell. Although the electrical synaptic connexion between the two cells is monosynaptic by physiological criteria, intracellular staining reveals that the touch cells and the S-cell do not make contact, but instead are linked by a pair of small interneurones. 2. The electrical coupling between touch cells and S-cells rectifies, in that depolarizing current but not hyperpolarizing current passes from the touch cell into the S-cell. The rectifying junction is between the touch cells and coupling interneurones, while the connexion between coupling interneurones and the S-cell passes current in both directions. 3. Selective destruction of the coupling interneurones by intracellular injection of a protease interrupts the disynaptic electrical connexion between touch and S-cells. 4. The touch cell's geometry and membrane properties account for the failure of impulses that are generated in certain portions of the receptive field in the skin to propagate beyond the first branch-points of the touch cell axon within the ganglion. Conduction block at branch-points is used to examine physiologically the spatial distribution of contacts between the touch cell and the coupling interneurones. In addition, it is shown that under natural conditions branch-point failure presynaptically reduces the effectiveness of the electrical synaptic connexions. Images Plate 1 Plate 2 Plate 3 Plate 4 PMID:6267257

  3. A Tale of Transmission: Aeromonas veronii Activity within Leech-Exuded Mucus

    PubMed Central

    Ott, Brittany M.; Dacks, Andrew M.; Ryan, Kenneth J.

    2016-01-01

    Transmission, critical to the establishment and persistence of host-associated microbiotas, also exposes symbionts to new environmental conditions. With horizontal transmission, these different conditions represent major lifestyle shifts. Yet genome-wide analyses of how microbes adjust their transcriptomes toward these dramatic shifts remain understudied. Here, we provide a comprehensive and comparative analysis of the global transcriptional profiles of a symbiont as it shifts between lifestyles during transmission. The gammaproteobacterium Aeromonas veronii is transmitted from the gut of the medicinal leech to other hosts via host mucosal castings, yet A. veronii can also transition from mucosal habitancy to a free-living lifestyle. These three lifestyles are characterized by distinct physiological constraints and consequently lifestyle-specific changes in the expression of stress-response genes. Mucus-bound A. veronii had the greatest expression in terms of both the number of loci and levels of transcription of stress-response mechanisms. However, these bacteria are still capable of proliferating within the mucus, suggesting the availability of nutrients within this environment. We found that A. veronii alters transcription of loci in a synthetic pathway that obtains and incorporates N-acetylglucosamine (NAG; a major component of mucus) into the bacterial cell wall, enabling proliferation. Our results demonstrate that symbionts undergo dramatic local adaptation, demonstrated by widespread transcriptional changes, throughout the process of transmission that allows them to thrive while they encounter new environments which further shape their ecology and evolution. PMID:26896136

  4. Riluzole suppresses postinhibitory rebound in an excitatory motor neuron of the medicinal leech.

    PubMed

    Angstadt, James D; Simone, Amanda M

    2014-08-01

    Postinhibitory rebound (PIR) is an intrinsic property often exhibited by neurons involved in generating rhythmic motor behaviors. Cell DE-3, a dorsal excitatory motor neuron in the medicinal leech exhibits PIR responses that persist for several seconds following the offset of hyperpolarizing stimuli and are suppressed in reduced Na(+) solutions or by Ca(2+) channel blockers. The long duration and Na(+) dependence of PIR suggest a possible role for persistent Na(+) current (I NaP). In vertebrate neurons, the neuroprotective agent riluzole can produce a selective block of I NaP. This study demonstrates that riluzole inhibits cell DE-3 PIR in a concentration- and Ca(2+)-dependent manner. In 1.8 mM Ca(2+) solution, 50-100 µM riluzole selectively blocked the late phase of PIR, an effect similar to that of the neuromodulator serotonin. However, 200 µM riluzole blocked both the early and late phases of PIR. Increasing extracellular Ca(2+) to 10 mM strengthened PIR, but high riluzole concentrations continued to suppress both phases of PIR. These results indicate that riluzole may suppress PIR via a nonspecific inhibition of Ca(2+) conductances and suggest that a Ca(2+)-activated nonspecific current (I(CAN)), rather than I NaP, may underlie the Na(+)-dependent component of PIR.

  5. Creation and reduction of a morphologically detailed model of a leech heart interneuron

    PubMed Central

    Tobin, Anne-Elise; Van Hooser, Stephen D.; Calabrese, Ronald L.

    2010-01-01

    Conductance-based neuron models aid in understanding the role intrinsic and synaptic currents play in producing neuronal activity. Incorporating morphological detail into a model allows for additional analysis of non-homogeneous distributions of active and synaptic conductances, as well as spatial segregation of electrical events. We developed a morphologically detailed “Full Model” of a leech heart interneuron that replicates reasonably well intracellular recordings from these interneurons. However, it comprises hundreds of compartments, each increasing parameter space and simulation time. To reduce the number of compartments of the Full Model, while preserving conductance densities and distributions, its compartments were grouped into functional groups that each share identical conductance densities. Each functional group was sequentially reduced to one or two compartments, preserving surface area, conductance densities and its contribution to input resistance. As a result, the input resistance and membrane time constant were preserved. The axial resistances of several compartments were rescaled to match the amplitude of synaptic currents and low-threshold calcium currents and the shape of action potentials to those in the Full Model. This reduced model, with intrinsic conductances, matched the activity of the Full Model for a variety of simulated current-clamp and voltage-clamp data. Because surface area and conductance distribution of the functional groups of the Full Model were maintained, parameter changes introduced into the reduced model can be directly translated to the Full Model. Thus, our computationally efficient reduced morphology model can be used as a tool for exploring the parameter space of the Full Model and in network simulations. PMID:16760352

  6. Endogenous and half-center bursting in morphologically-inspired models of leech heart interneurons

    PubMed Central

    Tobin, Anne-Elise; Calabrese, Ronald L.

    2010-01-01

    Based on a detailed morphology ‘Full Model’ of a leech heart interneuron, we previously developed a computationally-efficient, morphologically-inspired ‘Reduced Model’ to expedite tuning the model to produce endogenous bursting and alternating bursting when configured as a half-center oscillator (paired with reciprocally inhibitory synapses). To find conductance density distributions that produce endogenous bursting, we implemented a genetic algorithm automated parameter search. With multiple searches, we found eight parameter sets that produced endogenous bursting in the Reduced Model. When these parameter sets were applied to the Full Model, all produced endogenous bursting, although when the simulation time was extended from 80 s to 300 s, only four parameter sets produced sustained bursting in the Reduced Models. All parameter sets produced alternating half-center bursting in the Reduced and Full Models throughout 300 s. When conductance amplitudes were systematically varied for each of the four sustained burster sets, the effects on bursting activity differed, both for the same parameter set in the Reduced and Full Models and for different parameter sets with the same level of morphological detail. This implies that morphological detail can affect burst activity and that these parameter sets may represent different mechanisms for burst generation and/or regulation. We also tested the models with parameter variations that correspond to experimental manipulations. We conclude that whereas similar output can be achieved with multiple different parameter sets, perturbations such as conductance variations can highlight differences. Additionally, this work demonstrates both the utility and limitations of using simplified models to represent more morphologically-accurate models. PMID:16760353

  7. Deciphering the Structural Basis That Guides the Oxidative Folding of Leech-derived Tryptase Inhibitor*

    PubMed Central

    Pantoja-Uceda, David; Arolas, Joan L.; Aviles, Francesc X.; Santoro, Jorge; Ventura, Salvador; Sommerhoff, Christian P.

    2009-01-01

    Protein folding mechanisms have remained elusive mainly because of the transient nature of intermediates. Leech-derived tryptase inhibitor (LDTI) is a Kazal-type serine proteinase inhibitor that is emerging as an attractive model for folding studies. It comprises 46 amino acid residues with three disulfide bonds, with one located inside a small triple-stranded antiparallel β-sheet and with two involved in a cystine-stabilized α-helix, a motif that is widely distributed in bioactive peptides. Here, we analyzed the oxidative folding and reductive unfolding of LDTI by chromatographic and disulfide analyses of acid-trapped intermediates. It folds and unfolds, respectively, via sequential oxidation and reduction of the cysteine residues that give rise to a few 1- and 2-disulfide intermediates. Species containing two native disulfide bonds predominate during LDTI folding (IIa and IIc) and unfolding (IIa and IIb). Stop/go folding experiments demonstrate that only intermediate IIa is productive and oxidizes directly into the native form. The NMR structures of acid-trapped and further isolated IIa, IIb, and IIc reveal global folds similar to that of the native protein, including a native-like canonical inhibitory loop. Enzyme kinetics shows that both IIa and IIc are inhibitory-active, which may substantially reduce proteolysis of LDTI during its folding process. The results reported show that the kinetics of the folding reaction is modulated by the specific structural properties of the intermediates and together provide insights into the interdependence of conformational folding and the assembly of native disulfides during oxidative folding. PMID:19820233

  8. Cycling of Dense Core Vesicles Involved in Somatic Exocytosis of Serotonin by Leech Neurons

    PubMed Central

    Trueta, Citlali; Kuffler, Damien P.; De-Miguel, Francisco F.

    2012-01-01

    We studied the cycling of dense core vesicles producing somatic exocytosis of serotonin. Our experiments were made using electron microscopy and vesicle staining with fluorescent dye FM1-43 in Retzius neurons of the leech, which secrete serotonin from clusters of dense core vesicles in a frequency-dependent manner. Electron micrographs of neurons at rest or after 1 Hz stimulation showed two pools of dense core vesicles. A perinuclear pool near Golgi apparatuses, from which vesicles apparently form, and a peripheral pool with vesicle clusters at a distance from the plasma membrane. By contrast, after 20 Hz electrical stimulation 47% of the vesicle clusters were apposed to the plasma membrane, with some omega exocytosis structures. Dense core and small clear vesicles apparently originating from endocytosis were incorporated in multivesicular bodies. In another series of experiments, neurons were stimulated at 20 Hz while bathed in a solution containing peroxidase. Electron micrographs of these neurons contained gold particles coupled to anti-peroxidase antibodies in dense core vesicles and multivesicular bodies located near the plasma membrane. Cultured neurons depolarized with high potassium in the presence of FM1-43 displayed superficial fluorescent spots, each reflecting a vesicle cluster. A partial bleaching of the spots followed by another depolarization in the presence of FM1-43 produced restaining of some spots, other spots disappeared, some remained without restaining and new spots were formed. Several hours after electrical stimulation the FM1-43 spots accumulated at the center of the somata. This correlated with electron micrographs of multivesicular bodies releasing their contents near Golgi apparatuses. Our results suggest that dense core vesicle cycling related to somatic serotonin release involves two steps: the production of clear vesicles and multivesicular bodies after exocytosis, and the formation of new dense core vesicles in the perinuclear

  9. Phase relationships between segmentally organized oscillators in the leech heartbeat pattern generating network.

    PubMed

    Masino, Mark A; Calabrese, Ronald L

    2002-03-01

    Motor pattern generating networks that produce segmentally distributed motor outflow are often portrayed as a series of coupled segmental oscillators that produce a regular progression (constant phase differences) in their rhythmic activity. The leech heartbeat central pattern generator is paced by a core timing network, which consists of two coupled segmental oscillators in segmental ganglia 3 and 4. The segmental oscillators comprise paired mutually inhibitory oscillator interneurons and the processes of intersegmental coordinating interneurons. As a first step in understanding the coordination of segmental motor outflow by this pattern generator, we describe the functional synaptic interactions, and activity and phase relationships of the heart interneurons of the timing network, in isolated nerve cord preparations. In the timing network, most (approximately 75%) of the coordinating interneuron action potentials were generated at a primary spike initiation site located in ganglion 4 (G4). A secondary spike initiation site in ganglion 3 (G3) became active in the absence of activity at the primary site. Generally, the secondary site was characterized by a reluctance to burst and a lower spike frequency, when compared with the primary site. Oscillator interneurons in G3 inhibited spike activity at both initiation sites, whereas oscillator interneurons in G4 inhibited spike activity only at the primary initiation site. This asymmetry in the control of spike activity in the coordinating interneurons may account for the observation that the phase of the coordinating interneurons is more tightly linked to the G3 than G4 oscillator interneurons. The cycle period of the timing network and the phase difference between the ipsilateral G3 and G4 oscillator interneurons were regular within individual preparations, but varied among preparations. This variation in phase differences observed across preparations implies that modulated intrinsic membrane and synaptic properties

  10. Regional differences in BMP-dependence of dorsoventral patterning in the leech Helobdella

    PubMed Central

    Kuo, Dian-Han; Shankland, Marty; Weisblat, David A.

    2012-01-01

    In the leech Helobdella, the ectoderm exhibits a high degree of morphological homonomy between body segments, but pattern elements in lateral ectoderm arise via distinct cell lineages in the segments of the rostral and midbody regions. In each of the four rostral segments, a complete set of ventrolateral (O fate) and dorsolateral (P fate) ectodermal pattern elements arises from a single founder cell, op. In the 28 midbody and caudal segments, however, there are two initially indeterminate o/p founder cells; the more dorsal of these is induced to adopt the P fate by BMP5-8 emanating from the dorsalmost ectoderm, while the more ventral cell assumes the O fate. Previous work has suggested that the dorsoventral patterning of O and P fates differs in the rostral region, but the role of BMP signaling in those segments has not been investigated. We show here that suppression of dorsal BMP5-8 signaling (which effects a P-to-O fate change in the midbody) has no effect on the patterning of O and P fates in the rostral region. Furthermore, ectopic expression of BMP5-8 in the ventral ectoderm (which induces an O-to-P fate change in the midbody) has no effect in the rostral region. Finally, expression of a dominant-negative BMP receptor (which induces a P-to-O fate change in the midbody) fails to affect O/P patterning in the rostral region. Thus, the rostral segments appear to use some mechanism other than BMP signaling to pattern O and P cell fates along the dorsoventral axis. From a mechanistic standpoint, the OP lineage of the rostral segments and the O-P equivalence group of the midbody and caudal segments constitute distinct developmental modules that rely to differing degrees on positional cues from surrounding ectoderm in order to specify homonomous cell fates. PMID:22641012

  11. Dopamine activates the motor pattern for crawling in the medicinal leech.

    PubMed

    Puhl, Joshua G; Mesce, Karen A

    2008-04-16

    Locomotion in segmented animals is thought to be based on the coupling of "unit burst generators," but the biological nature of the unit burst generator has been revealed in only a few animal systems. We determined that dopamine (DA), a universal modulator of motor activity, is sufficient to activate fictive crawling in the medicinal leech, and can exert its actions within the smallest division of the animal's CNS, the segmental ganglion. In the entire isolated nerve cord or in the single ganglion, DA induced slow antiphasic bursting (approximately 15 s period) of motoneurons known to participate in the two-step elongation-contraction cycle underlying crawling behavior. During each cycle, the dorsal (DE-3) and ventral (VE-4) longitudinal excitor motoneurons fired approximately 180 degrees out of phase from the ventrolateral circular excitor motoneuron (CV), which marks the elongation phase. In many isolated whole nerve cords, DE-3 bursting progressed in an anterior to posterior direction with intersegmental phase delays appropriate for crawling. In the single ganglion, the dorsal (DI-1) and ventral (VI-2) inhibitory longitudinal motoneurons fired out of phase with each DE-3 burst, further confirming that the crawl unit burst generator exists in the single ganglion. All isolated ganglia of the CNS were competent to produce DA-induced robust fictive crawling, which typically lasted uninterrupted for 5-15 min. A quantitative analysis indicated that DA-induced crawling was not significantly different from electrically evoked or spontaneous crawling. We conclude that DA is sufficient to activate the full crawl motor program and that the kernel for crawling resides within each segmental ganglion.

  12. Hm-MyD88 and Hm-SARM: Two key regulators of the neuroimmune system and neural repair in the medicinal leech

    PubMed Central

    Rodet, F.; Tasiemski, A.; Boidin-Wichlacz, C.; Van Camp, C.; Vuillaume, C.; Slomianny, C.; Salzet, M.

    2015-01-01

    Unlike mammals, the CNS of the medicinal leech can regenerate damaged neurites, thus restoring neural functions after lesion. We previously demonstrated that the injured leech nerve cord is able to mount an immune response promoting the regenerative processes. Indeed neurons and microglia express sensing receptors like Hm-TLR1, a leech TLR ortholog, associated with chemokine release in response to a septic challenge or lesion. To gain insights into the TLR signaling pathways involved during these neuroimmune responses, members of the MyD88 family were investigated. In the present study, we report the characterization of Hm-MyD88 and Hm-SARM. The expression of their encoding gene was strongly regulated in leech CNS not only upon immune challenge but also during CNS repair, suggesting their involvement in both processes. This work also showed for the first time that differentiated neurons of the CNS could respond to LPS through a MyD88-dependent signalling pathway, while in mammals, studies describing the direct effect of LPS on neurons and the outcomes of such treatment are scarce and controversial. In the present study, we established that this PAMP induced the relocalization of Hm-MyD88 in isolated neurons. PMID:25880897

  13. Hm-MyD88 and Hm-SARM: two key regulators of the neuroimmune system and neural repair in the medicinal leech.

    PubMed

    Rodet, F; Tasiemski, A; Boidin-Wichlacz, C; Van Camp, C; Vuillaume, C; Slomianny, C; Salzet, M

    2015-04-16

    Unlike mammals, the CNS of the medicinal leech can regenerate damaged neurites, thus restoring neural functions after lesion. We previously demonstrated that the injured leech nerve cord is able to mount an immune response promoting the regenerative processes. Indeed neurons and microglia express sensing receptors like Hm-TLR1, a leech TLR ortholog, associated with chemokine release in response to a septic challenge or lesion. To gain insights into the TLR signaling pathways involved during these neuroimmune responses, members of the MyD88 family were investigated. In the present study, we report the characterization of Hm-MyD88 and Hm-SARM. The expression of their encoding gene was strongly regulated in leech CNS not only upon immune challenge but also during CNS repair, suggesting their involvement in both processes. This work also showed for the first time that differentiated neurons of the CNS could respond to LPS through a MyD88-dependent signalling pathway, while in mammals, studies describing the direct effect of LPS on neurons and the outcomes of such treatment are scarce and controversial. In the present study, we established that this PAMP induced the relocalization of Hm-MyD88 in isolated neurons.

  14. Comparison of the effects of cumene hydroperoxide and hydrogen peroxide on Retzius nerve cells of the leech Haemopis sanguisuga.

    PubMed

    Jovanovic, Zorica; Jovanovic, Svetlana

    2013-01-01

    Oxidative stress and the production of reactive oxygen species are known to play a major role in neuronal cell damage, but the exact mechanisms responsible for neuronal injury and death remain uncertain. In the present study, we examined the effects of oxidative stress on spontaneous spike activity and depolarizing outward potassium current by exposing the Retzius neurons of the leech to cumene hydroperoxide (CHP) and hydrogen peroxide (H(2)O(2)), the oxidants commonly used to examine oxidative mechanisms mediating cell death. We observed that relatively low concentrations of CHP (0.25, 1, and 1.5 mM) led to a marked prolongation of spontaneous repetitive activity. The prolonged action potentials showed an initial, spike-like depolarization followed by a plateau phase. In contrast, H(2)O(2) at the same and much higher concentrations (0.25 to 5 mM) did not significantly change the duration of spontaneous spike potentials of leech Retzius nerve cells (LRNCs). In the voltage clamp experiments, calcium-activated outward potassium currents, needed for the repolarization of the action potential, were suppressed with CHP, but not with H(2)O(2). The present findings indicate that CHP is a more potent oxidant and neurotoxin than H(2)O(2) and that the effect of CHP on the electrophysiological properties of LRNCs may be due to the inhibition of the potassium channels.

  15. Population variation and individual maximum size in two leech populations: energy extraction from cannibalism or niche widening?

    PubMed

    Persson, Lennart; Elliott, J Malcolm

    2013-05-01

    The theory of cannibal dynamics predicts a link between population dynamics and individual life history. In particular, increased individual growth has, in both modeling and empirical studies, been shown to result from a destabilization of population dynamics. We used data from a long-term study of the dynamics of two leech (Erpobdella octoculata) populations to test the hypothesis that maximum size should be higher in a cycling population; one of the study populations exhibited a delayed feedback cycle while the other population showed no sign of cyclicity. A hump-shaped relationship between individual mass of 1-year-old leeches and offspring density the previous year was present in both populations. As predicted from the theory, the maximum mass of individuals was much larger in the fluctuating population. In contrast to predictions, the higher growth rate was not related to energy extraction from cannibalism. Instead, the higher individual mass is suggested to be due to increased availability of resources due to a niche widening with increased individual body mass. The larger individual mass in the fluctuating population was related to a stronger correlation between the densities of 1-year-old individuals and 2-year-old individuals the following year in this population. Although cannibalism was the major mechanism regulating population dynamics, its importance was negligible in terms of providing cannibalizing individuals with energy subsequently increasing their fecundity. Instead, the study identifies a need for theoretical and empirical studies on the largely unstudied interplay between ontogenetic niche shifts and cannibalistic population dynamics.

  16. The present state of the leech fauna (Annelida, Hirudinea) in the Upper Irtysh cascade of water reservoirs

    PubMed Central

    Fedorova, Lyudmila I.; Kaygorodova, Irina A.

    2016-01-01

    Abstract Hirudinea is a small and ecologically important group of aquatic organisms. However, up to date, the leech fauna of Kazakhstan is poorly studied. The presence of large under-collected areas, such as the Upper Irtysh basin, makes biodiversity studies concerning these invertebrates from Kazakhstan relevant. In this paper, the latest information on species diversity of the freshwater hirudofauna of the Upper Irtysh cascade of water reservoirs, the Kazakhstan part of Irtysh River, is presented. It includes 10 free-living and parasitic species, of which 7 and 9 inhabit the Shulbinsk and the Bukhtarma reservoirs, respectively. These species belong to 2 orders, 3 families and 6 genera. The faunal list highlights four potentially new morphological species (Alboglossiphonia sp., Erpobdella sp., Piscicola sp. 1 and Piscicola sp. 2). Besides them, another three species Erpobdella vilnensis, Helobdella stagnalis and Theromyzon tessulatum recorded for the first time in the area. The exact systematic position is stated for all leech taxa. Each species from the list accompanied with information on taxonomic synonymy, data on its geographic distribution, and brief summary of morphological and ecological characteristics. PMID:27408572

  17. The LEECH Exoplanet Imaging Survey. Further constraints on the planet architecture of the HR 8799 system

    NASA Astrophysics Data System (ADS)

    Maire, A.-L.; Skemer, A. J.; Hinz, P. M.; Desidera, S.; Esposito, S.; Gratton, R.; Marzari, F.; Skrutskie, M. F.; Biller, B. A.; Defrère, D.; Bailey, V. P.; Leisenring, J. M.; Apai, D.; Bonnefoy, M.; Brandner, W.; Buenzli, E.; Claudi, R. U.; Close, L. M.; Crepp, J. R.; De Rosa, R. J.; Eisner, J. A.; Fortney, J. J.; Henning, T.; Hofmann, K.-H.; Kopytova, T. G.; Males, J. R.; Mesa, D.; Morzinski, K. M.; Oza, A.; Patience, J.; Pinna, E.; Rajan, A.; Schertl, D.; Schlieder, J. E.; Su, K. Y. L.; Vaz, A.; Ward-Duong, K.; Weigelt, G.; Woodward, C. E.

    2015-04-01

    Context. Astrometric monitoring of directly imaged exoplanets allows the study of their orbital parameters and system architectures. Because most directly imaged planets have long orbital periods (>20 AU), accurate astrometry is challenging when based on data acquired on timescales of a few years and usually with different instruments. The LMIRCam camera on the Large Binocular Telescope is being used for the LBT Exozodi Exoplanet Common Hunt (LEECH) survey to search for and characterize young and adolescent exoplanets in L' band (3.8 μm), including their system architectures. Aims: We first aim to provide a good astrometric calibration of LMIRCam. Then, we derive new astrometry, test the predictions of the orbital model of 8:4:2:1 mean motion resonance proposed for the system, and perform new orbital fitting of the HR 8799 bcde planets. We also present deep limits on a putative fifth planet inside the known planets. Methods: We use observations of HR 8799 and the Θ1 Ori C field obtained during the same run in October 2013. Results: We first characterize the distortion of LMIRCam. We determine a platescale and a true north orientation for the images of 10.707 ± 0.012 mas/pix and -0.430 ± 0.076°, respectively. The errors on the platescale and true north orientation translate into astrometric accuracies at a separation of 1'' of 1.1 mas and 1.3 mas, respectively. The measurements for all planets agree within 3σ with a predicted ephemeris. The orbital fitting based on the new astrometric measurements favors an architecture for the planetary system based on 8:4:2:1 mean motion resonance. The detection limits allow us to exclude a fifth planet slightly brighter or more massive than HR 8799 b at the location of the 2:1 resonance with HR 8799 e (~9.5 AU) and about twice as bright as HR 8799 cde at the location of the 3:1 resonance with HR 8799 e (~7.5 AU). The LBT is an international collaboration among institutions in the United States, Italy, and Germany. LBT

  18. Effect of conduction block at axon bifurcations on synaptic transmission to different postsynaptic neurones in the leech.

    PubMed Central

    Gu, X N

    1991-01-01

    1. The cutaneous receptive field of the medial pressure (mP) sensory neurone in the leech has been examined. The cell has one major receptive field and an anterior and a posterior minor receptive field, principally on lateral and dorsal skin. The two minor receptive fields are contiguous with the major receptive field and are innervated by fine anterior and posterior axons, but there is no overlap between major and minor receptive fields. 2. At low frequencies of stimulation of the minor receptive fields, conduction block takes place in the mP cell at the central branch point within the leech ganglion. 3. The mP cell synapses directly with many other cells in the leech ganglion, including the anterior pagoda (AP) cell, longitudinal (L) motoneurone and the annulus erector (AE) motoneurone, which were studied as a group of postsynaptic neurones. Conduction block in the mP cell affects its synaptic transmission to all three postsynaptic neurones, but the effect can be different in different postsynaptic neurones. Block at the central branch point for an impulse travelling along the anterior axon reduces transmission to the AE cell much more than to the AP or L cells, while block at the central branch for an impulse travelling along the posterior axon has the reverse effect. 4. The distribution of functional connections of the branches of the mP cell with each postsynaptic cell was studied. For this analysis, branches of the mP cell were selectively silenced either during conduction block or by laser microsurgery. Generally, nearly all of the functional connections with the L and AP cell are made by anterior branches of the mP cell while the connection with the AE cell was primarily made by posterior branches of the mP cell. 5. The possible sites of contact between the mP cell and postsynaptic cells were determined by injecting separate markers into the mP cell and a postsynaptic cell. In confirmation of physiology, the mP cell's posterior branches had few, if any

  19. Interaction of HmC1q with leech microglial cells: involvement of C1qBP-related molecule in the induction of cell chemotaxis

    PubMed Central

    2012-01-01

    Background In invertebrates, the medicinal leech is considered to be an interesting and appropriate model to study neuroimmune mechanisms. Indeed, this non-vertebrate animal can restore normal function of its central nervous system (CNS) after injury. Microglia accumulation at the damage site has been shown to be required for axon sprouting and for efficient regeneration. We characterized HmC1q as a novel chemotactic factor for leech microglial cell recruitment. In mammals, a C1q-binding protein (C1qBP alias gC1qR), which interacts with the globular head of C1q, has been reported to participate in C1q-mediated chemotaxis of blood immune cells. In this study, we evaluated the chemotactic activities of a recombinant form of HmC1q and its interaction with a newly characterized leech C1qBP that acts as its potential ligand. Methods Recombinant HmC1q (rHmC1q) was produced in the yeast Pichia pastoris. Chemotaxis assays were performed to investigate rHmC1q-dependent microglia migration. The involvement of a C1qBP-related molecule in this chemotaxis mechanism was assessed by flow cytometry and with affinity purification experiments. The cellular localization of C1qBP mRNA and protein in leech was investigated using immunohistochemistry and in situ hybridization techniques. Results rHmC1q-stimulated microglia migrate in a dose-dependent manner. This rHmC1q-induced chemotaxis was reduced when cells were preincubated with either anti-HmC1q or anti-human C1qBP antibodies. A C1qBP-related molecule was characterized in leech microglia. Conclusions A previous study showed that recruitment of microglia is observed after HmC1q release at the cut end of axons. Here, we demonstrate that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surface. Taken together, these results highlight the importance of the interaction between C1q and C1qBP in microglial activation leading to nerve repair in the medicinal leech. PMID:22356764

  20. Expression and characterization of the N-terminal half of antistasin, an anticoagulant protein derived from the leech Haementeria officinalis.

    PubMed

    Palladino, L O; Tung, J S; Dunwiddie, C; Alves, K; Lenny, A B; Przysiecki, C; Lehman, D; Nutt, E; Cuca, G C; Law, S W

    1991-02-01

    Antistasin, a 15-kDa anticoagulant protein isolated from the salivary glands of the Mexican leech Haementeria officinalis, has been shown to be a potent inhibitor of factor Xa in the blood coagulation cascade. Antistasin possesses a twofold internal homology between the N- and C-terminal halves of the molecule, suggesting a gene duplication event in the evolution of the antistasin gene. This structural feature also suggests that either or both halves of the protein may possess biological activity if expressed as separate domains. Because the N-terminal domain contains a factor Xa P1-reactive site, we chose to express this domain in an insect cell baculovirus expression system. Characterization of this recombinant half antistasin molecule reveals that the N-terminal domain inhibits factor Xa in vitro, with a K(i) of 1.7 nM.

  1. The neurotoxic effects of hydrogen peroxide and copper in Retzius nerve cells of the leech Haemopis sanguisuga

    PubMed Central

    Jovanovic, Zorica D.; Stanojevic, Marija B.; Nedeljkov, Vladimir B.

    2016-01-01

    ABSTRACT Oxidative stress and the generation of reactive oxygen species (ROS) play an important role in cellular damage. Electrophysiological analyses have shown that membrane transport proteins are susceptible to ROS. In the present study, oxidative stress was induced in Retzius nerve cells of the leech Haemopis sanguisuga by bath application of 1 mM of hydrogen peroxide (H2O2) and 0.02 mM of copper (Cu) for 20 min. The H2O2/Cu(II) produced considerable changes in the electrical properties of the Retzius nerve cells. Intracellular recording of the resting membrane potential revealed that the neuronal membrane was depolarized in the presence of H2O2/Cu(II). We found that the amplitude of action potentials decreased, while the duration augmented in a progressive way along the drug exposure time. The combined application of H2O2 and Cu(II) caused an initial excitation followed by depression of the spontaneous electrical activity. Voltage-clamp recordings revealed a second effect of the oxidant, a powerful inhibition of the outward potassium channels responsible for the repolarization of action potentials. The neurotoxic effect of H2O2/Cu(II) on the spontaneous spike electrogenesis and outward K+ current of Retzius nerve cells was reduced in the presence of hydroxyl radical scavengers, dimethylthiourea and dimethyl sulfoxide, but not mannitol. This study provides evidence for the oxidative modification of outward potassium channels in Retzius nerve cells. The oxidative mechanism of the H2O2/Cu(II) system action on the electrical properties of Retzius neurons proposed in this study might have a wider significance, referring not only to leeches but also to mammalian neurons. PMID:26935393

  2. Mechanism of ammonia excretion in the freshwater leech Nephelopsis obscura: characterization of a primitive Rh protein and effects of high environmental ammonia

    PubMed Central

    Quijada-Rodriguez, Alex R.; Treberg, Jason R.

    2015-01-01

    Remarkably little is known about nitrogenous excretion in freshwater invertebrates. In the current study, the nitrogen excretion mechanism in the carnivorous ribbon leech, Nephelopsis obscura, was investigated. Excretion experiments showed that the ribbon leech is ammonotelic, excreting 166.0 ± 8.6 nmol·grams fresh weight (gFW)−1·h−1 ammonia and 14.7 ± 1.9 nmol·gFW−1·h−1 urea. Exposure to high and low pH hampered and enhanced, respectively, ammonia excretion rates, indicating an acid-linked ammonia trapping mechanism across the skin epithelia. Accordingly, compared with body tissues, the skin exhibited elevated mRNA expression levels of a newly identified Rhesus protein and at least in tendency the Na+/K+-ATPase. Pharmacological experiments and enzyme assays suggested an ammonia excretion mechanism that involves the V-ATPase, Na+/K+-ATPase, and carbonic anhydrase, but not necessarily a functional microtubule system. Most importantly, functional expression studies of the identified Rh protein cloned from leech skin tissue revealed an ammonia transport capability of this protein when expressed in yeast. The leech Rh-ammonia transporter (NoRhp) is a member of the primitive Rh protein family, which is a sister group to the common ancestor of vertebrate ammonia-transporting Rh proteins. Exposure to high environmental ammonia (HEA) caused a new adjustment of body ammonia, accompanied with a decrease in NoRhp and Na+/K+-ATPase mRNA levels, but unaltered ammonia excretion rates. To our knowledge, this is only the second comprehensive study regarding the ammonia excretion mechanisms in a freshwater invertebrate, but our results show that basic processes of ammonia excretion appear to also be comparable to those found in freshwater fish, suggesting an early evolution of ionoregulatory mechanisms in freshwater organisms. PMID:26180186

  3. Field evaluation of deet, Repel Care, and three plant based essential oil repellents against mosquitoes, black flies (Diptera: Simuliidae) and land leeches (Arhynchobdellida: Haemadipsidae) in Thailand.

    PubMed

    Tawatsin, Apiwat; Thavara, Usavadee; Chansang, Uruyakorn; Chavalittumrong, Pranee; Boonruad, Thidarat; Wongsinkongman, Prapai; Bansidhi, Jaree; Mulla, Mir S

    2006-06-01

    Diethyl methyl benzamide, or deet, a commercial plant-based repellent (Repel Care), and essential ils from 3 species of plants (finger root rhizomes, guava leaves, and turmeric rhizomes), steam distillated and formulated as insect repellents, were evaluated in the field on human volunteers against hematophagous mosquitoes, black flies, and land leeches in Thailand. Field trials were conducted against wild mosquitoes in Bang Bua Thong District, Nonthaburi Province, and in the Thap Lan National Park Headquarters, Nadee District, Pranchinburi Province; anthroophilic black flies (Diptera: Simuliidae) at the Forestry Fire Control Station in Doi Inthanon National Park, Chomthong district, Chiang Mai Province; and land leeches (Arhynchobdellida: Haemadipsidae) in the Khao Yai National Park, Pak Chong District, Nakhon Ratchasima Province. The 3 experimental plant-based essential oil formulations as well as Repel Care and deet provided complete protection from mosquito landing and biting for up to 9 h (duration of the experiment). Similar results were obtained with the 5 products against black flies, providing 100% protection for 9 h but 96-82% protection after 10 and 11 h posttreatment. The 5 repellent products also provided 100% protection against land leeches for at least 8 h. Thi is the 1st report of repellency of plant-based repellents against black flies and land leeches in Thailand. The identification and availability of inexpensive sources of plant-based oils, i.e., finger root rhizomes, guava leaves, and turmeric rhizomes providing long-lasting repellency against blood-sucking organisms are promising leads into commercial production of relatively safe and effective repellents.

  4. Mechanism of ammonia excretion in the freshwater leech Nephelopsis obscura: characterization of a primitive Rh protein and effects of high environmental ammonia.

    PubMed

    Quijada-Rodriguez, Alex R; Treberg, Jason R; Weihrauch, Dirk

    2015-09-15

    Remarkably little is known about nitrogenous excretion in freshwater invertebrates. In the current study, the nitrogen excretion mechanism in the carnivorous ribbon leech, Nephelopsis obscura, was investigated. Excretion experiments showed that the ribbon leech is ammonotelic, excreting 166.0 ± 8.6 nmol·grams fresh weight (gFW)(-1)·h(-1) ammonia and 14.7 ± 1.9 nmol·gFW(-1)·h(-1) urea. Exposure to high and low pH hampered and enhanced, respectively, ammonia excretion rates, indicating an acid-linked ammonia trapping mechanism across the skin epithelia. Accordingly, compared with body tissues, the skin exhibited elevated mRNA expression levels of a newly identified Rhesus protein and at least in tendency the Na(+)/K(+)-ATPase. Pharmacological experiments and enzyme assays suggested an ammonia excretion mechanism that involves the V-ATPase, Na(+)/K(+)-ATPase, and carbonic anhydrase, but not necessarily a functional microtubule system. Most importantly, functional expression studies of the identified Rh protein cloned from leech skin tissue revealed an ammonia transport capability of this protein when expressed in yeast. The leech Rh-ammonia transporter (NoRhp) is a member of the primitive Rh protein family, which is a sister group to the common ancestor of vertebrate ammonia-transporting Rh proteins. Exposure to high environmental ammonia (HEA) caused a new adjustment of body ammonia, accompanied with a decrease in NoRhp and Na(+)/K(+)-ATPase mRNA levels, but unaltered ammonia excretion rates. To our knowledge, this is only the second comprehensive study regarding the ammonia excretion mechanisms in a freshwater invertebrate, but our results show that basic processes of ammonia excretion appear to also be comparable to those found in freshwater fish, suggesting an early evolution of ionoregulatory mechanisms in freshwater organisms.

  5. The genus Vitex: A review

    PubMed Central

    Rani, Anita; Sharma, Anupam

    2013-01-01

    The review includes 161 references on the genus Vitex, and comprises ethnopharmacology, morphology and microscopy, phytoconstituents, pharmacological reports, clinical studies, and toxicology of the prominent species of Vitex. Essential oils, flavonoids, iridoid glycosides, diterpenoides and ligans constitute major classes of phytoconstituents of the genus. A few species of this genus have medicinal value, among these, leaves and fruits of V. agnus-castus Linn. (Verbenaceae) has been traditionally used in treatment of women complaints. V. agnus-castus has also been included in herbal remedies, which are in clinical use to regulate the menstrual cycle, reduce premenstrual symptom tension and anxiety, treat some menopausal symptoms as well as to treat hormonally induced acne. Despite a long tradition of use of some species, the genus has not been explored properly. In the concluding part, the future scope of Vitex species has been emphasized with a view to establish their multifarious biological activities and mode of action. PMID:24347927

  6. The genus Cladosporium

    PubMed Central

    Bensch, K.; Braun, U.; Groenewald, J.Z.; Crous, P.W.

    2012-01-01

    A monographic revision of the hyphomycete genus Cladosporium s. lat. (Cladosporiaceae, Capnodiales) is presented. It includes a detailed historic overview of Cladosporium and allied genera, with notes on their phylogeny, systematics and ecology. True species of Cladosporium s. str. (anamorphs of Davidiella), are characterised by having coronate conidiogenous loci and conidial hila, i.e., with a convex central dome surrounded by a raised periclinal rim. Recognised species are treated and illustrated with line drawings and photomicrographs (light as well as scanning electron microscopy). Species known from culture are described in vivo as well as in vitro on standardised media and under controlled conditions. Details on host range/substrates and the geographic distribution are given based on published accounts, and a re-examination of numerous herbarium specimens. Various keys are provided to support the identification of Cladosporium species in vivo and in vitro. Morphological datasets are supplemented by DNA barcodes (nuclear ribosomal RNA gene operon, including the internal transcribed spacer regions ITS1 and ITS2, the 5.8S nrDNA, as well as partial actin and translation elongation factor 1-α gene sequences) diagnostic for individual species. In total 993 names assigned to Cladosporium s. lat., including Heterosporium (854 in Cladosporium and 139 in Heterosporium), are treated, of which 169 are recognized in Cladosporium s. str. The other taxa are doubtful, insufficiently known or have been excluded from Cladosporium in its current circumscription and re-allocated to other genera by the authors of this monograph or previous authors. Taxonomic novelties: Cladosporium allicinum (Fr.: Fr.) Bensch, U. Braun & Crous, comb. nov., C. astroideum var. catalinense U. Braun, var. nov., Fusicladium tectonicola (Yong H. He & Z.Y. Zhang) U. Braun & Bensch, comb. nov., Septoidium uleanum (Henn.) U. Braun, comb. nov., Zasmidium adeniae (Hansf.) U. Braun, comb. nov., Zasmidium

  7. Phoretic interaction between the kangaroo leech Marsupiobdella africana (Hirudinea: Glossiphoniidae) and the cape river crab Potamonautes perlatus (Decapoda: Potamonautidae)☆

    PubMed Central

    Badets, Mathieu; Preez, Louis Du

    2013-01-01

    The South African leech Marsupiobdella africana is a temporary ectoparasite of the amphibian Xenopus laevis, has a phoretic association with a freshwater crab Potamonautes perlatus, and exhibits advanced parental care by incubating its offspring in a brood pouch. Because phoretic associations are usually regarded to favor the phoront’s dispersion, its occurrence within the biology of a parasitic species reflects an intimate context of interactions. In addition to phoresy, attachment to the crab may confer other advantages pertaining to offspring development and predator avoidance, dispersion and the parasitic life cycle. Two ponds where amphibian and crab hosts co-occur were sampled twice a month for a period of 1 year. The population dynamics of the leeches and their use of specific microhabitats as attachment sites on the crabs were also investigated. Results indicate a direct relationship between intra-specific variation in the sex ratio among captured crab hosts and the number of leeches recruited over time. The attachments to specific microhabitats on the hard surfaces of the host suggest a proximal proximate anti-predatory strategy. Finally, the importance of oxygen accessibility for the offspring development has been investigated experimentally. Results revealed a remarkable network of interactions linking all partners of this system raising the question as to whether the crabs merely act as a vehicle or play a role within the parasitic life cycle. PMID:24918071

  8. The medicinal chemistry of genus Aralia.

    PubMed

    Clement, Jason A; Clement, Ella S H

    2015-01-01

    The genus Aralia contains many plants used medicinally in Asia and the Americas. Although many members of this genus are used medicinally, the vast majority of this genus has not been explored chemically. The species of Aralia that have been explored chemically have yielded compounds of several classes, including triterpenoid saponins, sterols, diterpenoids, and acetylenic lipids. Many of the biologically active components found in genus Aralia have been evaluated for their potential as lead compounds for drug discovery. This review will explore the medicinal chemistry of compounds reported from genus Aralia, and future prospects for this genus will be considered.

  9. NMR structural characterization and computational predictions of the major intermediate in oxidative folding of leech carboxypeptidase inhibitor.

    PubMed

    Arolas, Joan L; D'Silva, Loyola; Popowicz, Grzegorz M; Aviles, Francesc X; Holak, Tad A; Ventura, Salvador

    2005-08-01

    The III-A intermediate constitutes the major rate-determining step in the oxidative folding of leech carboxypeptidase inhibitor (LCI). In this work, III-A has been directly purified from the folding reaction and structurally characterized by NMR spectroscopy. This species, containing three native disulfides, displays a highly native-like structure; however, it lacks some secondary structure elements, making it more flexible than native LCI. III-A represents a structurally determined example of a disulfide-insecure intermediate; direct oxidation of this species to the fully native protein seems to be restricted by the burial of its two free cysteine residues inside a native-like structure. We also show that theoretical approaches based on topological constraints predict with good accuracy the presence of this folding intermediate. Overall, the derived results suggest that, as it occurs with non-disulfide bonded proteins, native-like interactions between segments of secondary structure rather than the crosslinking of disulfide bonds direct the folding of LCI.

  10. Cathepsin L and cystatin B gene expression discriminates immune cœlomic cells in the leech Theromyzon tessulatum

    PubMed Central

    Lefebvre, Christophe; Vandenbulcke, Franck; Bocquet, Béatrice; Tasiemski, Aurélie; Desmons, Annie; Verstraete, Mathilde; Salzet, Michel; Cocquerelle, Claude

    2009-01-01

    Previous studies evidenced that cystatin B-like gene is specifically expressed and induced in large circulating cœlomic cells following bacterial challenge in the leech Theromyzon tessulatum. In order to understand the role of that cysteine proteinase inhibitor during immune response, we investigated the existence of members of cathepsin family. We cloned a cathepsin L-like gene and studied its tissue distribution. Immunohistochemical studies using anti-cathepsin L and anti-cystatin B antibodies and ultrastructural results demonstrated the presence of three distinct cœlomic cell populations, (1) the chloragocytes which were initially defined as large cœlomocytes, (2) the granular amœbocytes, and (3) small cœlomic cells. Among those cells, while chloragocytes contain cystatin B and cathepsin L, granular amœbocytes do only contain cathepsin L and third cell population contains neither cathepsin nor inhibitor. Finally, results evidenced that cathepsin L immunopositive granular amœbocytes are chemoattracted to the site of injury and phagocyte bacteria. PMID:18177937

  11. A dye mixture (Neurobiotin and Alexa 488) reveals extensive dye-coupling among neurons in leeches; physiology confirms the connections.

    PubMed

    Fan, Ruey-Jane; Marin-Burgin, Antonia; French, Kathleen A; Otto Friesen, W

    2005-12-01

    Although the neuronal circuits that generate leech movements have been studied for over 30 years, the list of interneurons (INs) in these circuits remains incomplete. Previous studies showed that some motor neurons (MNs) are electrically coupled to swim-related INs, e.g., rectifying junctions connect IN 28 to MN DI-1 (dorsal inhibitor), so we searched for additional neurons in these behavioral circuits by co-injecting Neurobiotin and Alexa Fluor 488 into segmental MNs DI-1, VI-2, DE-3 and VE-4. The high molecular weight Alexa dye is confined to the injected cell, whereas the smaller Neurobiotin molecules diffuse through gap junctions to reveal electrical coupling. We found that MNs were each dye-coupled to approximately 25 neurons, about half of which are likely to be INs. We also found that (1) dye-coupling was reliably correlated with physiologically confirmed electrical connections, (2) dye-coupling is unidirectional between MNs that are linked by rectifying connections, and (3) there are novel electrical connections between excitatory and inhibitory MNs, e.g. between excitatory MN VE-4 and inhibitory MN DI-1. The INs found in this study provide a pool of novel candidate neurons for future studies of behavioral circuits, including those underlying swimming, crawling, shortening, and bending movements.

  12. D quadrant specification in the leech Helobdella: actomyosin contractility controls the unequal cleavage of the CD blastomere

    PubMed Central

    Lyons, Deirdre C.; Weisblat, David A.

    2009-01-01

    The unequal division of the CD blastomere at second cleavage is critical in establishing the second embryonic axis in the leech Helobdella, as in other unequally cleaving spiralians. When CD divides, the larger D and smaller C blastomeres arise invariantly on the left and right sides of the embryo, respectively. Here we show that stereotyped cellular dynamics, including the formation of an intercellular blastocoel, culminate in a morphological left-right asymmetry in the 2-cell embryo, which precedes cytokinesis and predicts the chirality of the second cleavage. In contrast to the unequal first cleavage, the unequal second cleavage does not result from down-regulation of one centrosome, nor from an asymmetry within the spindle itself. Instead, the unequal cleavage of the CD cell entails a symmetric mitotic apparatus moving and anisotropically growing rightward in an actomyosin-dependent process. Our data reveal that mechanisms controlling the establishment of the D quadrant differ fundamentally even among the monophyletic clitellate annelids. Thus, while the homologous spiral cleavage pattern is highly conserved in this clade, it has diverged significantly at the level of cell biological mechanisms. This combination of operational conservation and mechanistic divergence begins to explain how the spiral cleavage program has remained so refractory to change while, paradoxically, accommodating numerous modifications throughout evolution. PMID:19607823

  13. Enhancing the secretory yields of leech carboxypeptidase inhibitor in Escherichia coli: influence of trigger factor and signal recognition particle.

    PubMed

    Puertas, Juan-Miguel; Nannenga, Brent L; Dornfeld, Kevin T; Betton, Jean-Michel; Baneyx, François

    2010-11-01

    The signal recognition particle (SRP) dependent secretion pathway is as an attractive alternative to Sec-dependent export for the production of disulfide-bonded and/or fast-folding recombinant proteins in the Escherichia coli periplasm. SRP, which shares a ribosomal attachment site with the molecular chaperone trigger factor (TF), recognizes highly hydrophobic signal sequence as they emerge from the ribosome and delivers ribosome nascent chain complexes to FtsY for subsequent cotranslational translocation of target proteins across the SecYEG pore. However, like in the case of Sec-dependent export, secretory yields can be limited by the accumulation of precursor proteins in the cytoplasm. Using leech carboxypeptidase inhibitor (LCI) fused to the SRP-dependent DsbA signal sequence as a model system, we show that a null mutation in the gene encoding TF (Deltatig) or SRP co-expression reduce pre-LCI accumulation by half, and that quantitative export can be achieved by combining the two strategies. Interestingly, enhanced precursor processing did not alter periplasmic LCI levels but increased the amount of protein excreted in the growth medium. All mature LCI was nearly fully active and an 80% increase in productivity was achieved in Deltatig cells alone due to their faster growth. Our results show that competition between SRP and TF can interfere with efficient export of recombinant proteins targeted to the SRP pathway and establish TF-deficient strains and SRP co-expression as a simple solution to improve yields.

  14. A 3-SYNAPSE POSITIVE FEEDBACK LOOP REGULATES THE EXCITABILITY OF AN INTERNEURON CRITICAL FOR SENSITIZATION IN THE LEECH

    PubMed Central

    Crisp, Kevin M.; Muller, Kenneth J.

    2007-01-01

    Sensitization of reflexive shortening in the leech has been linked to serotonin (5-HT)-induced changes in the excitability of a single interneuron, the S cell. This neuron is necessary for sensitization and complete dishabituation of reflexive shortening, during which it contributes to the sensory-motor reflex. The S cell does not contain 5-HT, which is released primarily from the Retzius (R) cells, whose firing enhances S-cell excitability. Here we show that the S cell excites the R cells, mainly via a fast disynaptic pathway in which the first synapse is the electrical junction between the S cell and the coupling interneurons, and the second synapse is a glutamatergic synapse of the coupling interneurons onto the R cells. The S cell-triggered excitatory postsynaptic potential in the R cell diminishes and nearly disappears in elevated concentrations of divalent cations because the coupling interneurons become inexcitable under these conditions. Serotonin released from the R cells feeds back upon the S cell and increases its excitability by activating a 5-HT7-like receptor; 5-methoxytryptamine (5-MeOT; 10 μM) mimics the effects of 5-HT on S cell excitability, and effects of both 5-HT and 5-MeOT are blocked by pimozide (10 μM) and SB-269970 (5 μM). This feedback loop may be critical for the full expression of sensitization of reflexive shortening. PMID:16571760

  15. Genetic diversity in Gossypium genus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The overall objectives of this paper are to report on cotton germplasm resources, morphobiological and agronomic diversity of Gossypium genus and review efforts on molecular genetic diversity of cotton gene pools as well as on the challenges and perspectives of exploiting genetic diversity in cotton...

  16. Natural products from the genus tephrosia.

    PubMed

    Chen, Yinning; Yan, Tao; Gao, Chenghai; Cao, Wenhao; Huang, Riming

    2014-01-27

    The genus Tephrosia, belonging to the Leguminosae family, is a large pantropical genus of more than 350 species, many of which have important traditional uses in agriculture. This review not only outlines the source, chemistry and biological evaluations of natural products from the genus Tephrosia worldwide that have appeared in literature from 1910 to December 2013, but also covers work related to proposed biosynthetic pathways and synthesis of some natural products from the genus Tephrosia, with 105 citations and 168 new compounds.

  17. Genus dependence of superstring amplitudes

    SciTech Connect

    Davis, Simon

    2006-11-15

    The problem of the consistency of the finiteness of the supermoduli space integral in the limit of vanishing super-fixed point distance and the genus-dependence of the integral over the super-Schottky coordinates in the fundamental region containing a neighborhood of |K{sub n}|=0 is resolved. Given a choice of the categories of isometric circles representing the integration region, the exponential form of bounds for superstring amplitudes is derived.

  18. Biodiversity of the genus Cladophialophora

    PubMed Central

    Badali, H.; Gueidan, C.; Najafzadeh, M.J.; Bonifaz, A.; van den Ende, A.H.G. Gerrits; de Hoog, G.S.

    2008-01-01

    Cladophialophora is a genus of black yeast-like fungi comprising a number of clinically highly significant species in addition to environmental taxa. The genus has previously been characterized by branched chains of ellipsoidal to fusiform conidia. However, this character was shown to have evolved several times independently in the order Chaetothyriales. On the basis of a multigene phylogeny (nucLSU, nucSSU, RPB1), most of the species of Cladophialophora (including its generic type C. carrionii) belong to a monophyletic group comprising two main clades (carrionii- and bantiana-clades). The genus includes species causing chromoblastomycosis and other skin infections, as well as disseminated and cerebral infections, often in immunocompetent individuals. In the present study, multilocus phylogenetic analyses were combined to a morphological study to characterize phenetically similar Cladophialophora strains. Sequences of the ITS region, partial Translation Elongation Factor 1-α and β-Tubulin genes were analysed for a set of 48 strains. Four novel species were discovered, originating from soft drinks, alkylbenzene-polluted soil, and infected patients. Membership of the both carrionii and bantiana clades might be indicative of potential virulence to humans. PMID:19287540

  19. Biodiversity of the genus Cladophialophora.

    PubMed

    Badali, H; Gueidan, C; Najafzadeh, M J; Bonifaz, A; van den Ende, A H G Gerrits; de Hoog, G S

    2008-01-01

    Cladophialophora is a genus of black yeast-like fungi comprising a number of clinically highly significant species in addition to environmental taxa. The genus has previously been characterized by branched chains of ellipsoidal to fusiform conidia. However, this character was shown to have evolved several times independently in the order Chaetothyriales. On the basis of a multigene phylogeny (nucLSU, nucSSU, RPB1), most of the species of Cladophialophora (including its generic type C. carrionii) belong to a monophyletic group comprising two main clades (carrionii- and bantiana-clades). The genus includes species causing chromoblastomycosis and other skin infections, as well as disseminated and cerebral infections, often in immunocompetent individuals. In the present study, multilocus phylogenetic analyses were combined to a morphological study to characterize phenetically similar Cladophialophora strains. Sequences of the ITS region, partial Translation Elongation Factor 1-alpha and beta-Tubulin genes were analysed for a set of 48 strains. Four novel species were discovered, originating from soft drinks, alkylbenzene-polluted soil, and infected patients. Membership of the both carrionii and bantiana clades might be indicative of potential virulence to humans.

  20. Effects of millimeter wave irradiation and equivalent thermal heating on the activity of individual neurons in the leech ganglion

    PubMed Central

    Romanenko, Sergii; Siegel, Peter H.; Wagenaar, Daniel A.

    2014-01-01

    Many of today's radiofrequency-emitting devices in telecommunication, telemedicine, transportation safety, and security/military applications use the millimeter wave (MMW) band (30–300 GHz). To evaluate the biological safety and possible applications of this radiofrequency band for neuroscience and neurology, we have investigated the physiological effects of low-intensity 60-GHz electromagnetic irradiation on individual neurons in the leech midbody ganglia. We applied incident power densities of 1, 2, and 4 mW/cm2 to the whole ganglion for a period of 1 min while recording the action potential with a standard sharp electrode electrophysiology setup. For comparison, the recognized U.S. safe exposure limit is 1 mW/cm2 for 6 min. During the exposure to MMWs and gradual bath heating at a rate of 0.04°C/s (2.4°C/min), the ganglionic neurons exhibited similar dose-dependent hyperpolarization of the plasma membrane and decrease in the action potential amplitude. However, narrowing of the action potential half-width during MMW irradiation at 4 mW/cm2 was 5 times more pronounced compared with that during equivalent bath heating of 0.6°C. Even more dramatic difference in the effects of MMW irradiation and bath heating was noted in the firing rate, which was suppressed at all applied MMW power densities and increased in a dose-dependent manner during gradual bath heating. The mechanism of enhanced narrowing of action potentials and suppressed firing by MMW irradiation, compared with that by gradual bath heating, is hypothesized to involve specific coupling of MMW energy with the neuronal plasma membrane. PMID:25122711

  1. Solving a Bloody Mess: B-Vitamin Independent Metabolic Convergence among Gammaproteobacterial Obligate Endosymbionts from Blood-Feeding Arthropods and the Leech Haementeria officinalis.

    PubMed

    Manzano-Marín, Alejandro; Oceguera-Figueroa, Alejandro; Latorre, Amparo; Jiménez-García, Luis F; Moya, Andres

    2015-10-09

    Endosymbiosis is a common phenomenon in nature, especially between bacteria and insects, whose typically unbalanced diets are usually complemented by their obligate endosymbionts. While much interest and focus has been directed toward phloem-feeders like aphids and mealybugs, blood-feeders such as the Lone star tick (Amblyomma americanum), Glossina flies, and the human body louse (Pediculus humanus corporis) depend on obligate endosymbionts which complement their B-vitamin-deficient diets, and thus are required for growth and survival. Glossiphoniid leeches have also been found to harbor distinct endosymbionts housed in specialized organs. Here, we present the genome of the bacterial endosymbiont from Haementeria officinalis, first of a glossiphoniid leech. This as-yet-unnamed endosymbiont belongs to the Gammaproteobacteria, has a pleomorphic shape and is restricted to bacteriocytes. For this bacterial endosymbiont, we propose the name Candidatus Providencia siddallii. This symbiont possesses a highly reduced genome with high A+T content and a reduced set of metabolic capabilities, all of which are common characteristics of ancient obligate endosymbionts of arthropods. Its genome has retained many pathways related to the biosynthesis of B-vitamins, pointing toward a role in supplementing the blood-restricted diet of its host. Through comparative genomics against the endosymbionts of A. americanum, Glossina flies, and P. humanus corporis, we were able to detect a high degree of metabolic convergence among these four very distantly related endosymbiotic bacteria.

  2. Solving a Bloody Mess: B-Vitamin Independent Metabolic Convergence among Gammaproteobacterial Obligate Endosymbionts from Blood-Feeding Arthropods and the Leech Haementeria officinalis

    PubMed Central

    Manzano-Marín, Alejandro; Oceguera-Figueroa, Alejandro; Latorre, Amparo; Jiménez-García, Luis F.; Moya, Andres

    2015-01-01

    Endosymbiosis is a common phenomenon in nature, especially between bacteria and insects, whose typically unbalanced diets are usually complemented by their obligate endosymbionts. While much interest and focus has been directed toward phloem-feeders like aphids and mealybugs, blood-feeders such as the Lone star tick (Amblyomma americanum), Glossina flies, and the human body louse (Pediculus humanus corporis) depend on obligate endosymbionts which complement their B-vitamin-deficient diets, and thus are required for growth and survival. Glossiphoniid leeches have also been found to harbor distinct endosymbionts housed in specialized organs. Here, we present the genome of the bacterial endosymbiont from Haementeria officinalis, first of a glossiphoniid leech. This as-yet-unnamed endosymbiont belongs to the Gammaproteobacteria, has a pleomorphic shape and is restricted to bacteriocytes. For this bacterial endosymbiont, we propose the name Candidatus Providencia siddallii. This symbiont possesses a highly reduced genome with high A+T content and a reduced set of metabolic capabilities, all of which are common characteristics of ancient obligate endosymbionts of arthropods. Its genome has retained many pathways related to the biosynthesis of B-vitamins, pointing toward a role in supplementing the blood-restricted diet of its host. Through comparative genomics against the endosymbionts of A. americanum, Glossina flies, and P. humanus corporis, we were able to detect a high degree of metabolic convergence among these four very distantly related endosymbiotic bacteria. PMID:26454017

  3. The genus Thermotoga: Recent developments

    PubMed Central

    Frock, Andrew D.; Notey, Jaspreet S.; Kelly, Robert M.

    2013-01-01

    The genus Thermotoga comprises extremely thermophilic (Topt ≥ 70°C) and hyperthermophilic (Topt ≥ 80°C) bacteria that have been extensively studied for insights into the basis for life at elevated temperatures and for biotechnological opportunities (e.g., biohydrogen production, biocatalysis). Over the past decade, genome sequences have become available for a number of Thermotoga species, leading to functional genomics efforts to understand growth physiology as well as genomics-based identification and characterization of novel high temperature biocatalysts. Discussed here are recent developments along these lines for this novel group of microorganisms. PMID:20718299

  4. The LEECH Exoplanet Imaging Survey: Characterization of the Coldest Directly Imaged Exoplanet, GJ 504 b, and Evidence for Superstellar Metallicity

    NASA Astrophysics Data System (ADS)

    Skemer, Andrew J.; Morley, Caroline V.; Zimmerman, Neil T.; Skrutskie, Michael F.; Leisenring, Jarron; Buenzli, Esther; Bonnefoy, Mickael; Bailey, Vanessa; Hinz, Philip; Defrére, Denis; Esposito, Simone; Apai, Dániel; Biller, Beth; Brandner, Wolfgang; Close, Laird; Crepp, Justin R.; De Rosa, Robert J.; Desidera, Silvano; Eisner, Josh; Fortney, Jonathan; Freedman, Richard; Henning, Thomas; Hofmann, Karl-Heinz; Kopytova, Taisiya; Lupu, Roxana; Maire, Anne-Lise; Males, Jared R.; Marley, Mark; Morzinski, Katie; Oza, Apurva; Patience, Jenny; Rajan, Abhijith; Rieke, George; Schertl, Dieter; Schlieder, Joshua; Stone, Jordan; Su, Kate; Vaz, Amali; Visscher, Channon; Ward-Duong, Kimberly; Weigelt, Gerd; Woodward, Charles E.

    2016-02-01

    As gas giant planets and brown dwarfs radiate away the residual heat from their formation, they cool through a spectral type transition from L to T, which encompasses the dissipation of cloud opacity and the appearance of strong methane absorption. While there are hundreds of known T-type brown dwarfs, the first generation of directly imaged exoplanets were all L type. Recently, Kuzuhara et al. announced the discovery of GJ 504 b, the first T dwarf exoplanet. GJ 504 b provides a unique opportunity to study the atmosphere of a new type of exoplanet with a ˜500 K temperature that bridges the gap between the first directly imaged planets (˜1000 K) and our own solar system's Jupiter (˜130 K). We observed GJ 504 b in three narrow L-band filters (3.71, 3.88, and 4.00 μm), spanning the red end of the broad methane fundamental absorption feature (3.3 μm) as part of the LBTI Exozodi Exoplanet Common Hunt (LEECH) exoplanet imaging survey. By comparing our new photometry and literature photometry with a grid of custom model atmospheres, we were able to fit GJ 504 b's unusual spectral energy distribution for the first time. We find that GJ 504 b is well fit by models with the following parameters: Teff = 544 ± 10 K, g < 600 m s-2, [M/H] = 0.60 ± 0.12, cloud opacity parameter of fsed = 2-5, R = 0.96 ± 0.07 RJup, and log(L) = -6.13 ± 0.03 L⊙, implying a hot start mass of 3-30 Mjup for a conservative age range of 0.1-6.5 Gyr. Of particular interest, our model fits suggest that GJ 504 b has a superstellar metallicity. Since planet formation can create objects with nonstellar metallicities, while binary star formation cannot, this result suggests that GJ 504 b formed like a planet, not like a binary companion. The LBT is an international collaboration among institutions in the United States, Italy, and Germany. LBT Corporation partners are the University of Arizona on behalf of the Arizona university system; Istituto Nazionale di Astrophisica, Italy; LBT

  5. THE LEECH EXOPLANET IMAGING SURVEY: CHARACTERIZATION OF THE COLDEST DIRECTLY IMAGED EXOPLANET, GJ 504 b, AND EVIDENCE FOR SUPERSTELLAR METALLICITY

    SciTech Connect

    Skemer, Andrew J.; Leisenring, Jarron; Bailey, Vanessa; Hinz, Philip; Defrére, Denis; Apai, Dániel; Close, Laird; Eisner, Josh; Morley, Caroline V.; Fortney, Jonathan; Zimmerman, Neil T.; Buenzli, Esther; Bonnefoy, Mickael; Biller, Beth; Brandner, Wolfgang; Skrutskie, Michael F.; Esposito, Simone; Crepp, Justin R.; De Rosa, Robert J.; Desidera, Silvano; and others

    2016-02-01

    As gas giant planets and brown dwarfs radiate away the residual heat from their formation, they cool through a spectral type transition from L to T, which encompasses the dissipation of cloud opacity and the appearance of strong methane absorption. While there are hundreds of known T-type brown dwarfs, the first generation of directly imaged exoplanets were all L type. Recently, Kuzuhara et al. announced the discovery of GJ 504 b, the first T dwarf exoplanet. GJ 504 b provides a unique opportunity to study the atmosphere of a new type of exoplanet with a ∼500 K temperature that bridges the gap between the first directly imaged planets (∼1000 K) and our own solar system's Jupiter (∼130 K). We observed GJ 504 b in three narrow L-band filters (3.71, 3.88, and 4.00 μm), spanning the red end of the broad methane fundamental absorption feature (3.3 μm) as part of the LBTI Exozodi Exoplanet Common Hunt (LEECH) exoplanet imaging survey. By comparing our new photometry and literature photometry with a grid of custom model atmospheres, we were able to fit GJ 504 b's unusual spectral energy distribution for the first time. We find that GJ 504 b is well fit by models with the following parameters: T{sub eff} = 544 ± 10 K, g < 600 m s{sup −2}, [M/H] = 0.60 ± 0.12, cloud opacity parameter of f{sub sed} = 2–5, R = 0.96 ± 0.07 R{sub Jup}, and log(L) = −6.13 ± 0.03 L{sub ⊙}, implying a hot start mass of 3–30 M{sub jup} for a conservative age range of 0.1–6.5 Gyr. Of particular interest, our model fits suggest that GJ 504 b has a superstellar metallicity. Since planet formation can create objects with nonstellar metallicities, while binary star formation cannot, this result suggests that GJ 504 b formed like a planet, not like a binary companion.

  6. Australian Marsh Beetles (Coleoptera: Scirtidae). 7. Genus Nothocyphon, new genus.

    PubMed

    Zwick, Peter

    2015-07-06

    The new genus Nothocyphon (type species: Helodes (Cyphon ?) lindensis Blackburn, 1892) is proposed for small Contacyphon-like Australian beetles. The included species exhibit a generalized body structure, lacking the derived character expressions of related genera. Male tergite 9 is very weakly developed, membranous and bare. This is derived but as a reduction only weakly supports the monophyly of Nothocyphon.The new genus includes 39 species, with 37 newly described herein: Nothocyphon alces, n. sp., N. amita, n. sp., N. amphora, n. sp., N. armatus, n. sp., N. armstrongi, n. sp., N. auritus, n. sp., N. banksiae, n. sp., N. biserratus, n. sp., N. brevihamatus, n. sp., N. crux, n. sp., N. denticulatus, n. sp., N. donnabuangi, n. sp., N. esau, n. sp., N. frater (Blackburn), n. comb., N. horridus, n. sp., N. ímitator, n. sp., N. isolaeregis, n. sp., N. lanceolatus, n. sp., N. lindensis (Blackburn), n. comb., N. multidentatus, n. sp., N. naso, n. sp., N. nungatta, n. sp., N. pacificus, n. sp., N. patruelis, n. sp., N. platyphallus, n. sp., N. plicatus, n. sp., N. radula, n. sp., N. sarcophilus, n. sp., N. scutiger, n. sp., N. serratipenis, n. sp., N. signatus, n. sp., N. soror, n. sp., N. taeniatus, n. sp., N. taurus, n. sp., N. thylacinus, n. sp., N. triangulum, n. sp., N. vandiemeni, n. sp., N. wattsi, n. sp., N. ypsilon, n. sp.Lectotypes are designated for N. frater (Blackburn) and N. lindensis (Blackburn). All species are redescribed or described, and illustrated. Several informal species groups are recognized, and identification keys to males are provided.

  7. [Pseudomonas genus bacteria on weeds].

    PubMed

    Gvozdiak, R I; Iakovleva, L M; Pasichnik, L A; Shcherbina, T N; Ogorodnik, L E

    2005-01-01

    It has been shown in the work that the weeds (couch-grass and ryegrass) may be affected by bacterial diseases in natural conditions, Pseudomonas genus bacteria being their agents. The isolated bacteria are highly-aggressive in respect of the host-plant and a wide range of cultivated plants: wheat, rye, oats, barley, apple-tree and pear-tree. In contrast to highly aggressive bacteria isolated from the affected weeds, bacteria-epi phytes isolated from formally healthy plants (common amaranth, orache, flat-leaved spurge, field sow thistle, matricary, common coltsfoot, narrow-leaved vetch) and identified as P. syringae pv. coronafaciens, were characterized by weak aggression. A wide range of ecological niches of bacteria evidently promote their revival and distribution everywhere in nature.

  8. Evolution of the Genus Homo

    NASA Astrophysics Data System (ADS)

    Tattersall, Ian; Schwartz, Jeffrey H.

    2009-05-01

    Definition of the genus Homo is almost as fraught as the definition of Homo sapiens. We look at the evidence for “early Homo,” finding little morphological basis for extending our genus to any of the 2.5-1.6-myr-old fossil forms assigned to “early Homo” or Homo habilis/rudolfensis. We also point to heterogeneity among “early African Homo erectus,” and the lack of apomorphies linking these fossils to the Asian Homo erectus group, a cohesive regional clade that shows some internal variation, including brain size increase over time. The first truly cosmopolitan Homo species is Homo heidelbergensis, known from Africa, Europe, and China following 600 kyr ago. One species sympatric with it included the >500-kyr-old Sima de los Huesos fossils from Spain, clearly distinct from Homo heidelbergensis and the oldest hominids assignable to the clade additionally containing Homo neanderthalensis. This clade also shows evidence of brain size expansion with time; but although Homo neanderthalensis had a large brain, it left no unequivocal evidence of the symbolic consciousness that makes our species unique. Homo sapiens clearly originated in Africa, where it existed as a physical entity before it began (also in that continent) to show the first stirrings of symbolism. Most likely, the biological underpinnings of symbolic consciousness were exaptively acquired in the radical developmental reorganization that gave rise to the highly characteristic osteological structure of Homo sapiens, but lay fallow for tens of thousands of years before being “discovered” by a cultural stimulus, plausibly the invention of language.

  9. Eight new species in the genus Alphabaculovirus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    This taxonomic proposal recommends the addition of eight new species to the genus Alphabaculovirus of the family Baculoviridae. Placement of these new species within genus Alphabaculovirus is based on the following criteria: host species of the insect order Lepidoptera; circular double-stranded DNA...

  10. Na(+)/K(+) pump interacts with the h-current to control bursting activity in central pattern generator neurons of leeches.

    PubMed

    Kueh, Daniel; Barnett, William H; Cymbalyuk, Gennady S; Calabrese, Ronald L

    2016-09-02

    The dynamics of different ionic currents shape the bursting activity of neurons and networks that control motor output. Despite being ubiquitous in all animal cells, the contribution of the Na(+)/K(+) pump current to such bursting activity has not been well studied. We used monensin, a Na(+)/H(+) antiporter, to examine the role of the pump on the bursting activity of oscillator heart interneurons in leeches. When we stimulated the pump with monensin, the period of these neurons decreased significantly, an effect that was prevented or reversed when the h-current was blocked by Cs(+). The decreased period could also occur if the pump was inhibited with strophanthidin or K(+)-free saline. Our monensin results were reproduced in model, which explains the pump's contributions to bursting activity based on Na(+) dynamics. Our results indicate that a dynamically oscillating pump current that interacts with the h-current can regulate the bursting activity of neurons and networks.

  11. Sugawara construction for higher genus Riemann surfaces

    NASA Astrophysics Data System (ADS)

    Schlichenmaier, Martin

    1999-04-01

    By the classical genus zero Sugawara construction one obtains representations of the Virasoro algebra from admissible representations of affine Lie algebras (Kac-Moody algebras of affine type). In this lecture, the classical construction is recalled first. Then, after giving a review on the global multi-point algebras of Krichever-Novikov type for compact Riemann surfaces of arbitrary genus, the higher genus Sugawara construction is introduced. Finally, the lecture reports on results obtained in a joint work with O. K. Sheinman. We were able to show that also in the higher genus, multi-point situation one obtains (from representations of the global algebras of affine type) representations of a centrally extended algebra of meromorphic vector fields on Riemann surfaces. The latter algebra is a generalization of the Virasoro algebra to higher genus.

  12. Beta Genus Papillomaviruses and Skin Cancer

    PubMed Central

    Howley, Peter M.; Pfister, Herbert J.

    2015-01-01

    A role for the beta genus HPVs in keratinocyte carcinoma (KC) remains to be established. In this article we examine the potential role of the beta HPVs in cancer revealed by the epidemiology associating these viruses with KC and supported by oncogenic properties of the beta HPV proteins. Unlike the cancer associated alpha genus HPVs, in which transcriptionally active viral genomes are invariably found associated with the cancers, that is not the case for the beta genus HPVs and keratinocyte carcinomas. Thus a role for the beta HPVs in KC would necessarily be in the carcinogenesis initiation and not in the maintenance of the tumor. PMID:25724416

  13. Industrial importance of the genus Brevibacterium.

    PubMed

    Onraedt, Annelies; Soetaert, Wim; Vandamme, Erick

    2005-04-01

    The genus Brevibacterium has long been difficult for taxonomists to classify due to its close morphological similarity to other genera. Since it was proposed in 1953, the genus has often been redefined. The genus is best known for its important role in the ripening of certain cheeses (B. linens) and for its supposed over-production of L: -amino acids. Other interesting industrial applications, including the production of ectoine, have recently been proposed. The general characteristics, the occurrence and the recent taxonomy of Brevibacterium are reviewed here. Furthermore, known and potential industrial applications for Brevibacterium species are briefly discussed.

  14. Revision of the African genus Uvariastrum (Annonaceae)

    PubMed Central

    Couvreur, Thomas L.P.

    2014-01-01

    Abstract The genus Uvariastrum (Annonaceae) is restricted to continental Africa and is characterized by sepals with folded margins, few carpels and numerous stamens. The genus is mainly found in the tropical lowland rain forests of Africa, with one species growing in a drier woodland habitat. The species name Uvariastrum pynaertii De Wild is reduced into synonymy with Uvariastrum zenkeri Engl. & Diels. Uvaraistrum neglectum Paiva and Uvariastrum modestum Dielsare transferred to the genus Uvaria leading to two new combinations: Uvaria modesta (Diels) Couvreur, comb. nov. and Uvaria paivana Couvreur, nom. nov. Five species are currently recognized in Uvariastrum. The present revision, the first of the genus for over 100 years, provides an overview of previously published information and discussions on morphology, taxonomy and palynology. Preliminary conservation status assessments are provided for each species, as well as diagnostic keys for fruiting and flowering material as well as detailed species descriptions. Furthermore, all species are illustrated by line drawings and all species are mapped. PMID:24526846

  15. Borneocola (Zingiberaceae), a new genus from Borneo

    PubMed Central

    Sam, Yen Yen; Takano, Atsuko; Ibrahim, Halijah; Záveská, Eliška; Aziz, Fazimah

    2016-01-01

    Abstract A new genus from Borneo, Borneocola Y.Y.Sam, is described here. The genus currently contains eight species previously classified as members of the Scaphochlamys Baker. The finding is based on the results of the morphological and molecular studies of Scaphochlamys throughout its geographical range and its closely allied sister groups, Distichochlamys M.F.Newman and Myxochlamys A.Takano & Nagam. Borneocola is nested within the tribe Zingibereae and its monophyly is strongly supported by both ITS and matK sequence data. The genus is characterised by several thin, translucent and marcescent floral bracts, absence of coloured streaks on the labellum and capitate stigma with two dorsal knobs. The genus is distributed in northwest Borneo and all species are very rare and highly endemic. PMID:28127243

  16. Evolutionary history of the genus Trisopterus.

    PubMed

    Gonzalez, Elena G; Cunha, Regina L; Sevilla, Rafael G; Ghanavi, Hamid R; Krey, Grigorios; Bautista, José M

    2012-03-01

    The group of small poor cods and pouts from the genus Trisopterus, belonging to the Gadidae family, comprises four described benthopelagic species that occur across the North-eastern Atlantic, from the Baltic Sea to the coast of Morocco, and the Mediterranean. Here, we combined molecular data from mitochondrial (cytochrome b) and nuclear (rhodopsin) genes to confirm the taxonomic status of the described species and to disentangle the evolutionary history of the genus. Our analyses supported the monophyly of the genus Trisopterus and confirmed the recently described species Trisopterus capelanus. A relaxed molecular clock analysis estimated an Oligocene origin for the group (~30 million years ago; mya) indicating this genus as one of the most ancestral within the Gadidae family. The closure and re-opening of the Strait of Gibraltar after the Messinian Salinity Crisis (MSC) probably triggered the speciation process that resulted in the recently described T. capelanus.

  17. Revision of the African genus Uvariastrum (Annonaceae).

    PubMed

    Couvreur, Thomas L P

    2014-01-01

    The genus Uvariastrum (Annonaceae) is restricted to continental Africa and is characterized by sepals with folded margins, few carpels and numerous stamens. The genus is mainly found in the tropical lowland rain forests of Africa, with one species growing in a drier woodland habitat. The species name Uvariastrum pynaertii De Wild is reduced into synonymy with Uvariastrum zenkeri Engl. & Diels. Uvaraistrum neglectum Paiva and Uvariastrum modestum Dielsare transferred to the genus Uvaria leading to two new combinations: Uvaria modesta (Diels) Couvreur, comb. nov. and Uvaria paivana Couvreur, nom. nov. Five species are currently recognized in Uvariastrum. The present revision, the first of the genus for over 100 years, provides an overview of previously published information and discussions on morphology, taxonomy and palynology. Preliminary conservation status assessments are provided for each species, as well as diagnostic keys for fruiting and flowering material as well as detailed species descriptions. Furthermore, all species are illustrated by line drawings and all species are mapped.

  18. The Genus Hafnia: from Soup to Nuts

    PubMed Central

    Janda, J. Michael; Abbott, Sharon L.

    2006-01-01

    The genus Hafnia, a member of the family Enterobacteriaceae, consists of gram-negative bacteria that are occasionally implicated in both intestinal and extraintestinal infections in humans. Despite the fact that the genus currently contains only a single species (H. alvei), more extensive phylogenetic depth (two or more species) is apparent based upon DNA relatedness and 16S rRNA gene sequencing studies. Hafnia causes a variety of systemic infections, including septicemia and pneumonia; however, its role as a gastrointestinal pathogen is controversial. Many of the data supporting a role for hafniae as enteric pathogens were incorrectly attributed to this genus rather than to the actual pathogen, Escherichia albertii. There are numerous gaps in our understanding of this genus, including ecologic habitats and population genetics, disease-producing role in animals, phenetic and genetic methods useful in distinguishing genomospecies within the H. alvei complex, and bona fide pathogenicity factors. PMID:16418520

  19. THE GENUS TRIGONELLA – PHYTOCHEMISTRY AND BIOLOGY

    PubMed Central

    Jain, S.C; Agrawal, M.; Sharma, R.A.

    1996-01-01

    The genus Trigonella is an annual plant distributed in the Mediterranean region and it comprises several species. The present report deals with the dietary, medicinal, biochemical biological and various pharmacological properties. PMID:22556778

  20. Mcphersonarcys, a new genus for Pentatomaaequalis Say (Heteroptera: Pentatomidae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new monotypic genus, Mcphersonarcys, is erected to hold Pentatoma aequalis Say, a species formerly placed in the genus Hymenarcys. Based on the distribution of 19 character-states Hymenarcys forms a clade with its sister genus Coenus. Both genera are related to the large genus Euschistus. Mcphe...

  1. Genomic diversity within the haloalkaliphilic genus Thioalkalivibrio

    PubMed Central

    Ahn, Anne-Catherine; Meier-Kolthoff, Jan P.; Overmars, Lex; Richter, Michael; Woyke, Tanja; Sorokin, Dimitry Y.

    2017-01-01

    Thioalkalivibrio is a genus of obligate chemolithoautotrophic haloalkaliphilic sulfur-oxidizing bacteria. Their habitat are soda lakes which are dual extreme environments with a pH range from 9.5 to 11 and salt concentrations up to saturation. More than 100 strains of this genus have been isolated from various soda lakes all over the world, but only ten species have been effectively described yet. Therefore, the assignment of the remaining strains to either existing or novel species is important and will further elucidate their genomic diversity as well as give a better general understanding of this genus. Recently, the genomes of 76 Thioalkalivibrio strains were sequenced. On these, we applied different methods including (i) 16S rRNA gene sequence analysis, (ii) Multilocus Sequence Analysis (MLSA) based on eight housekeeping genes, (iii) Average Nucleotide Identity based on BLAST (ANIb) and MUMmer (ANIm), (iv) Tetranucleotide frequency correlation coefficients (TETRA), (v) digital DNA:DNA hybridization (dDDH) as well as (vi) nucleotide- and amino acid-based Genome BLAST Distance Phylogeny (GBDP) analyses. We detected a high genomic diversity by revealing 15 new “genomic” species and 16 new “genomic” subspecies in addition to the ten already described species. Phylogenetic and phylogenomic analyses showed that the genus is not monophyletic, because four strains were clearly separated from the other Thioalkalivibrio by type strains from other genera. Therefore, it is recommended to classify the latter group as a novel genus. The biogeographic distribution of Thioalkalivibrio suggested that the different “genomic” species can be classified as candidate disjunct or candidate endemic species. This study is a detailed genome-based classification and identification of members within the genus Thioalkalivibrio. However, future phenotypical and chemotaxonomical studies will be needed for a full species description of this genus. PMID:28282461

  2. Evolution of clitellate phaosomes from rhabdomeric photoreceptor cells of polychaetes – a study in the leech Helobdella robusta (Annelida, Sedentaria, Clitellata)

    PubMed Central

    2013-01-01

    Introduction In Annelida two types of photoreceptor cells (PRCs) are regarded as generally present, rhabdomeric and ciliary PRCs. In certain taxa, however, an additional type of PRC may occur, the so called phaosomal PRC. Whereas the former two types of PRCs are always organized as an epithelium with their sensory processes projecting into an extracellular cavity formed by the PRCs and (pigmented) supportive cells, phaosomes are seemingly intracellular vacuoles housing the sensory processes. Phaosomal PRCs are the only type of PRC found in one major annelid group, Clitellata. Several hypotheses have been put forward explaining the evolutionary origin of the clitellate phaosomes. To elucidate the evolution of clitellate PRC and eyes the leech Helobdella robusta, for which a sequenced genome is available, was chosen. Results TEM observations showed that extraocular and ocular PRCs are structurally identical. Bioinformatic analyses revealed predictions for four opsin genes, three of which could be amplified. All belong to the rhabdomeric opsin family and phylogenetic analyses showed them in a derived position within annelid opsins. Gene expression studies showed two of them expressed in the eye and in the extraocular PRCs. Polychaete eye-typic key enzymes for ommochromme and pterin shading pigments synthesis are not expressed in leech eyes. Conclusions By comparative gene-expression studies we herein provide strong evidence that the phaosomal PRCs typical of Clitellata are derived from the rhabdomeric PRCs characteristic for polychaete adult eyes. Thus, they represent a highly derived type of PRC that evolved in the stem lineage of Clitellata rather than another, primitive type of PRC in Metazoa. Evolution of these PRCs in Clitellata is related to a loss of the primary eyes and most of their photoreceptive elements except for the rhabdomeric PRCs. Most likely this happened while changing to an endobenthic mode of life. This hypothesis of PRC evolution is in accordance

  3. Taxonomy and Chemotaxonomy of the Genus Hypericum

    PubMed Central

    Crockett, Sara L.; Robson, Norman K. B.

    2012-01-01

    The genus Hypericum L. (St. John’s Wort, Hypericaceae) includes, at the most recent count, 469 species that are either naturally occurring on, or which have been introduced to, every continent in the world, except Antarctica. These species occur as herbs, shrubs, and infrequently trees, and are found in a variety of habitats in temperate regions and in high mountains in the tropics, avoiding only zones of extreme aridity, temperature and/or salinity. Monographic work on the genus has resulted in the recognition and description of 36 taxonomic sections, delineated by specific combinations of morphological characteristics and biogeographic distribution ranges. Hypericum perforatum L. (Common St. John’s wort, section Hypericum), one of the best-known members of the genus, is an important medicinal herb of which extracts are taken for their reported activity against mild to moderate depression. Many other species have been incorporated in traditional medicine systems in countries around the world, or are sold as ornamentals. Several classes of interesting bioactive secondary metabolites, including naphthodianthrones (e.g. hypericin and pseudohypericin), flavonol glycosides (e.g. isoquercitrin and hyperoside), biflavonoids (e.g. amentoflavone), phloroglucinol derivatives (e.g. hyperforin and adhyperforin) and xanthones have been identified from members of the genus. A general overview of the taxonomy of the genus and the distribution of relevant secondary metabolites is presented. PMID:22662019

  4. Identification and nomenclature of the genus Penicillium.

    PubMed

    Visagie, C M; Houbraken, J; Frisvad, J C; Hong, S-B; Klaassen, C H W; Perrone, G; Seifert, K A; Varga, J; Yaguchi, T; Samson, R A

    2014-06-01

    Penicillium is a diverse genus occurring worldwide and its species play important roles as decomposers of organic materials and cause destructive rots in the food industry where they produce a wide range of mycotoxins. Other species are considered enzyme factories or are common indoor air allergens. Although DNA sequences are essential for robust identification of Penicillium species, there is currently no comprehensive, verified reference database for the genus. To coincide with the move to one fungus one name in the International Code of Nomenclature for algae, fungi and plants, the generic concept of Penicillium was re-defined to accommodate species from other genera, such as Chromocleista, Eladia, Eupenicillium, Torulomyces and Thysanophora, which together comprise a large monophyletic clade. As a result of this, and the many new species described in recent years, it was necessary to update the list of accepted species in Penicillium. The genus currently contains 354 accepted species, including new combinations for Aspergillus crystallinus, A. malodoratus and A. paradoxus, which belong to Penicillium section Paradoxa. To add to the taxonomic value of the list, we also provide information on each accepted species MycoBank number, living ex-type strains and provide GenBank accession numbers to ITS, β-tubulin, calmodulin and RPB2 sequences, thereby supplying a verified set of sequences for each species of the genus. In addition to the nomenclatural list, we recommend a standard working method for species descriptions and identifications to be adopted by laboratories working on this genus.

  5. A Genus Oblivious Approach to Cross Parameterization

    SciTech Connect

    Bennett, J C; Pascucci, V; Joy, K I

    2008-06-16

    In this paper we present a robust approach to construct a map between two triangulated meshes, M and M{prime} of arbitrary and possibly unequal genus. We introduce a novel initial alignment scheme that allows the user to identify 'landmark tunnels' and/or a 'constrained silhouette' in addition to the standard landmark vertices. To describe the evolution of non-landmark tunnels we automatically derive a continuous deformation from M to M{prime} using a variational implicit approach. Overall, we achieve a cross parameterization scheme that is provably robust in the sense that it can map M to M{prime} without constraints on their relative genus. We provide a number of examples to demonstrate the practical effectiveness of our scheme between meshes of different genus and shape.

  6. Na+/K+ pump interacts with the h-current to control bursting activity in central pattern generator neurons of leeches

    PubMed Central

    Kueh, Daniel; Barnett, William H; Cymbalyuk, Gennady S; Calabrese, Ronald L

    2016-01-01

    The dynamics of different ionic currents shape the bursting activity of neurons and networks that control motor output. Despite being ubiquitous in all animal cells, the contribution of the Na+/K+ pump current to such bursting activity has not been well studied. We used monensin, a Na+/H+ antiporter, to examine the role of the pump on the bursting activity of oscillator heart interneurons in leeches. When we stimulated the pump with monensin, the period of these neurons decreased significantly, an effect that was prevented or reversed when the h-current was blocked by Cs+. The decreased period could also occur if the pump was inhibited with strophanthidin or K+-free saline. Our monensin results were reproduced in model, which explains the pump’s contributions to bursting activity based on Na+ dynamics. Our results indicate that a dynamically oscillating pump current that interacts with the h-current can regulate the bursting activity of neurons and networks. DOI: http://dx.doi.org/10.7554/eLife.19322.001 PMID:27588351

  7. Lineage analysis of micromere 4d, a super-phylotypic cell for Lophotrochozoa, in the leech Helobdella and the sludgeworm Tubifex

    PubMed Central

    Gline, Stephanie E.; Nakamoto, Ayaki; Cho, Sung-Jin; Chi, Candace; Weisblat, David A.

    2011-01-01

    The super-phylum Lophotrochozoa contains the plurality of extant animal phyla and exhibits a corresponding diversity of adult body plans. Moreover, in contrast to Ecdysozoa and Deuterostomia, most lophotrochozoans exhibit a conserved pattern of stereotyped early divisions called spiral cleavage. In particular, bilateral mesoderm in most lophotrochozoan species arises from the progeny of micromere 4d, which is assumed to be homologous with a similar cell in the embryo of the ancestral lophotrochozoan, more than 650 million years ago. Thus, distinguishing the conserved and diversified features of cell fates in the 4d lineage among modern spiralians is required to understand how lophotrochozoan diversity has evolved by changes in developmental processes. Here we analyze cell fates for the early progeny of the bilateral daughters (M teloblasts) of micromere 4d in the leech Helobdella sp. Austin, a clitellate annelid. We show that the first six progeny of the M teloblasts (em1–em6) contribute five different sets of progeny to non-segmental mesoderm, mainly in the head and in the lining of the digestive tract. The latter feature, associated with cells em1 and em2 in Helobdella, is seen with the M teloblast lineage in a second clitellate species, the sludgeworm Tubifex tubifex and, on the basis of previously published work, in the initial progeny of the M teloblast homologs in molluscan species, suggesting that it may be an ancestral feature of lophotrochozoan development. PMID:21295566

  8. Comparison of the effects of millimeter wave irradiation, general bath heating, and localized heating on neuronal activity in the leech ganglion

    NASA Astrophysics Data System (ADS)

    Romanenko, Sergii; Siegel, Peter H.; Wagenaar, Daniel A.; Pikov, Victor

    2013-02-01

    The use of electrically-induced neuromodulation has grown in importance in the treatment of multiple neurological disorders such as Parkinson's disease, dystonia, epilepsy, chronic pain, cluster headaches and others. While electrical current can be applied locally, it requires placing stimulation electrodes in direct contact with the neural tissue. Our goal is to develop a method for localized application of electromagnetic energy to the brain without direct tissue contact. Toward this goal, we are experimenting with the wireless transmission of millimeter wave (MMW) energy in the 10-100 GHz frequency range, where penetration and focusing can be traded off to provide non-contact irradiation of the cerebral cortex. Initial experiments have been conducted on freshly-isolated leech ganglia to evaluate the real-time changes in the activity of individual neurons upon exposure to the MMW radiation. The initial results indicate that low-intensity MMWs can partially suppress the neuronal activity. This is in contrast to general bath heating, which had an excitatory effect on the neuronal activity. Further studies are underway to determine the changes in the state of the membrane channels that might be responsible for the observed neuromodulatory effects.

  9. Phylogeny of the plant genus Pachypodium (Apocynaceae)

    PubMed Central

    Mugford, Kaila; Hastings, Amy P.; Agrawal, Anurag A.

    2013-01-01

    Background. The genus Pachypodium contains 21 species of succulent, generally spinescent shrubs and trees found in southern Africa and Madagascar. Pachypodium has diversified mostly into arid and semi-arid habitats of Madagascar, and has been cited as an example of a plant group that links the highly diverse arid-adapted floras of Africa and Madagascar. However, a lack of knowledge about phylogenetic relationships within the genus has prevented testing of this and other hypotheses about the group. Methodology/Principal Findings. We use DNA sequence data from the nuclear ribosomal ITS and chloroplast trnL-F region for all 21 Pachypodium species to reconstruct evolutionary relationships within the genus. We compare phylogenetic results to previous taxonomic classifications and geography. Results support three infrageneric taxa from the most recent classification of Pachypodium, and suggest that a group of African species (P. namaquanum, P. succulentum and P. bispinosum) may deserve taxonomic recognition as an infrageneric taxon. However, our results do not resolve relationships among major African and Malagasy lineages of the genus. Conclusions/Significance. We present the first molecular phylogenetic analysis of Pachypodium. Our work has revealed five distinct lineages, most of which correspond to groups recognized in past taxonomic classifications. Our work also suggests that there is a complex biogeographic relationship between Pachypodium of Africa and Madagascar. PMID:23646289

  10. Review of the genus Tenuipalpus (Acari: Tenuipalpidae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Tenuipalpus Donnadieu is the most speciose genus of the family Tenuipalpidae, with over 300 described species. The descriptions of many of these species are incomplete, and lack important information necessary for accurate species identification. The objective of this study was to re-describe specie...

  11. The genus Sipha in North America

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Five species of the aphid genus Sipha are reported in North America and are reviewed herein. Of these species, three are adventive: Sipha elegans del Guercio, Sipha glyceriae (Kaltenbach), and Sipha maydis Passerini. Sipha maydis was discovered in California in 2007 and now has been found in Georgia...

  12. Identification and nomenclature of the genus Penicillium

    PubMed Central

    Visagie, C.M.; Houbraken, J.; Frisvad, J.C.; Hong, S.-B.; Klaassen, C.H.W.; Perrone, G.; Seifert, K.A.; Varga, J.; Yaguchi, T.; Samson, R.A.

    2014-01-01

    Penicillium is a diverse genus occurring worldwide and its species play important roles as decomposers of organic materials and cause destructive rots in the food industry where they produce a wide range of mycotoxins. Other species are considered enzyme factories or are common indoor air allergens. Although DNA sequences are essential for robust identification of Penicillium species, there is currently no comprehensive, verified reference database for the genus. To coincide with the move to one fungus one name in the International Code of Nomenclature for algae, fungi and plants, the generic concept of Penicillium was re-defined to accommodate species from other genera, such as Chromocleista, Eladia, Eupenicillium, Torulomyces and Thysanophora, which together comprise a large monophyletic clade. As a result of this, and the many new species described in recent years, it was necessary to update the list of accepted species in Penicillium. The genus currently contains 354 accepted species, including new combinations for Aspergillus crystallinus, A. malodoratus and A. paradoxus, which belong to Penicillium section Paradoxa. To add to the taxonomic value of the list, we also provide information on each accepted species MycoBank number, living ex-type strains and provide GenBank accession numbers to ITS, β-tubulin, calmodulin and RPB2 sequences, thereby supplying a verified set of sequences for each species of the genus. In addition to the nomenclatural list, we recommend a standard working method for species descriptions and identifications to be adopted by laboratories working on this genus. PMID:25505353

  13. The marine leech Stibarobdella loricata (Harding, 1924) (Hirudinea, Piscicolidae), parasitic on the angel shark Squatina spp. and sandtiger shark Carcharias taurus Rafinesque, 1810 (Chondrichthyes: Squatinidae, Carchariidae) in Southern Brazilian waters.

    PubMed

    Soto, J M R

    2003-11-01

    The presence of the marine leech, Stibarobdella loricata (Harding, 1924) (Hirudinea, Piscicolidae), is reported on the southern coast of Brazil, based on seven lots with 47 specimens, between 71 and 182 mm in total length, collected on the dorsal region of angel sharks, Squatina argentina (Marini, 1930); S. guggenheim Marini, 1936; S. punctata Marini, 1936 (Chondrichthyes, Squatinidae); and on the head of a sandtiger shark, Carcharias taurus Rafinesque, 1810 (Chondrichthyes, Carchariidae). This is the first record of S. loricata in the western Atlantic and of its parasitic association with S. argentina, S. guggenheim, S. punctata, and C. taurus.

  14. A New Genus of Macropsinae (Hemiptera: Cicadellidae) From Madagascar

    PubMed Central

    Yang, Liyuan; Dietrich, C.H.; Zhang, Yalin

    2016-01-01

    Paragalboa acuta gen. & sp. n. is described and illustrated from Madagascar. The new genus shows morphological affinities to the Macropsini genus Galboa Distant recorded from Seychelles. A checklist of all known genera of Macropsinae is provided. PMID:27389563

  15. Genus III. Actinokineospora Hasegawa 1988a, 449vp

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The physiology, systematics and ecology of the species that currently composes the actinobacterial genus Actinokineospora is presented. The phylogenetic position of the species within this genus relative to the other genera within the suborder Pseudonocardineae is discussed. Methods for isolation,...

  16. Certhiasomus, a new genus of woodcreeper (Aves: Passeriformes: Dendrocolaptidae)

    USGS Publications Warehouse

    Derryberry, Elizabeth; Claramunt, Santiago; Chesser, R. Terry; Aleixo, Alexandre; Cracraft, Joel; Moyle, Robert G.; Brumfield, Robb T.

    2010-01-01

    Phylogenetic analysis of the family Dendrocolaptidae (Aves: Passeriformes) indicates that the two species traditionally placed in the genus Deconychura are not sister taxa. Certhiasomus, a new genus of woodcreeper, is described for one of these species, C. stictolaemus.

  17. Calocybella, a new genus for Rugosomyces pudicus (Agaricales, Lyophyllaceae) and emendation of the genus Gerhardtia.

    PubMed

    Vizzini, Alfredo; Consiglio, Giovanni; Setti, Ledo; Ercole, Enrico

    2015-06-01

    Calocybella is a new genus established to accommodate Rugosomyces pudicus. Phylogenetic analyses based on a LSU-ITS sequence dataset place Calocybella sister to Gerhardtia from which it differs morphologically in the presence of clamp-connections and reddening context. The genus Gerhardtia is emended to also include taxa with smooth spores. According to our morphological analysis of voucher material, Calocybe juncicola s. auct. is shown to be Calocybella pudica.

  18. Pseudasthenes, a new genus of ovenbird (Aves: Passeriformes: Furnariidae)

    USGS Publications Warehouse

    Derryberry, Elizabeth; Claramunt, Santiago; O'Quin, Kelly E.; Aleixo, Alexandre; Chesser, R. Terry; Remsen, J.V.; Brumfield, Robb T.

    2010-01-01

    Phylogenetic analysis of the family Furnariidae (Aves: Passeriformes) indicates that the genus Asthenes is polyphyletic, consisting of two groups that are not sister taxa. Pseudasthenes, a new genus of ovenbird, is described for one of these groups. The four species included in the new genus, formerly placed in Asthenes, are P. humicola, P. patagonica, P. steinbachi, and P. cactorum.

  19. Create the genus Pelarspovirus in the family Tombusviridae

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In 2014 we submitted a proposal to create this new genus with six members. The Executive Committee (EC) of the ICTV did not support its creation at that time due to the placement of the pelarspovirus genus branch within a larger monophyletic lineage of many of the members of the carmovirus genus wh...

  20. A note on the trilobite genus Dixiphopyge

    USGS Publications Warehouse

    Brezinski, D.K.

    1997-01-01

    Recovery of the first nearly complete thoracopygon of the trilobite genus Dixiphopyge Brezinski from the Chouteau Formation of central Missouri aids in evaluating the paleoecology and taxonomic affinities of this genus. Dixiphopyge is an isopygous trilobite, suboval in outline, and possessing nine thoracic segments. At the apex of each axial ring is a hollow tubercle that may represent the base of a short spine. Dixiphopyge inhabited muddy biostrome environments. In an enrolled position Dixiphopyge is interpreted to have looked somewhat like a porcupine with its spines radiating outward, presumably to inhibit its consumption by predators. Previous subfamily assignment of Dixiphopyge in the Otarioninae with Cyphaspis and Namuropyge may have been incorrect, because the latter two genera possess broad preglabellar fields and are micropygous.

  1. Operators and higher genus mirror curves

    NASA Astrophysics Data System (ADS)

    Codesido, Santiago; Gu, Jie; Mariño, Marcos

    2017-02-01

    We perform further tests of the correspondence between spectral theory and topological strings, focusing on mirror curves of genus greater than one with nontrivial mass parameters. In particular, we analyze the geometry relevant to the SU(3) relativistic Toda lattice, and the resolved C{^3}/Z_6 orbifold. Furthermore, we give evidence that the correspondence holds for arbitrary values of the mass parameters, where the quantization problem leads to resonant states. We also explore the relation between this correspondence and cluster integrable systems.

  2. Taxonomy of Marine Bacteria: the Genus Beneckea

    PubMed Central

    Baumann, Paul; Baumann, Linda; Mandel, M.

    1971-01-01

    One-hundred-and-forty-five isolates of marine origin were submitted to an extensive physiological, nutritional, and morphological characterization. All strains were gram-negative, facultatively anaerobic, straight or curved rods which were motile by means of flagella. Glucose was fermented with the production of acid but no gas. Sodium but no organic growth factors were required. None of the strains were able to denitrify or fix molecular nitrogen. The results of nutritional and physiological tests were submitted to a numerical analysis. On the basis of phenotypic similarity, nine groups were established. These groups could be distinguished from one another by multiple, unrelated, phenotypic traits. Six groups which had deoxyribonucleic acid (DNA) containing 45 to 48 moles per cent guanine plus cytosine (GC) were assigned to a redefined genus Beneckea. All of the strains in this genus, when grown in liquid medium, had a single, polar flagellum. When grown on a solid medium, many strains had peritrichous flagella. Two groups were similar to previously described species and were designated B. alginolytica and B. natriegens. The remaining four groups were designated B. campbellii, B. neptuna, B. nereida, and B. pelagia. An additional group of phenotypically similar strains having the properties of the genus Beneckea was not included in the numerical analysis. These strains were readily separable from species of this genus and were designated B. parahaemolytica. Of the remaining groups, one was identified as Photobacterium fischeri. The other group (B-2) which had about 41 moles% GC content in its DNA could not be placed into existing genera. Images PMID:4935323

  3. Phytochemical, ethnomedicinal uses and pharmacological profile of genus Pistacia.

    PubMed

    Rauf, Abdur; Patel, Seema; Uddin, Ghias; Siddiqui, Bina S; Ahmad, Bashir; Muhammad, Naveed; Mabkhot, Yahia N; Hadda, Taibi Ben

    2017-02-01

    Pistacia genus belong to family Anacardiaceae and it is versatile in that its member species have food (P. vera), medicinal (P. lentiscus) and ornamental (P. chinensis) values. Various species of this genus have folkloric uses with credible mention in diverse pharmacopeia. As a trove of phenolic compounds, terpenoids, monoterpenes, flavonoids, alkaloids, saponins, fatty acids, and sterols, this genus has garnered pharmaceutical attention in recent times. With adequate clinical studies, this genus might be exploited for therapy of a multitude of inflammatory diseases, as promised by preliminary studies. In this regard, the ethnomedicinal, phytochemistry, biological potencies, risks, and scopes of Pistacia genus have been reviewed here.

  4. Biodegradation of chlorpyrifos by bacterial genus Pseudomonas.

    PubMed

    Gilani, Razia Alam; Rafique, Mazhar; Rehman, Abdul; Munis, Muhammad Farooq Hussain; Rehman, Shafiq Ur; Chaudhary, Hassan Javed

    2016-02-01

    Chlorpyrifos is an organophosphorus pesticide commonly used in agriculture. It is noxious to a variety of organisms that include living soil biota along with beneficial arthropods, fish, birds, humans, animals, and plants. Exposure to chlorpyrifos may cause detrimental effects as delayed seedling emergence, fruit deformities, and abnormal cell division. Contamination of chlorpyrifos has been found about 24 km from the site of its application. There are many physico-chemical and biological approaches to remove organophosphorus pesticides from the ecosystem, among them most promising is biodegradation. The 3,5,6-trichloro-2-pyridinol (TCP) and diethylthiophosphate (DETP) as primary products are made when chlorpyrifos is degraded by soil microorganisms which further break into nontoxic metabolites as CO(2), H(2)O, and NH(3). Pseudomonas is a diversified genus possessing a series of catabolic pathways and enzymes involved in pesticide degradation. Pseudomonas putida MAS-1 is reported to be more efficient in chlorpyrifos degradation by a rate of 90% in 24 h among Pseudomonas genus. The current review analyzed the comparative potential of bacterial species in Pseudomonas genus for degradation of chlorpyrifos thus, expressing an ecofriendly approach for the treatment of environmental contaminants like pesticides.

  5. The Pangenome of the genus Clostridium.

    PubMed

    Udaondo, Zulema; Duque, Estrella; Ramos, Juan Luis

    2017-03-21

    We present the pangenome for the genus Clostridium sensu stricto, which was obtained using highly curated and annotated genomes from 16 species, some of these cause disease, while others are used for the production of added-value chemicals. Multilocus sequencing analysis revealed that species of this genus group into at least two clades that include non-pathogenic and pathogenic strains, suggesting that pathogenicity is dispersed across the phylogenetic tree. The core genome of the genus includes 546 protein families, which mainly comprise those involved in protein translation and DNA repair. The GS-GOGAT may represent the central pathway for generating organic nitrogen from inorganic nitrogen sources. Glycerol and glucose metabolism genes are well represented in the core genome together with a set of energy conservation systems. A metabolic network comprising proteins/enzymes, RNAs and metabolites, whose topological structure is a non-random and scale-free network with hierarchically structured modules was built. These modules shed light on the interactions between RNAs, proteins and metabolites, revealing biological features of transcription and translation, cell wall biosynthesis, C1 metabolism and N metabolism. Network analysis identified four nodes that function as hubs and bottlenecks, namely, coenzyme A, HPr kinases, S-adenosylmethionine and the ribonuclease P-protein, suggesting pivotal roles for them in Clostridium. This article is protected by copyright. All rights reserved.

  6. Ethnopharmacology of the plants of genus Ajuga.

    PubMed

    Israili, Zafar H; Lyoussi, Badiâa

    2009-10-01

    The plants of genus Ajuga are evergreen, clump-forming rhizomatous perennial or annual herbaceous flowering species, with Ajuga being one of the 266 genera of the family Lamiaceae. There are at least 301 species of the genus Ajuga with many variations. These plants, growing in Europe, Asia, Africa, Australia and North America, are used in gardens as ground cover or border for their foliage and beautiful flowers. Many of these plants have been used in traditional medicine as a remedy for fever, toothache, dysentery, malaria, high blood pressure, diabetes, gastrointestinal disorders, as anthelmintic, diuretic and antifungal, anti-inflammatory, and antimycobacterial agents. They are also used as insect growth inhibitor s. A large number of compounds have been isolated from the Ajuga plants, including phytoecdysteroids, neo-clerodane-diterpenes and diterpenoids, triterpenes, sterols, anthocyanidin-glucosides and iridoid glycosides, withanolides, flavonoids, triglycerides and essential oils. These compounds possess a broad spectrum of biological, pharmacological and medicinal properties, such as anabolic, analgesic, antibacterial, antiestrogenic, antifungal, anti-inflammatory, antihypertensive, antileukemic, antimalarial, antimycobacterial, antioxidant, antipyretic, cardiotonic, cytotoxic, hypoglycemic, and vasorelaxing activity, as well as antifeedant and insect growth-inhibitory properties. Thus, genus Ajuga has significant medicinal and economic importance.

  7. Phytochemistry and pharmacognosy of the genus Acronychia.

    PubMed

    Epifano, Francesco; Fiorito, Serena; Genovese, Salvatore

    2013-11-01

    The genus Acronychia (Rutaceae) comprise 44 species, most of which are represented by shrubs and small trees, distributed in a wide geographical area of South-Eastern Asia comprising China, India, Malaysia, Indonesia, Australia, and the islands of the western Pacific Ocean. Most of the species of the genus Acronychia have been used for centuries as natural remedies in the ethnomedical traditions of indigenous populations as anti-microbial, anti-fungal, anti-spasmodic, stomachic, anti-pyretic, and anti-haemorragic agent. Moreover fruits and aerial parts are used as food in salads and condiments, while the essential oil obtained from flowers and leaves has been employed in cosmetics production. Phytochemicals isolated from Acronychia spp. include acetophenones, quinoline and acridone alkaloids, flavonoids, cinnamic acids, lignans, coumarins, steroids, and triterpenes. The reported biological activities of the above mentioned natural compounds refer to anti-plasmodial, anti-cancer, anti-oxidant, anti-inflammatory, anti-fungal, and neuroprotective effects. The aim of this review is to examine in detail from a phytochemical and pharmacologically point of view what is reported in the current literature about the properties of phytopreparations or individual active principles obtained from plants belonging to the Acronychia genus.

  8. Hirudotherapy in veterinary medicine.

    PubMed

    Sobczak, Natalia; Kantyka, Magdalena

    2014-01-01

    The saliva of medicinal leeches, e.g., Hirudo medicinalis and Hirudo verbana commonly used in hirudotherapy, contains more than 100 bioactive substances with various therapeutic effects, including anticoagulant, vasodilator, thrombolytic, anti-inflammatory and anaesthetic properties. Recently, leeches have been used very successfully in veterinary medicine to treat many diseases of animals, especially dogs, cats and horses. The most common indications for the use of leeches are hip and elbow dysplasia, acute and chronic arthritis, diseases associated with inflammation of tendons, ligaments, and fascia, diseases of the vertebrae and the treatment of scars. Leech therapy is a painless procedure which takes an average of 30 to 120 minutes, the time being dependent on the size of the animal. All leeches used in medical procedures should originate only from certified biofarms. The maintenance of sterile conditions for the culture, transport and storage of medical leeches is very important to protect animals from microbial infections. Hirudotherapy is successfully used in veterinary medicine, especially when traditional treatment is not effective, the effects of treatment are too slow, or after surgery, when the tissues may be threatened by venous congestion.

  9. Molecular phylogenetic study in genus Hydra.

    PubMed

    Kawaida, Hitomi; Shimizu, Hiroshi; Fujisawa, Toshitaka; Tachida, Hidenori; Kobayakawa, Yoshitaka

    2010-11-15

    Among 8000-9000 species of Cnidaria, only several dozens of species of Hydrozoa have been found in the fresh water. Hydra is such a fresh water polyp and has been used as a good material for research in developmental biology, regeneration and pattern formation. Although the genus Hydra has only a few ten species, its distribution is cosmopolitan. The phylogenetic relationship between hydra species is fascinating from the aspect of evolutionary biology and biogeography. However, only a few molecular phylogenetic studies have been reported on hydra. Therefore, we conducted a molecular phylogenetic study of the genus Hydra based on mitochondrial and nuclear nucleotide sequences using a hydra collection that has been kept in the National Institute of Genetics (NIG) of Japan. The results support the idea that four species groups comprise the genus Hydra. Within the viridissima group (green hydra) and braueri group, genetic distances between strains were relatively large. In contrast, genetic distances between strains among the vulgaris and oligactis groups were small irrespective of their geographic distribution. The vulgaris group strains were classified at least (as far as our investigated samples) into three sub-groups, vulgaris sub-group, carnea sub-group, and H. sp. (K5 and K6) sub-group. All of the vulgaris sub-group and H. sp. (K5 and K6) sub-group strains were collected in Eurasia. The carnea sub-group strains in NIG collection were all collected in North America. A few newly collected samples in Japan, however, suggested belonging to the carnea sub-group according to the molecular phylogenic analysis. This suggests a trans-Pacific distribution of the carnea sub-group hydra.

  10. Genus Paracoccidioides: Species Recognition and Biogeographic Aspects

    PubMed Central

    Theodoro, Raquel Cordeiro; Teixeira, Marcus de Melo; Felipe, Maria Sueli Soares; Paduan, Karina dos Santos; Ribolla, Paulo Martins; San-Blas, Gioconda; Bagagli, Eduardo

    2012-01-01

    Background Paracoccidioidomycosis is a systemic mycosis caused by Paracoccidioides brasiliensis (species S1, PS2, PS3), and Paracoccidioides lutzii. This work aimed to differentiate species within the genus Paracoccidioides, without applying multilocus sequencing, as well as to obtain knowledge of the possible speciation processes. Methodology/Principal Findings Single nucleotide polymorphism analysis on GP43, ARF and PRP8 intein genes successfully distinguished isolates into four different species. Morphological evaluation indicated that elongated conidia were observed exclusively in P. lutzii isolates, while all other species (S1, PS2 and PS3) were indistinguishable. To evaluate the biogeographic events that led to the current geographic distribution of Paracoccidioides species and their sister species, Nested Clade and Likelihood Analysis of Geographic Range Evolution (LAGRANGE) analyses were applied. The radiation of Paracoccidioides started in northwest South America, around 11–32 million years ago, as calculated on the basis of ARF substitution rate, in the BEAST program. Vicariance was responsible for the divergence among S1, PS2 and P. lutzii and a recent dispersal generated the PS3 species, restricted to Colombia. Taking into account the ancestral areas revealed by the LAGRANGE analysis and the major geographic distribution of L. loboi in the Amazon basin, a region strongly affected by the Andes uplift and marine incursions in the Cenozoic era, we also speculate about the effect of these geological events on the vicariance between Paracoccidioides and L. loboi. Conclusions/Significance The use of at least 3 SNPs, but not morphological criteria, as markers allows us to distinguish among the four cryptic species of the genus Paracoccidioides. The work also presents a biogeographic study speculating on how these species might have diverged in South America, thus contributing to elucidating evolutionary aspects of the genus Paracoccidioides. PMID:22666382

  11. The Genus Diphasiastrum and Its Lycopodium Alkaloids.

    PubMed

    Halldorsdottir, Elsa Steinunn; Kowal, Natalia Magdalena; Olafsdottir, Elin Soffia

    2015-08-01

    The genus Diphasiastrum includes at least 23 species distributed primarily across the northern temperate and subarctic areas of the world. These plants produce an array of lycopodium alkaloids, and some species such as Diphasiastrum complanatum have been used in traditional medicine for ages for various conditions. Hybridization is common in this group of plants and they have always been a challenge for taxonomists and other scientists studying them. To date, 11 Diphasiastrum species have been reported to produce lycopodium alkaloids. In this review, reported alkaloids and their distribution patterns across these species along with taxonomical and bioactivity considerations are reviewed and discussed.

  12. Non-gravitational effects on genus penicillium

    NASA Technical Reports Server (NTRS)

    Loup, Mackenzie

    1995-01-01

    In September 1994, Shuttle Orbiter Discovery, STS-64, launched into space. Aboard that shuttle was a payload containing Fungi spores, genus Penicillium. With the over looking help of Dr. Audrey Gabel, Associate Professor of Biology at Black Hills State University, investigations on differing media types began. Basis for this experimentation was to determine if there was any differences between the space exposed spores and control spores. Studies concluded that there were differences and those differences were then recorded. It was hypothesized the spores may have been effected causing differences in growth rate, colony size, depth and margins, coloring, germination, and growth on different media.

  13. A review: Ethnobotanical survey of genus Leucas

    PubMed Central

    Das, Surya Narayan; Patro, Varanasi Jaganath; Dinda, Subas Chandra

    2012-01-01

    Plants of genus Leucas (Lamiaceae) are widely distributed throughout Asia, Africa, and India. The plant is used in traditional medicine to cure many diseases such as cough, cold, diarrhea, and inflammatory skin disorder. A variety of phytoconstituents have been isolated from the Leucas species, which include lignans, flavonoids, coumarins, steroids, terpenes, fatty acids, and aliphatic long-chain compounds. Anti-inflammatory, analgesic, anti-diarrheal, antimicrobial, antioxidant, and insecticidal activities have been reported in the extracts of these plants and their phytoconstituents. An overview of the ethnobotanical, phytochemical, and pharmacological investigations on the Leucas species is presented in this review. PMID:23055635

  14. Non-gravitational effects on genus penicillium

    SciTech Connect

    Loup, M.

    1995-09-01

    In September 1994, Shuttle Orbiter Discovery, STS-64, launched into space. Aboard that shuttle was a payload containing Fungi spores, genus Penicillium. With the over looking help of Dr. Audrey Gabel, Associate Professor of Biology at Black Hills State University, investigations on differing media types began. Basis for this experimentation was to determine if there was any differences between the space exposed spores and control spores. Studies concluded that there were differences and those differences were then recorded. It was hypothesized the spores may have been effected causing differences in growth rate, colony size, depth and margins, coloring, germination, and growth on different media.

  15. The genus Platychara from the Western Hemisphere

    USGS Publications Warehouse

    Peck, R.E.; Forester, R.M.

    1979-01-01

    The systematics of four species belonging to the genus Platychara (Charophyta) from the Western Hemisphere is discussed. Three of the species, as defined herein, occur in Cretaceous and Paleocene rocks from Mexico through South America. The type species, P. compressa (Peck and Reker) Grambast, also of Cretaceous and Paleocene age, is herein restricted to deposits north of Mexico. These latter restrictions geographically separate P. compressa and P. perlata as presently defined but the relationship between these two species is still uncertain. A new species, P. grambastii, is proposed for specimens from Maestrichtian sediments in Jamaica. ?? 1979.

  16. A Brief Chronicle of the Genus Cordyceps Fr., the Oldest Valid Genus in Cordycipitaceae (Hypocreales, Ascomycota)

    PubMed Central

    Tanaka, Eiji; Han, Jae-Gu; Oh, Junsang; Han, Sang-Kuk; Lee, Kang-Hyo

    2014-01-01

    The earliest pre-Linnaean fungal genera are briefly discussed here with special emphasis on the nomenclatural connection with the genus Cordyceps Fr. Since its valid publication under the basidiomycetous genus Clavaria Vaill. ex L. (Clavaria militaris L. Sp. Pl. 2:1182, 1753), the genus Cordyceps has undergone nomenclatural changes in the post-Linnaean era, but has stood firmly for approximately 200 years. Synonyms of Cordyceps were collected from different literature sources and analyzed based on the species they represent. True synonyms of Cordyceps Fr. were defined as genera that represented species of Cordyceps Fr. emend. G. H. Sung, J. M. Sung, Hywel-Jones & Spatafora. The most common synonyms of Cordyceps observed were Clavaria and Sphaeria Hall, reported in the 18th and in the first half of the 19th century, respectively. Cordyceps, the oldest genus in the Cordyceps s. s. clade of Cordycipitaceae, is the most preferred name under the "One Fungus = One Name" principle on priority bases. PMID:25071376

  17. Genus-two characters of the Ising model

    NASA Astrophysics Data System (ADS)

    Choi, J. H.; Koh, I. G.

    1989-05-01

    As a first step in studying conformal theories on a higher-genus Riemann surface, we construct genus-two characters of the Ising model from their behavior in zero- and nonzero-homology pinching limits, the Goddard-Kent-Olive coset-space construction, and the branching coefficients in the level-two A(1)1 Kac-Moody characters on the higher-genus Riemann surface.

  18. Iron homeostasis in the Rhodobacter genus

    PubMed Central

    Zappa, Sébastien; Bauer, Carl E.

    2013-01-01

    Metals are utilized for a variety of critical cellular functions and are essential for survival. However cells are faced with the conundrum of needing metals coupled with e fact that some metals, iron in particular are toxic if present in excess. Maintaining metal homeostasis is therefore of critical importance to cells. In this review we have systematically analyzed sequenced genomes of three members of the Rhodobacter genus, R. capsulatus SB1003, R. sphaeroides 2.4.1 and R. ferroxidans SW2 to determine how these species undertake iron homeostasis. We focused our analysis on elemental ferrous and ferric iron uptake genes as well as genes involved in the utilization of iron from heme. We also discuss how Rhodobacter species manage iron toxicity through export and sequestration of iron. Finally we discuss the various putative strategies set up by these Rhodobacter species to regulate iron homeostasis and the potential novel means of regulation. Overall, this genomic analysis highlights surprisingly diverse features involved in iron homeostasis in the Rhodobacter genus. PMID:24382933

  19. Polyphasic taxonomy of the genus Talaromyces

    PubMed Central

    Yilmaz, N.; Visagie, C.M.; Houbraken, J.; Frisvad, J.C.; Samson, R.A.

    2014-01-01

    The genus Talaromyces was described by Benjamin in 1955 as a sexual state of Penicillium that produces soft walled ascomata covered with interwoven hyphae. Phylogenetic information revealed that Penicillium subgenus Biverticillium and Talaromyces form a monophyletic clade distinct from the other Penicillium subgenera. Subsequently, in combination with the recent adoption of the one fungus one name concept, Penicillium subgenus Biverticillium was transferred to Talaromyces. At the time, the new combinations were made based only on phylogenetic information. As such, the aim of this study was to provide a monograph on Talaromyces applying a polyphasic species concept, including morphological, molecular and physiological characters. Based on an ITS, BenA and RPB2 multigene phylogeny, we propose a new sectional classification for the genus, placing the 88 accepted species into seven sections, named sections Bacillispori, Helici, Islandici, Purpurei, Subinflati, Talaromyces and Trachyspermi. We provide morphological descriptions for each of these species, as well as notes on their identification using morphology and DNA sequences. For molecular identification, BenA is proposed as a secondary molecular marker to the accepted ITS barcode for fungi. PMID:25492983

  20. Genus Tinospora: Ethnopharmacology, Phytochemistry, and Pharmacology

    PubMed Central

    She, Gaimei; Han, Dan; Wang, Weihua; Liu, Zhao

    2016-01-01

    The genus Tinospora includes 34 species, in which several herbs were used as traditional medicines by indigenous groups throughout the tropical and subtropical parts of Asia, Africa, and Australia. The extensive literature survey revealed Tinospora species to be a group of important medicinal plants used for the ethnomedical treatment of colds, headaches, pharyngitis, fever, diarrhea, oral ulcer, diabetes, digestive disorder, and rheumatoid arthritis. Indian ethnopharmacological data points to the therapeutic potential of the T. cordifolia for the treatment of diabetic conditions. While Tinospora species are confusing in individual ingredients and their mechanisms of action, the ethnopharmacological history of those plants indicated that they exhibit antidiabetic, antioxidation, antitumor, anti-inflammation, antimicrobial, antiosteoporosis, and immunostimulation activities. While the clinical applications in modern medicine are lacking convincing evidence and support, this review is aimed at summarizing the current knowledge of the traditional uses, phytochemistry, biological activities, and toxicities of the genus Tinospora to reveal its therapeutic potentials and gaps, offering opportunities for future researches. PMID:27648105

  1. [Taxonomy and ecology of the genus Candida].

    PubMed

    Schauer, F; Hanschke, R

    1999-01-01

    Candida is a heterogeneous genus which contains about a quarter of all yeast species. It includes not only species of uncertain affiliation but also unrelated strains whose phylogenetic relationships have not been resolved. A great variety of CoQ types are present in the genus, the mol % G + C ranges from 30-63%, and species that were found to sporulate have teleomorphic counterparts in 11 different genera. Candida species are mainly associated with plants, rotting vegetation, with insects which feed on plants or with food. In line with this, 71% of Candida species utilize xylose (wood degradation), 57% of species use cellobiose (cellulose degradation), 29% oxidize aliphatic hydrocarbons (components of plant cuticula), 27% of species degrade starch as a plant storage material, and 7% utilize methanol as a possible metabolite from pectin catabolism. 85% of species require individual vitamins produced mainly in plant materials. 65% of Candida species are not able to grow at temperatures of 37 degrees C. In comparison only relatively few species occur normally in humans and other warm blooded animals. About 16% of type strains and selected strains for comparative purposes (CBS) were isolated from human specimens. Perhaps up to 10% of Candida species may be of medical importance, though this has so far only been clearly demonstrated for less than 5% of currently known species.

  2. Revised concept of the fossil genus Oviparosiphum Shaposhnikov, 1979 with the description of a new genus (Hemiptera, Sternorrhyncha, Aphidomorpha).

    PubMed

    Żyła, Dagmara; Homan, Agnieszka; Franielczyk, Barbara; Wegierek, Piotr

    2015-01-01

    This paper presents a revision of the aphid genus Oviparosiphum, which is known from the Cretaceous period. Redescriptions of two species: Oviparosiphumjakovlevi Shaposhnikov, 1979 and Oviparosiphumbaissense Shaposhnikov & Wegierek, 1989 are made, and an updated diagnosis of this genus is provided. Oviparosiphumbaissense is the type species of a newly described genus Archeoviparosiphum gen. n. Five other species of Oviparosiphum are also transferred to the new genus. The basis for their separation from Oviparosiphum is the structure of the siphunculi and ovipositor. A key is provided to the genera of Oviparosiphidae.

  3. Molecular phylogenetics of the hummingbird genus Coeligena.

    PubMed

    Parra, Juan Luis; Remsen, J V; Alvarez-Rebolledo, Mauricio; McGuire, Jimmy A

    2009-11-01

    Advances in the understanding of biological radiations along tropical mountains depend on the knowledge of phylogenetic relationships among species. Here we present a species-level molecular phylogeny based on a multilocus dataset for the Andean hummingbird genus Coeligena. We compare this phylogeny to previous hypotheses of evolutionary relationships and use it as a framework to understand patterns in the evolution of sexual dichromatism and in the biogeography of speciation within the Andes. Previous phylogenetic hypotheses based mostly on similarities in coloration conflicted with our molecular phylogeny, emphasizing the unreliability of color characters for phylogenetic inference. Two major clades, one monochromatic and the other dichromatic, were found in Coeligena. Closely related species were either allopatric or parapatric on opposite mountain slopes. No sister lineages replaced each other along an elevational gradient. Our results indicate the importance of geographic isolation for speciation in this group and the potential interaction between isolation and sexual selection to promote diversification.

  4. [CITRULLINUREIDASE GENE DIVERSITY IN THE GENUS FRANCISELLA].

    PubMed

    Timofeev, V S; Bakhteeva, I V; Pavlov, V M; Mokrievich, A N

    2015-01-01

    This work describes the results, of the in silico analysis of the genetic diversity of the citrullinureidase gene (ctu) in two species of bacteria of the genus Francisella: tularensis (ssp. tularensis, holarctica, mediasiatica, novicida) and philomiragia. The strains of the Central Asiatic subspecies possessing the citrullinureidase activity differ in the gene ctu from the ssp tularensis Schu by three nucleotide substitutions leading to two insignificant amino acid substitutions in the encoded polypeptide. In the strain F. tularensis of the ssp. holarctica the gene ctu encodes inactive enzyme, which is probably due to amino acid substitutions: 151 Gly --> Asp, 183 Pro --> Leu, 222 Asp --> Asn. Except for the Japan biovar bacteria, in all strains of the Holarctic subspecies there are two stop codons in the gene ctu. The bacteria of the subspecies novicida contain the ctu gene only in the strain 3523, whereas the other strains contain the gene FTN_0827 encoding the C-N hydrolase, which probably provides the citrullinureidase activity.

  5. Proteolytic Activity in the Genus Ficus 1

    PubMed Central

    Williams, Donald C.; Sgarbieri, Valdemiro C.; Whitaker, John R.

    1968-01-01

    The latices of only 13 of a total of 46 species of Ficus examined contained appreciable proteolytic activity. Therefore, high proteolytic activity in the latex is not a distinguishing feature of the genus. The latex of F. stenocarpa had the highest specific activity followed closely by the latices of F. carica and F. glabrata. Latices of 6 species of Ficus were examined by chromatography on CM-cellulose and compared with the results obtained for 9 varieties of F. carica. All of the latices were found to contain multiple proteolytic enzymes. Chromatographically, the multiple enzyme components of the several varieties of F. carica were more similar than those of the several species examined. The latices of 16 varieties of F. carica were all different as determined by free boundary electrophoresis although the specific proteolytic activity of the latices was reasonably constant. PMID:16656886

  6. Environmental Origin of the Genus Bordetella

    PubMed Central

    Hamidou Soumana, Illiassou; Linz, Bodo; Harvill, Eric T.

    2017-01-01

    Members of the genus Bordetella include human and animal pathogens that cause a variety of respiratory infections, including whooping cough in humans. Despite the long known ability to switch between a within-animal and an extra-host lifestyle under laboratory growth conditions, no extra-host niches of pathogenic Bordetella species have been defined. To better understand the distribution of Bordetella species in the environment, we probed the NCBI nucleotide database with the 16S ribosomal RNA (16S rRNA) gene sequences from pathogenic Bordetella species. Bacteria of the genus Bordetella were frequently found in soil, water, sediment, and plants. Phylogenetic analyses of their 16S rRNA gene sequences showed that Bordetella recovered from environmental samples are evolutionarily ancestral to animal-associated species. Sequences from environmental samples had a significantly higher genetic diversity, were located closer to the root of the phylogenetic tree and were present in all 10 identified sequence clades, while only four sequence clades possessed animal-associated species. The pathogenic bordetellae appear to have evolved from ancestors in soil and/or water. We show that, despite being animal-adapted pathogens, Bordetella bronchiseptica, and Bordetella hinzii have preserved the ability to grow and proliferate in soil. Our data implicate soil as a probable environmental origin of Bordetella species, including the animal-pathogenic lineages. Soil may further constitute an environmental niche, allowing for persistence and dissemination of the bacterial pathogens. Spread of pathogenic bordetellae from an environmental reservoir such as soil may potentially explain their wide distribution as well as frequent disease outbreaks that start without an obvious infectious source. PMID:28174558

  7. Small RNAs in the genus Clostridium.

    PubMed

    Chen, Yili; Indurthi, Dinesh C; Jones, Shawn W; Papoutsakis, Eleftherios T

    2011-01-25

    The genus Clostridium includes major human pathogens and species important to cellulose degradation, the carbon cycle, and biotechnology. Small RNAs (sRNAs) are emerging as crucial regulatory molecules in all organisms, but they have not been investigated in clostridia. Research on sRNAs in clostridia is hindered by the absence of a systematic method to identify sRNA candidates, thus delegating clostridial sRNA research to a hit-and-miss process. Thus, we wanted to develop a method to identify potential sRNAs in the Clostridium genus to open up the field of sRNA research in clostridia. Using comparative genomics analyses combined with predictions of rho-independent terminators and promoters, we predicted sRNAs in 21 clostridial genomes: Clostridium acetobutylicum, C. beijerinckii, C. botulinum (eight strains), C. cellulolyticum, C. difficile, C. kluyveri (two strains), C. novyi, C. perfringens (three strains), C. phytofermentans, C. tetani, and C. thermocellum. Although more than one-third of predicted sRNAs have Shine-Dalgarno (SD) sequences, only one-sixth have a start codon downstream of SD sequences; thus, most of the predicted sRNAs are noncoding RNAs. Quantitative reverse transcription-PCR (Q-RT-PCR) and Northern analysis were employed to test the presence of a randomly chosen set of sRNAs in C. acetobutylicum and several C. botulinum strains, leading to the confirmation of a large fraction of the tested sRNAs. We identified a conserved, novel sRNA which, together with the downstream gene coding for an ATP-binding cassette (ABC) transporter gene, responds to the antibiotic clindamycin. The number of predicted sRNAs correlated with the physiological function of the species (high for pathogens, low for cellulolytic, and intermediate for solventogenic), but not with 16S rRNA-based phylogeny.

  8. A new genus and species of Nematalycidae (Acari: Endeostigmata)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Osperalycus tenerphagus, a new genus and species of Nematalycidae (Acari: Endeostigmata), is described from Ohio, USA, using light microscopy and low temperature scanning electron microscopy. Specimens were extracted from two different loam soils. This genus can be readily distinguished from the oth...

  9. The genus Eleodes Eschscholtz (Coleoptera: tenebrionidae) in Texas

    Technology Transfer Automated Retrieval System (TEKTRAN)

    False wireworms are larvae of the darkling beetle genus Eleodes Eschscholtz, some of which are agricultural pests of dryland wheat. Because of the large numbers of species in the genus (approximately 235), identifications can be problematic. Hence, regional keys are of great utility. Within the s...

  10. Genus IV. Actinosynnema Hasegawa, Lechevalier and Lechevalier 1978, 304al

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The physiology, systematics and ecology of the species that currently composes the actinobacterial genus Actinosynnema is presented. The phylogenetic position of the species within this genus relative to the other genera within the family Actinosynnemataceae is discussed. Methods for isolation, pr...

  11. Genus XIII. Umezawaea Labeda and Kroppenstedt 2007, 2761vp

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The physiology, systematics and ecology of the species that currently compose the actinobacterial genus Umezawaea is presented. The phylogenetic position of the lone species within this genus, Umezawaea tangerina relative to the species in other genera within the family Actinosynnemataceae is discu...

  12. Revision of the genus Raoiella (Acari: Tenuipalpidae) of the world.

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Flat mites in the genus Raoiella have attracted recent world-wide interest due to the rapid spread of a major pest of various palm trees and other monocot species, the red palm mite, R. indica. This focus on the species R. indica has created a need to better understand the genus. Despite the econo...

  13. Development of DNA barcodes of genus Lygus Hahn (Hemiptera: Miridae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Lygus (Hemiptera: Miridae) is an important group of insects that contains 43 known species worldwide. Some species within this genus are important agricultural pests in North America. Annual economic impacts in cotton, Gossypium hirsutum L., from Lygus spp. due to yield losses and control ...

  14. The genus Gnaphalium L. (Compositae): phytochemical and pharmacological characteristics.

    PubMed

    Zheng, Xing; Wang, Wei; Piao, Huishan; Xu, Weiqiang; Shi, Haibo; Zhao, Chengai

    2013-07-15

    The genus Gnaphalium, a herb distributed worldwide, comprises approximately 200 species of the Compositae (Asteraceae) family that belongs to the tribe Gnaphalieae. Some species are traditionally used as wild vegetables and in folk medicine. This review focuses on the phytochemical investigations and biological studies of plants from the genus Gnaphalium over the past few decades. More than 125 chemical constituents have been isolated from the genus Gnaphalium, including flavonoids, sesquiterpenes, diterpenes, triterpenes, phytosterols, anthraquinones, caffeoylquinic acid derivatives, and other compounds. The extracts of this genus, as well as compounds isolated from it, have been demonstrated to possess multiple pharmacological activities such as antioxidant, antibacterial and antifungal, anti-complement, antitussive and expectorant, insect antifeedant, cytotoxic, anti-inflammatory, antidiabetic and antihypouricemic properties. The present review compiles the information available on this genus because of its relevance to food and ethnopharmacology and the potential therapeutic uses of these species.

  15. The Foraminiferal Genus Orbitolina in North America

    USGS Publications Warehouse

    Douglass, Raymond Charles

    1960-01-01

    The foraminiferal genus Orbitolina has been useful as an index fossil in the Cretaceous rocks of the circumglobal equatorial belt for nearly a century. In Europe and the Near and Middle East enough work has been done on the species to allow their use for approximate correlations within the Cretaceous sedimentary rocks. The study of American specimens of Orbitolina, had been almost neglected although they were used in a rather cursory fashion for markers of the Lower Cretaceous Trinity strata. Three species had been described and assigned to Orbitolina in the United States, but the validity of each of the species had been questioned. A study of the genus Orbitolina, its type species, its morphology and the stratigraphic and geographic distribution in North America are presented in this report. Stratigraphic sections were measured throughout the area of Lower Cretaceous outcrop in Texas, New Mexico. and Arizona, and samples of Orbitolina were taken from these measured sections. Several thousand thin sections were prepared from which 8 species of Orbitolina, 7 of them new, were recognized. Orbitolina texana (Roemer) was found to be confined to the lower part of the Glen Rose limestone and its equivalents. Orbitolina, minuta n. sp. is essentially confined to the upper part of the Glen Rose limestone and its equivalents. Four of the species are known only from the Arizona and New Mexico region. The species of Orbitolina are useful stratigraphically, but all their characters-internal as well as external-must be considered. The use of thin sections for the study of Orbitolina is essential. One of the first things that had to be determined was the correct concept of the genus Orbitolina. The type species had not been determined by earlier authors, although four species had been suggested at various times. With careful study of the early literature, it became apparent that the type species is Orbitulites lenticulata Lamarck, 1816=Madreporites lenticularis Blumenbach, 1805

  16. Analysis of synonymous codon usage patterns in the genus Rhizobium.

    PubMed

    Wang, Xinxin; Wu, Liang; Zhou, Ping; Zhu, Shengfeng; An, Wei; Chen, Yu; Zhao, Lin

    2013-11-01

    The codon usage patterns of rhizobia have received increasing attention. However, little information is available regarding the conserved features of the codon usage patterns in a typical rhizobial genus. The codon usage patterns of six completely sequenced strains belonging to the genus Rhizobium were analysed as model rhizobia in the present study. The relative neutrality plot showed that selection pressure played a role in codon usage in the genus Rhizobium. Spearman's rank correlation analysis combined with correspondence analysis (COA) showed that the codon adaptation index and the effective number of codons (ENC) had strong correlation with the first axis of the COA, which indicated the important role of gene expression level and the ENC in the codon usage patterns in this genus. The relative synonymous codon usage of Cys codons had the strongest correlation with the second axis of the COA. Accordingly, the usage of Cys codons was another important factor that shaped the codon usage patterns in Rhizobium genomes and was a conserved feature of the genus. Moreover, the comparison of codon usage between highly and lowly expressed genes showed that 20 unique preferred codons were shared among Rhizobium genomes, revealing another conserved feature of the genus. This is the first report of the codon usage patterns in the genus Rhizobium.

  17. Genomes-based phylogeny of the genus Xanthomonas

    PubMed Central

    2012-01-01

    Background The genus Xanthomonas comprises several plant pathogenic bacteria affecting a wide range of hosts. Despite the economic, industrial and biological importance of Xanthomonas, the classification and phylogenetic relationships within the genus are still under active debate. Some of the relationships between pathovars and species have not been thoroughly clarified, with old pathovars becoming new species. A change in the genus name has been recently suggested for Xanthomonas albilineans, an early branching species currently located in this genus, but a thorough phylogenomic reconstruction would aid in solving these and other discrepancies in this genus. Results Here we report the results of the genome-wide analysis of DNA sequences from 989 orthologous groups from 17 Xanthomonas spp. genomes available to date, representing all major lineages within the genus. The phylogenetic and computational analyses used in this study have been automated in a Perl package designated Unus, which provides a framework for phylogenomic analyses which can be applied to other datasets at the genomic level. Unus can also be easily incorporated into other phylogenomic pipelines. Conclusions Our phylogeny agrees with previous phylogenetic topologies on the genus, but revealed that the genomes of Xanthomonas citri and Xanthomonas fuscans belong to the same species, and that of Xanthomonas albilineans is basal to the joint clade of Xanthomonas and Xylella fastidiosa. Genome reduction was identified in the species Xanthomonas vasicola in addition to the previously identified reduction in Xanthomonas albilineans. Lateral gene transfer was also observed in two gene clusters. PMID:22443110

  18. The Genus Aeromonas: Taxonomy, Pathogenicity, and Infection

    PubMed Central

    Janda, J. Michael; Abbott, Sharon L.

    2010-01-01

    Summary: Over the past decade, the genus Aeromonas has undergone a number of significant changes of practical importance to clinical microbiologists and scientists alike. In parallel with the molecular revolution in microbiology, several new species have been identified on a phylogenetic basis, and the genome of the type species, A. hydrophila ATCC 7966, has been sequenced. In addition to established disease associations, Aeromonas has been shown to be a significant cause of infections associated with natural disasters (hurricanes, tsunamis, and earthquakes) and has been linked to emerging or new illnesses, including near-drowning events, prostatitis, and hemolytic-uremic syndrome. Despite these achievements, issues still remain regarding the role that Aeromonas plays in bacterial gastroenteritis, the extent to which species identification should be attempted in the clinical laboratory, and laboratory reporting of test results from contaminated body sites containing aeromonads. This article provides an extensive review of these topics, in addition to others, such as taxonomic issues, microbial pathogenicity, and antimicrobial resistance markers. PMID:20065325

  19. Color evolution in the hummingbird genus coeligena.

    PubMed

    Parra, Juan Luis

    2010-02-01

    The remarkable diversity of coloration and species present in hummingbirds has been considered the result of sexual selection. I evaluate if color differences among species in the genus Coeligena are consistent with expectations from sexual selection theory. If sexual selection on color is important for speciation, closely related species should be markedly different in the colors of feather patches associated with aggression and breeding. I evaluate this prediction through a statistical assessment of the phylogenetic signal of colors from five feather patches: crown, gorget, belly, upper back, and rump. The first two are associated with aggressive and courtship displays and are expected to be under sexual selection, whereas the others are not. Contrary to expectations, the crown and gorget were the only patches with significant phylogenetic signal. Furthermore, I assess if populations of dichromatic species are more divergent in coloration and therefore have reduced gene flow. Color distances among dichromatic subspecies were larger than among monochromatic subspecies, but the magnitude of phenotypic differentiation was not related to levels of gene flow. These results support a role for sexual selection in shaping color variation among populations, but these differences alone are not sufficient to explain speciation.

  20. Tropical forests and the genus Homo.

    PubMed

    Roberts, Patrick; Boivin, Nicole; Lee-Thorp, Julia; Petraglia, Michael; Stock, Jay

    2016-11-01

    Tropical forests constitute some of the most diverse and complex terrestrial ecosystems on the planet. From the Miocene onward, they have acted as a backdrop to the ongoing evolution of our closest living relatives, the great apes, and provided the cradle for the emergence of early hominins, who retained arboreal physiological adaptations at least into the Late Pliocene. There also now exists growing evidence, from the Late Pleistocene onward, for tool-assisted intensification of tropical forest occupation and resource extraction by our own species, Homo sapiens. However, between the Late Pliocene and Late Pleistocene there is an apparent gap in clear and convincing evidence for the use of tropical forests by hominins, including early members of our own genus. In discussions of Late Pliocene and Early Pleistocene hominin evolution, including the emergence and later expansion of Homo species across the globe, tropical forest adaptations tend to be eclipsed by open, savanna environments. Thus far, it is not clear whether this Early-Middle Pleistocene lacuna in Homo-rainforest interaction is real and representative of an adaptive shift with the emergence of our species or if it is simply reflective of preservation bias.

  1. Functional proteomics within the genus Lactobacillus.

    PubMed

    De Angelis, Maria; Calasso, Maria; Cavallo, Noemi; Di Cagno, Raffaella; Gobbetti, Marco

    2016-03-01

    Lactobacillus are mainly used for the manufacture of fermented dairy, sourdough, meat, and vegetable foods or used as probiotics. Under optimal processing conditions, Lactobacillus strains contribute to food functionality through their enzyme portfolio and the release of metabolites. An extensive genomic diversity analysis was conducted to elucidate the core features of the genus Lactobacillus, and to provide a better comprehension of niche adaptation of the strains. However, proteomics is an indispensable "omics" science to elucidate the proteome diversity, and the mechanisms of regulation and adaptation of Lactobacillus strains. This review focuses on the novel and comprehensive knowledge of functional proteomics and metaproteomics of Lactobacillus species. A large list of proteomic case studies of different Lactobacillus species is provided to illustrate the adaptability of the main metabolic pathways (e.g., carbohydrate transport and metabolism, pyruvate metabolism, proteolytic system, amino acid metabolism, and protein synthesis) to various life conditions. These investigations have highlighted that lactobacilli modulate the level of a complex panel of proteins to growth/survive in different ecological niches. In addition to the general regulation and stress response, specific metabolic pathways can be switched on and off, modifying the behavior of the strains.

  2. American Tertiary mollusks of the genus Clementia

    USGS Publications Warehouse

    Woodring, W.P.

    1927-01-01

    Aside from its value as an aid in determining the age of Tertiary beds, the chief interest of the genus Clementia lies in the anomalous features of its present and former distribution. An attempt is made in this paper to trace its geologic history, to point out its paleobiologic significance, and to describe all the known American Tertiary species. The fossils from Colombia used in preparing this report were collected during explorations made under the direction of Dr. 0. B. Hopkins, chief geologist of the Imperial Oil Co. (Ltd.), who kindly donated them to the United States National Museum. Dr. T. Wayland Vaughan, of the Scripps Institution of Oceanography, furnished information relating to specimens collected by him in Mexico. Dr. Bruce L. Clark, of the University of California; Dr. G. Dallas Hanna, of the California Academy of Sciences; Dr. H. A. Pilsbry, of the Philadelphia Academy of Natural Sciences; and Dr. W. D. Matthew, of the American Museum of Natural History, generously loaned type specimens and other material. Doctor Clark and Doctor Hanna also gave information concerning the Tertiary species from California. Mr. Ralph B. Stewart, of the University of California, read the manuscript, and I have taken advantage of his suggestions. I am also indebted to Mr. L. R. Cox, of the British Museum, for information relating to the fossil species from Persia, Zanzibar, and Burma, and to Dr. Axel A. Olsson, of the International Petroleum Co., for data concerning undescribed Tertiary species from Peru.

  3. The genus Allium--Part 1.

    PubMed

    Fenwick, G R; Hanley, A B

    1985-01-01

    Alliums have been grown for many centuries for their characteristic, pungent flavor and medicinal properties. The present review, which includes references published up to the middle of 1984, is primarily concerned with the chemical composition, flavor, and physiological properties of these crops, their extracts, and processed products. Special emphasis is placed upon the relationship between the organoleptically and biologically active components of onion and garlic. Following a brief historical introduction, current production of commercially important alliums is described and their botanical origins and interrelationships are explained. Following consideration of the major economic diseases and pests of alliums, the agronomic, husbandry, and practices associated with their cultivation are described, particular emphasis being placed upon the storage and processing of onion and garlic. The detailed, overall chemical composition and nutritional value of members of the genus Allium are presented in Section 7; after an outline of the origin and nature of flavor components and precursors, the flavor volatiles of individual members are presented. The effects of agronomic, environmental, and processing practices on chemical and flavor content and quality are considered in Section 9. The following section deals critically with the human and animal studies which have been conducted into the medical and therapeutic properties of alliums, emphasis being placed upon the studies into the antiatherosclerotic effect of onion and garlic and their essential oils. After a study of antimicrobial properties of alliums and their effects on insects and animals, an overview is presented which highlights unexplored or inadequately studied areas and suggests rewarding areas for future research.

  4. METABOLIC CHARACTERIZATION OF THE GENUS BRUCELLA I.

    PubMed Central

    Meyer, Margaret E.; Cameron, H. S.

    1961-01-01

    Meyer, Margaret E. (University of California, Davis), and H. S. Cameron. Metabolic characterization of the genus Brucella. I. Statistical evaluation of the oxidative rates by which type I of each species can be identified. J. Bacteriol. 82:387–395. 1961.—The oxidative uptake rates on 11 amino acid and seven carbohydrate substrates were determined for 75 strains of brucellae that had been identified by the conventional determinative methods as Brucella melitensis type I, Brucella abortus type I, or Brucella suis type I. By calculating the standard deviation of the oxidative rates, it was demonstrated that a metabolic pattern that is characteristic and definitive for each of the species was formed by their differential oxidative utilization of substrate groups, and that qualitative as well as quantitative metabolic differences exist among the Brucella species. B. melitensis oxidized l-alanine, l-asparagine, and l-glutamic acid, but not l-arginine, dl-citrulline, l-lysine, dl-ornithine, l-arabinose, d-galactose, d-ribose, or d-xylose. B. abortus differed qualitatively from B. melitensis in that it oxidized the carbohydrate substrates. B. suis differed quantitatively from both of these species in its consistently low oxidative rates of l-alanine, l-asparagine, and l-glutamic acid, and its high rates of utilization of the carbohydrate substrates. It differed qualitatively in that it oxidized the four amino acid substrates that are components of the urea cycle. PMID:13770011

  5. The genus Plectranthus in India and its chemistry.

    PubMed

    Waldia, Shobha; Joshi, Bipin C; Pathak, Uma; Joshi, Mukesh C

    2011-02-01

    Phytochemical constituents isolated from Indian species of the genus Plectranthus reported up to 2009 are compiled. In India, the genus Plectranthus is found in all the habitats and altitudes, particularly in the Himalaya, the Southern Ghats, and the Nilgiri region. P. amboinicus, P. barbatus, P. caninus, P. mollis, P. coetsa, and P. incanus are the most common species found in India. Phytochemical studies of the genus revealed that Indian Plectranthus species are rich in essential oil, and that the most abundant secondary metabolites are diterpenoids, i.e., labdanes, abietanes, and ent-kauranes, as well as triterpenoids.

  6. Isleria, a new genus of antwren (Aves: Passeriformes: Thamnophilidae)

    USGS Publications Warehouse

    Bravo, Gustavo A.; Chesser, R. Terry; Brumfield, Robb T.

    2012-01-01

    A comprehensive molecular phylogenetic analysis of the family Thamnophilidae indicated that the genus Myrmotherula is not monophyletic. The clade composed of M. guttata and M. hauxwelli is only distantly related to other members of the genus and should be removed from Myrmotherula. The phenotypic distinctiveness of the clade argues against merging it with its sister group Thamnomanes and no generic name is available for the guttata-hauxwelli clade. Consequently, we describe the genus Isleria for these two species, and designate Myrmothera guttata as its type species.

  7. Identity of Baker's species described in the Oriental leafhopper genus Pythamus (Hemiptera: Cicadellidae) with description of a new genus.

    PubMed

    Wei, Cong; Webb, Michael D; Zhang, Yalin

    2014-05-13

    Baker's (1915) species described in the Oriental leafhopper genus Pythamus Melichar are revised. One species, Pythamus melichari Baker 1915, is placed in a new genus, Pythochandra Wei & Webb, gen. n.. The four varieties of P. melichari described by Baker (1915, 1923) (borneensis, bilobatus, decoratus and singaporensis) are elevated to species level and placed in the new genus stat. n., comb. n.. All species are briefly described and a key is provided for their separation. Two other species, Pythamus productus Baker and P. decoratus Baker, known only from females, are retained in Pythamus pending further studies.

  8. A review on phytochemistry and ethnopharmacological aspects of genus Calendula.

    PubMed

    Arora, Disha; Rani, Anita; Sharma, Anupam

    2013-07-01

    This review includes 84 references on the genus Calendula (Asteraceae) and comprises ethnopharmacology, morphology and microscopy, phytoconstituents, pharmacological reports, clinical studies and toxicology of the prominent species of Calendula. Triterpene alcohols, triterpene saponins, flavonoids, carotenoids and polysaccharides constitute major classes of phytoconstituents of the genus. A few species of this genus have medicinal value, among these Calendula officinalis Linn., has been traditionally used in the treatment of various skin tumors, dermatological lesions, ulcers, swellings and nervous disorders as well as almost 200 cosmetic formulations, i.e., creams, lotions, shampoos. Despite a long tradition of use of some species, the genus has not been explored properly. In the concluding part, the future scope of Calendula species has been emphasized with a view to establish their multifarious biological activities and mode of action.

  9. A new Neotropical genus of Blastini (Psocodea: 'Psocoptera': Psocidae: Amphigerontiinae).

    PubMed

    Aldrete, Alfonso N García; Román-P, Cristian

    2015-08-17

    A monotypic genus of Psocidae (Amphigerontiinae: Blastini) from Santiago de Cali, Colombia, is here described and illustrated. It differs from Chaetopsocidus Badonnel, from the Páramo de Monserrate, near Bogotá, in having setae on the forewing veins.

  10. Complete Genome Sequences of Six Strains of the Genus Methylobacterium

    SciTech Connect

    Marx, Christopher J; Bringel, Francoise O.; Christoserdova, Ludmila; Moulin, Lionel; UI Hague, Muhammad Farhan; Fleischman, Darrell E.; Gruffaz, Christelle; Jourand, Philippe; Knief, Claudia; Lee, Ming-Chun; Muller, Emilie E. L.; Nadalig, Thierry; Peyraud, Remi; Roselli, Sandro; Russ, Lina; Goodwin, Lynne A.; Ivanov, Pavel S.; Ivanova, N; Kyrpides, Nikos C; Lajus, Aurelie; Medigue, Claudine; Nolan, Matt; Woyke, Tanja; Stolyar, Sergey; Vorholt, Julia A.; Vuilleumier, Stephane

    2012-01-01

    The complete and assembled genome sequences were determined for six strains of the alphaproteobacterial genus Methylobacterium, chosen for their key adaptations to different plant-associated niches and environmental constraints.

  11. Complete genome sequences of six strains of the genus methylobacterium

    SciTech Connect

    Marx, Christopher J; Bringel, Francoise O.; Christoserdova, Ludmila; Moulin, Lionel; Farhan Ul Haque, Muhammad; Fleischman, Darrell E.; Gruffaz, Christelle; Jourand, Philippe; Knief, Claudia; Lee, Ming-Chun; Muller, Emilie E. L.; Nadalig, Thierry; Peyraud, Remi; Roselli, Sandro; Russ, Lina; Aguero, Fernan; Goodwin, Lynne A.; Ivanova, N; Kyrpides, Nikos C; Lajus, Aurelie; Medigue, Claudine; Nolan, Matt; Woyke, Tanja; Stolyar, Sergey; Vorholt, Julia A.; Vuilleumier, Stephane

    2012-01-01

    The complete and assembled genome sequences were determined for six strains of the alphaproteobacterial genus Methylobacterium, chosen for their key adaptations to different plant-associated niches and environmental constraints.

  12. The Genus Letrouitia (Letrouitiaceae: Lichenized Ascomycota) New to Cambodia

    PubMed Central

    Shi, Haixia; Qian, Zigang; Wang, Xinyu; Liu, Dong; Zhang, Yanyun; Ye, Xin; Harada, Hiroshi

    2015-01-01

    The genus Letrouitia is newly recorded for Cambodia, including the four species as L. domingensis, L. leprolytoides, L. sayeri, and L. subvulpina. A brief description and illustrations are provided. PMID:26190924

  13. A review on phytochemistry and ethnopharmacological aspects of genus Calendula

    PubMed Central

    Arora, Disha; Rani, Anita; Sharma, Anupam

    2013-01-01

    This review includes 84 references on the genus Calendula (Asteraceae) and comprises ethnopharmacology, morphology and microscopy, phytoconstituents, pharmacological reports, clinical studies and toxicology of the prominent species of Calendula. Triterpene alcohols, triterpene saponins, flavonoids, carotenoids and polysaccharides constitute major classes of phytoconstituents of the genus. A few species of this genus have medicinal value, among these Calendula officinalis Linn., has been traditionally used in the treatment of various skin tumors, dermatological lesions, ulcers, swellings and nervous disorders as well as almost 200 cosmetic formulations, i.e., creams, lotions, shampoos. Despite a long tradition of use of some species, the genus has not been explored properly. In the concluding part, the future scope of Calendula species has been emphasized with a view to establish their multifarious biological activities and mode of action. PMID:24347926

  14. METABOLIC CHARACTERIZATION OF THE GENUS BRUCELLA III.

    PubMed Central

    Meyer, Margaret E.

    1961-01-01

    Meyer, Margaret E. (University of California, Davis). Metabolic characterization of the genus Brucella. III. Oxidative metabolism of strains that show anomalous characteristics by conventional determinative methods. J. Bacteriol. 82:401–410. 1961.—The oxidative metabolic patterns were determined on 83 strains of brucellae that had been described as “atypical” because they differed in one or more characteristics or because they had been isolated from an abnormal host (other than the natural reservoir for that species). Of the 83 strains examined, 44 displayed the metabolic pattern for Brucella melitensis. A comparison was then made between the results of identifying these strains metabolically and by the conventional methods. It was found that a few strains of B. melitensis showed a decreased tolerance to basic fuchsin and thionin, but none of the strains that was identified metabolically as B. melitensis produced H2S or required CO2. No biotypes have been reported for this species, since only slight quantitative variation in dye tolerances occurs among strains of B. melitensis, and no metabolic variants were found. It is concluded that B. melitensis is a homogenous species and can be identified with certainty by its oxidative metabolic pattern, irrespective of its host or geographic source. Of the remaining strains, 38 displayed the metabolic pattern singular for Brucella abortus. Evidence was presented to support the conclusion that in this species the characteristics of dye tolerance, H2S production, and CO2 required for initial growth vary independently of each other, and strains that differ from the species description by these criteria can be identified correctly by their oxidative metabolic pattern. Of the 83 atypical strains examined, 24 were strains of Brucella described as a new species, Brucella intermedia (Renoux). Of these 24 strains, 10 were identified as Brucella melitensis, 13 as Brucella abortus, and one as Brucella suis. Evidence was

  15. The Exiguobacterium genus: biodiversity and biogeography

    SciTech Connect

    Vishnivetskaya, Tatiana A; Kathariou, Sophia; Tiedje, James M.

    2009-01-01

    Abstract. Bacteria of the genus Exiguobacterium are low G + C, Gram-positive facultative anaerobes that have been repeatedly isolated from ancient Siberian permafrost. In addition, Exiguobacterium spp. have been isolated from markedly diverse sources, including Greenland Glacial ice, hot springs at Yellowstone National Park, the rhizosphere of plants, and the environment of food processing plants. Strains of this hereto little known bacterium that have been retrieved from such different (and often extreme) environments are worthy of attention as they are likely to be specifically adapted to such environments and to carry variations in the genome which may correspond to psychrophilic and thermophilic adaptations. However, comparative genomic investigations of Exiguobacterium spp. from different sources have been limited. In this study, we employed different molecular approaches for the comparative analysis of 24 isolates from markedly diverse environments including ancient Siberian permafrost and hot springs at Yellowstone National Park. Pulsed-field gel electrophoresis (PFGE) with I-CeuI (an intron-encoded endonuclease), AscI and NotI were optimized for the determination of genomic fingerprints of nuclease-producing isolates. The application of a DNA macroarray for 82 putative stress-response genes yielded strain-specific hybridization profiles. Cluster analyses of 16S rRNA gene sequence data, PFGE I-CeuI restriction patterns and hybridization profiles suggested that Exiguobacterium strains formed two distinct divisions that generally agreed with temperature ranges for growth. With few exceptions (e.g., Greenland ice isolate GIC31), psychrotrophic and thermophilic isolates belonged to different divisions.

  16. Skadisotoma, a new genus of Isotomidae (Collembola) from Australia.

    PubMed

    Greenslade, Penelope; Fjellberg, Arne

    2015-06-13

    A new species and genus, Skadisotoma inpericulosa, is described from south-eastern Australia. It possesses some characters that are found in Tomoceridae, such as a long cylindrical dens that is medially bent and a mucro with at least six teeth of different sizes and three setae but in other characters it resembles an isotomid. In this it shows similarities to the Boreal genus Mucronia Fjellberg, but differs from it in the possession of spines on the dens and in some chaetotaxic characters.

  17. A review of the genus Lamellipalpodes Maulik (Coleoptera: Lampyridae).

    PubMed

    Bocakova, Milada; Bocak, Ladislav; Gimmel, Matthew L; Friedlova, Tereza

    2015-03-02

    The Ototretinae genus Lamellipalpodes Maulik, 1921 is reviewed. Four species are proposed as new to science, L. bajhangensis Bocakova sp. nov., L. holzschuhi Bocakova sp. nov. and L. godawarensis Bocakova sp. nov., all from Nepal, and L. yunnanensis Bocakova sp. nov. from China (Yunnan) and northern Laos. Six species are redescribed. Illustrations of diagnostic characters are included, with a checklist and a key to Lamellipalpodes species. The genus is newly recorded from China and Laos.

  18. The harvestman genus Taracus Simon 1879, and the new genus Oskoron (Opiliones: Ischyropsalidoidea: Taracidae).

    PubMed

    Shear, William A; Warfel, Joseph G

    2016-11-01

    The ischyropsalidoid genus Taracus Simon 1879 is reviewed and all previously named species are redescribed. Taracus nigripes Goodnight & Goodnight, 1943 is synonymized with T. packardi Simon 1879, and T. malkini Goodnight & Goodnight 1945 with Oskoron spinosus (Banks) 1894; the type locality of T. gertschi Goodnight & Goodnight 1942 is corrected from "eastern Oregon" to Rose Lake, Idaho, based on original labelling. The following new species of Taracus are described: T. carmanah (Vancouver Island), T. marchingtoni (Oregon), T. taylori, T. spesavius (both Nevada), T. timpanogos (Utah), T. audisioae, T. ubicki, and T. fluvipileus (all California). A new genus Oskoron is based upon O. spinosus (Banks) 1894, originally described in Taracus, and also includes two new species, O. brevichelis (Oregon, Washington) and O. crawfordi (Washington). New locality records extend the known distribution of Taracus to the Canadian provinces of Alberta and British Columbia and the US states of Montana, Wyoming, Utah, Nevada and New Mexico. Schönhofer's (2013) proposal of a family Taracidae for Taracus, Hesperonemastoma Gruber 1970 and Crosbycus Roewer 1914 is discussed.

  19. Genus identification of toxic plant by real-time PCR.

    PubMed

    Matsuyama, Shuji; Nishi, Katsuji

    2011-03-01

    Some plants have toxicities that are dangerous for humans. In the case of poisoning by toxic plants, a rapid and easy screening test is required for accurate medical treatment or forensic investigation. In this study, we designed specific primer pairs for identification of toxic plants, such as subgenus Aconitum, genus Ricinus, genus Illicium, and genus Scopolia, by internal transcribed spacer sequences of nuclear ribosomal DNA. Allied species of target plants, foods, and human DNA were not detected, but each primer pair provided a specific PCR product from the target plant using real-time PCR. This method can detect the subgenus Aconitum, genus Ricinus, and genus Scopolia with template DNA of 10 pg, respectively, and genus Illicium with 1 pg. Furthermore, each primer pair provided the exact PCR product from digested target plants in artificial gastric fluid. When a trace unknown plant sample in forensic investigation is collected from stomach contents, this PCR assay may be useful for screening toxic plants.

  20. GENUS RUELLIA: PHARMACOLOGICAL AND PHYTOCHEMICAL IMPORTANCE IN ETHNOPHARMACOLOGY.

    PubMed

    Afzal, Khurram; Uzair, Muhammad; Chaudhary, Bashir Ahmad; Ahmad, Ashfaq; Afzal, Samina; Saadullah, Malik

    2015-01-01

    Ruellia is a genus of flowering plants commonly known as Ruellias or Wild Petunias which belongs to the family Acanthaceae. It contains about 250 genera and 2500 species. Most of these are shrubs, or twining vines; some are epiphytes. Only a few species are distributed in temperate regions. They are distributed in Indonesia and Malaysia, Africa, Brazil, Central America and Pakistan. Some of these are used as medicinal plants. Many species of the genus has antinociceptive, antioxidant, analgesic, antispasmolytic, antiulcer, antidiabetic and anti-inflammatory properties. The phytochemicals constituents: glycosides, alkaloids, flavonoids and triterpenoids are present. The genus has been traditionally claimed to be used for the treatment of flu, asthma, fever, bronchitis, high blood pressure, eczema, and diabetes. The objective of this review article is to summarize all the pharmacological and phytochemical evaluations or investigations to find area of gap and endorse this genus a step towards commercial drug. Hence, further work required is to isolate and characterize the active compounds responsible for these activities in this plant and bring this genus plants to commercial health market to serve community with their potential benefits.

  1. Genotyping of clinical isolates of Acanthamoeba genus in Venezuela.

    PubMed

    Wagner, Carolina; Reyes-Batlle, María; Ysea, María Alejandra Vethencourt; Pérez, Mónica V Galindo; de Rondón, Carmen Guzmán; Paduani, Anaibeth J Nessi; Pérez, Angelyseb Dorta; López-Arencibia, Atteneri; Sifaoui, Ines; de Galindo, María Virginia Pérez; de Suárez, Eva Pérez; Martínez-Carretero, Enrique; Valladares, Basilio; Piñero, José E; Lorenzo-Morales, Jacob

    2016-12-01

    Free-living amoebae of Acanthamoeba genus are opportunistic pathogens distributed worldwide. Strains included in this genus are causative agents of a fatal encephalitis and a sight-threating keratitis in humans and other animals. In this study, 550 clinical samples which were collected between 1984 and 2014 from different patients with suspected infections due to Acanthamoeba were initially screened for the presence of this amoebic genus at the Laboratorio de Amibiasis-Escuela de Bioanálisis at the Universidad Central de Venezuela. Samples were cultured in 2% Non-Nutrient agar plates seeded with a layer of heat killed Escherichia coli. From the 550 clinical samples included in this study, 18 of them were positive for Acanthamoeba genus after culture identification. Moreover, positive samples were confirmed after amplification of the Diagnostic Fragment 3 (DF3) of the Acanthamoeba18S rDNA genus and sequencing was carried out in order to genotype the isolated strains of Acanthamoeba. Furthermore, the pathogenic potential of the strains was checked by performing thermotolerance and osmotolerance assays. Sequencing of the DF3 region resulted in the identification of genotype T4 in all the isolated strains. Moreover, most isolates were thermotolerant or both thermotolerant and osmotolerant and thus were classified as potentially pathogenic strains. To the best of our knowledge, this is the first report on the molecular characterization at the genotype level of Acanthamoeba strains in Venezuela.

  2. Molecular systematics of the Middle American genus Hypopachus (Anura: Microhylidae)

    PubMed Central

    Greenbaum, Eli; Smith, Eric N.; de Sá, Rafael O.

    2011-01-01

    We present the first phylogenetic study on the widespread Middle American microhylid frog genus Hypopachus. Partial sequences of mitochondrial (12S and 16S ribosomal RNA) and nuclear (rhodopsin) genes (1275 bp total) were analyzed from 43 samples of Hypopachus, three currently recognized species of Gastrophryne, and seven arthroleptid, brevicipitid and microhylid outgroup taxa. Maximum parsimony (PAUP), maximum likelihood (RAxML) and Bayesian inference (MrBayes) optimality criteria were used for phylogenetic analyses, and BEAST was used to estimate divergence dates of major clades. Population-level analyses were conducted with the programs NETWORK and Arlequin. Results confirm the placement of Hypopachus and Gastrophryne as sister taxa, but the latter genus was strongly supported as paraphyletic. The African phrynomerine genus Phrynomantis was recovered as the sister taxon to a monophyletic Chiasmocleis, rendering our well-supported clade of gastrophrynines paraphyletic. Hypopachus barberi was supported as a disjunctly distributed highland species, and we recovered a basal split in lowland populations of Hypopachus variolosus from the Pacific versant of Mexico and elsewhere in the Mesoamerican lowlands. Dating analyses from BEAST estimate speciation within the genus Hypopachus occurred in the late Miocene/early Pliocene for most clades. Previous studies have not found bioacoustic or morphological differences among these lowland clades, and our molecular data support the continued recognition of two species in the genus Hypopachus. PMID:21798357

  3. Using a model to assess the role of the spatiotemporal pattern of inhibitory input and intrasegmental electrical coupling in the intersegmental and side-to-side coordination of motor neurons by the leech heartbeat central pattern generator.

    PubMed

    García, Paul S; Wright, Terrence M; Cunningham, Ian R; Calabrese, Ronald L

    2008-09-01

    Previously we presented a quantitative description of the spatiotemporal pattern of inhibitory synaptic input from the heartbeat central pattern generator (CPG) to segmental motor neurons that drive heartbeat in the medicinal leech and the resultant coordination of CPG interneurons and motor neurons. To begin elucidating the mechanisms of coordination, we explore intersegmental and side-to-side coordination in an ensemble model of all heart motor neurons and their known synaptic inputs and electrical coupling. Model motor neuron intrinsic properties were kept simple, enabling us to determine the extent to which input and electrical coupling acting together can account for observed coordination in the living system in the absence of a substantive contribution from the motor neurons themselves. The living system produces an asymmetric motor pattern: motor neurons on one side fire nearly in synchrony (synchronous), whereas on the other they fire in a rear-to-front progression (peristaltic). The model reproduces the general trends of intersegmental and side-to-side phase relations among motor neurons, but the match with the living system is not quantitatively accurate. Thus realistic (experimentally determined) inputs do not produce similarly realistic output in our model, suggesting that motor neuron intrinsic properties may contribute to their coordination. By varying parameters that determine electrical coupling, conduction delays, intraburst synaptic plasticity, and motor neuron excitability, we show that the most important determinant of intersegmental and side-to-side phase relations in the model was the spatiotemporal pattern of synaptic inputs, although phasing was influenced significantly by electrical coupling.

  4. Flavonoids from the Genus Astragalus: Phytochemistry and Biological Activity

    PubMed Central

    Bratkov, Viktor M.; Shkondrov, Aleksandar M.; Zdraveva, Petranka K.; Krasteva, Ilina N.

    2016-01-01

    Flavonoids, the most common plant polyphenols are widely distributed in every species and possess a broad range of pharmacological activities. The genus Astragalus is the largest in the Fabaceae family with more than 2,500 species spread. They are known to contain different metabolites such as flavonoids, saponins, and polysaccharides. Plants from the genus have been used in the traditional medicine of many countries for centuries. This paper is focused on the large group of flavonoid compounds. Details on structure as well as information about the pharmacological properties of flavonoids, isolated from Astragalus species have been discussed. This review is based on publications until the first half of 2014 and includes also the results from our phytochemical investigations of the genus. PMID:27041870

  5. Guyanagarika, a new ectomycorrhizal genus of Agaricales from the Neotropics.

    PubMed

    Sánchez-García, Marisol; Henkel, Terry W; Aime, Mary Catherine; Smith, Matthew E; Matheny, Patrick Brandon

    2016-12-01

    A new genus and three new species of Agaricales are described from the Pakaraima Mountains of Guyana in the central Guiana Shield. All three of these new species fruit on the ground in association with species of the ectomycorrhizal (ECM) tree genus Dicymbe (Fabaceae subfam. Caesalpinioideae) and one species has been shown to form ectomycorrhizas. Multi-locus molecular phylogenetic analyses place Guyanagarika gen. nov. within the Catathelasma clade, a lineage in the suborder Tricholomatineae of the Agaricales. We formally recognize this 'Catathelasma clade' as an expanded family Catathelasmataceae that includes the genera Callistosporium, Catathelasma, Guyanagarika, Macrocybe, Pleurocollybia, and Pseudolaccaria. Within the Catathelasmataceae, Catathelasma and Guyanagarika represent independent origins of the ectomycorrhizal habit. Guyanagarika is the first documented case of an ECM Agaricales genus known only from the Neotropics.

  6. Evidence for Ecological Flexibility in the Cosmopolitan Genus Curtobacterium

    PubMed Central

    Chase, Alexander B.; Arevalo, Philip; Polz, Martin F.; Berlemont, Renaud; Martiny, Jennifer B. H.

    2016-01-01

    Assigning ecological roles to bacterial taxa remains imperative to understanding how microbial communities will respond to changing environmental conditions. Here we analyze the genus Curtobacterium, as it was found to be the most abundant taxon in a leaf litter community in southern California. Traditional characterization of this taxon predominantly associates it as the causal pathogen in the agricultural crops of dry beans. Therefore, we sought to investigate whether the abundance of this genus was because of its role as a plant pathogen or another ecological role. By collating >24,000 16S rRNA sequences with 120 genomes across the Microbacteriaceae family, we show that Curtobacterium has a global distribution with a predominant presence in soil ecosystems. Moreover, this genus harbors a high diversity of genomic potential for the degradation of carbohydrates, specifically with regards to structural polysaccharides. We conclude that Curtobacterium may be responsible for the degradation of organic matter within litter communities. PMID:27920771

  7. The genus Odontophrynus (Anura: Odontophrynidae): a larval perspective.

    PubMed

    Filipe Augusto C, Do Nascimento; Tamí, Mott; José A, Langone; Christine A, Davis; Rafael O, De Sá

    2013-01-01

    The genus Odontophrynus consists of 11 species of medium-sized frogs distributed across south and east South America. This study examines and describes the chondrocrania and oral cavities of O. americanus, O. maisuma, O. carvalhoi, and O. cultripes, and review current knowledge about the larval external morphology of the genus. Twenty-one tadpoles were cleared and double-stained for chondrocranium description and five tadpoles were dissected for analysis in a scanning electron microscope. The presence of a tectum parientale may be considered here as a putative synapomorphy of the genus. The O. americanus and O. cultripes species groups were partially differentiated by the length of the processus pseudopterigoideus, shape of divergence of the hypobranchial plates, number of postnarial papillae, and number of projections of the lateral ridge papillae. The larvae of O. occidentalis species group, in turn, differed from others by presenting a greater total length.

  8. [Advances in chemical constituents and bioactivity of Salvia genus].

    PubMed

    Peng, Qing; Liu, Jian-xun

    2015-06-01

    The genus Salvia in the family Lamiaceae with nearly 1 000 species, is widespread in temperate and tropical regions around the world. Many species of genus Salvia are important medicinal plants with a long history of which Danshen (the dried roots and rhizomes of S. miltiorrhiza) is one of the most popular herbal traditional medicines in Asian countries. The chemical constituents from Salvia plants mainly contain sesquiterpenoids, diterpenoids, triterpenoids, steroids and polyphenols etc, which exhibit antibacterial, antidermatophytic, antioxidant, anti-inflammatory, antineoplastic, antiplatelet aggregation activities and so on. In this article, the development of new constituents and their biological activities of Salvia genus in the past five years were reviewed and summarized for its further development and utilization.

  9. The versatility and adaptation of bacteria from the genus Stenotrophomonas

    SciTech Connect

    Ryan, R.P.; van der Lelie, D.; Monchy, S.; Cardinale, M.; Taghavi, S.; Crossman, L.; Avison, M. B.; Berg, G.; Dow, J. M.

    2009-07-01

    The genus Stenotrophomonas comprises at least eight species. These bacteria are found throughout the environment, particularly in close association with plants. Strains of the most predominant species, Stenotrophomonas maltophilia, have an extraordinary range of activities that include beneficial effects for plant growth and health, the breakdown of natural and man-made pollutants that are central to bioremediation and phytoremediation strategies and the production of biomolecules of economic value, as well as detrimental effects, such as multidrug resistance, in human pathogenic strains. Here, we discuss the versatility of the bacteria in the genus Stenotrophomonas and the insight that comparative genomic analysis of clinical and endophytic isolates of S. maltophilia has brought to our understanding of the adaptation of this genus to various niches.

  10. Phylogenetic position of the Dalmatian genus Phoxinellus and description of the newly proposed genus Delminichthys (Teleostei: Cyprinidae).

    PubMed

    Freyhof, Jörg; Lieckfeldt, Dietmar; Bogutskaya, Nina G; Pitra, Christian; Ludwig, Arne

    2006-02-01

    The Dalmatian cyprinid genus Phoxinellus is characterized by reductive characters most likely associated with the environmental conditions of small karstic streams, where all species of this genus occur. Based on 33 morphological traits, nuclear and mtDNA sequences Phoxinellus was found to be paraphyletic and included three not closely related monophyletic units. The scientific name Phoxinellus should therefore be restricted to species having plain coloration, small or absent postcleithrum, no genital papilla and an almost entirely naked body such as P. alepidotus, P. dalmaticus, and P. pseudalepidotus. Species that also have a small or absent postcleithrum and no genital papilla but display a dark stripe from the head to the caudal peduncle, and are entirely covered by distinct, not overlapping scales should be positioned closely to Telestes. Thus, we suggest inclusion of Phoxinellus croaticus, P. fontinalis and Paraphoxinus metohiensis in the genus Telestes. The Phoxinellus species that have a irregularly spotted color pattern, a large postcleithrum, an increased number of precaudal anal-fin pterygiophores, and a large genital papilla in females represent its own evolutionary line closely related to the Balkan species of Pseudophoxinus. For this monophyletic group, we propose to introduce a new genus: Delminichthys. This genus includes the species D. adspersus, D. ghetaldii, D. krbavensis and D. jadovensis.

  11. Calabi-Yau Geometry and Higher Genus Mirror Symmetry

    NASA Astrophysics Data System (ADS)

    Li, Si

    2011-12-01

    We study closed string mirror symmetry on compact Calabi-Yau manifolds at higher genus. String theory predicts the existence of two sets of geometric invariants, from the A-model and the B-model on Calabi-Yau manifolds, each indexed by a non-negative integer called genus. The A-model has been mathematically established at all genera by the Gromov-Witten theory, but little is known in mathematics for B-model beyond genus zero. We develop a mathematical theory of higher genus B-model from perturbative quantization techniques of gauge theory. The relevant gauge theory is the Kodaira-Spencer gauge theory, which is originally discovered by Bershadsky-Cecotti-Ooguri-Vafa as the closed string field theory of B-twisted topological string on Calabi-Yau three-folds. We generalize this to Calabi-Yau manifolds of arbitrary dimensions including also gravitational descendants, which we call BCOV theory. We give the geometric description of the perturbative quantization of BCOV theory in terms of deformation-obstruction theory. The vanishing of the relevant obstruction classes will enable us to construct the higher genus B-model. We carry out this construction on the elliptic curve and establish the corresponding higher genus B-model. Furthermore, we show that the B-model invariants constructed from BCOV theory on the elliptic curve can be identified with descendant Gromov-Witten invariants on the mirror elliptic curve. This gives the first compact Calabi-Yau example where mirror symmetry can be established at all genera.

  12. Rapid identification of Zygosaccharomyces with genus-specific primers.

    PubMed

    Hulin, Michelle; Wheals, Alan

    2014-03-03

    There has been a recent and rapid increase in the number of species of the genus Zygosaccharomyces which now comprises Z. bailii, Z. bisporus, Z. gambellarensis, Z. kombuchaensis, Z. lentus, Z. machadoi, Z. mellis, Z. parabaillii, Z. pseudobailii, Z. pseudorouxii, Z. rouxii, Z. sapae, and Z. siamensis. Z. pseudorouxii is an unofficial name given to isolates closely related to the newly-described species Z. sapae. The Zygosaccharomyces genus contains species that are important as food and beverage spoilage organisms and others are associated with fermentations and sweet foodstuffs, such as honey. Their economic significance means that the ability to identify them rapidly is of significant importance. Although Z. rouxii and Z. bailii have been genome-sequenced the extent of sequence data for the others, especially the newly-discovered species, is sometimes extremely limited which makes identification slow. However, parts of the ITS1/5.8S/ITS2 rDNA region contain sequences of sufficient similarity within the genus and of sufficient difference with outgroups, to be potential regions for the design of genus-wide specific primers. We report here the development of genus-specific primers that can detect all the major Zygosaccharomyces species including all those associated with foods; the rare and localised species Z. machadoi and Z. gambellarensis are not detected. The size of the single amplicon produced varies between species and in some cases is sufficiently different to assign provisional species identification. Sequence data from rDNA regions are available for virtually all described yeast species in all genera, thus, prior to having sufficient sequence data from structural genes, rDNA regions may provide more generally suitable candidates for both genus-specific and species-specific primer design.

  13. Three new species in the genus Wilkinsonellus (Braconidae, Microgastrinae) from the Neotropics, and the first host record for the genus

    PubMed Central

    Arias-Penna, Diana Carolina; Whitfield, James B.; Janzen, Daniel H.; Hallwachs, Winnie

    2013-01-01

    Abstract The genus Wilkinsonellus Mason is a poorly sampled but widely distributed tropical genus of Microgastrinae (Braconidae), parasitoid wasps that exclusively attack caterpillars (Lepidoptera). Currently, species of Wilkinsonellus have been described only from the Palaeotropics, but the genus was known to occur in the Neotropics. Here we describe the first three species from Central and South America: Wilkinsonellus alexsmithi sp. n., Wilkinsonellus kogui sp. n.,and Wilkinsonellus panamaensis sp. n. These species descriptions confirm that Wilkinsonellus is a Pantropical genus. A dichotomous key for the three new Neotropical species is given. The first recorded host for the genus, Microthyris prolongalis (Crambidae), is also reported, for Wilkinsonellus alexsmithi. PMID:23794899

  14. Three new species in the genus Wilkinsonellus (Braconidae, Microgastrinae) from the Neotropics, and the first host record for the genus.

    PubMed

    Arias-Penna, Diana Carolina; Whitfield, James B; Janzen, Daniel H; Hallwachs, Winnie

    2013-01-01

    The genus Wilkinsonellus Mason is a poorly sampled but widely distributed tropical genus of Microgastrinae (Braconidae), parasitoid wasps that exclusively attack caterpillars (Lepidoptera). Currently, species of Wilkinsonellus have been described only from the Palaeotropics, but the genus was known to occur in the Neotropics. Here we describe the first three species from Central and South America: Wilkinsonellus alexsmithi sp. n., Wilkinsonellus kogui sp. n.,and Wilkinsonellus panamaensis sp. n. These species descriptions confirm that Wilkinsonellus is a Pantropical genus. A dichotomous key for the three new Neotropical species is given. The first recorded host for the genus, Microthyris prolongalis (Crambidae), is also reported, for Wilkinsonellus alexsmithi.

  15. Genome Sequence of Type Strains of Genus Stenotrophomonas

    PubMed Central

    Patil, Prashant P.; Midha, Samriti; Kumar, Sanjeet; Patil, Prabhu B.

    2016-01-01

    Genomic resource of type strains and historically important strains of genus Stenotrophomonas allowed us to reveal the existence of 18 distinct species by applying modern phylogenomic criterions. Apart from Stenotrophomonas maltophilia, S. africana represents another species of clinical importance. Interestingly, Pseudomonas hibsicola, P. beteli, and S. pavani that are of plant origin are closer to S. maltophilia than the majority of the environmental isolates. The genus has an open pan-genome. By providing the case study on genes encoding metallo-β-lactamase and Clustered Regularly Interspaced Short Palindrome Repeats (CRISPR) regions, we have tried to show the importance of this genomic dataset in understanding its ecology. PMID:27014232

  16. Kitasatosporia, a new genus of the order Actinomycetales.

    PubMed

    Omura, S; Takahashi, Y; Iwai, Y; Tanaka, H

    1982-08-01

    The morphological, cultural, physiological and biochemical characteristics of a new actinomycete strain producing a new antibiotic, setamycin are described. The strain forms aerial mycelia. There is no fragmentation of vegetative mycelia. Since the cell wall type is a new one containing both LL- and meso-2,6-diaminopimelic acid, glycine and galactose, strain KM-6054 could not be classified in any previously named genera of the order Actinomycetales. Thus, it is considered to be a member of a new genus, for which the name Kitasatosporia is proposed. The type species (monotype) of this genus is K. setalba. The type strain of K. setalba is strain KM-6054 (ATCC 33774).

  17. Review of the leafhopper genus Evinus Dlabola (Hemiptera: Cicadellidae: Deltocephalinae).

    PubMed

    Lu, Lin; Dietrich, Christopher H; Zhang, Yalin

    2013-01-01

    The leafhopper genus Evinus Dlabola (Deltocephalinae: Macrostelini) is reviewed. Seven new species are described including E. angulatus sp. nov., E. hainanensis sp. nov., E. longus sp. nov., E. obscurus sp. nov., E. planus sp. nov., E. sinuatus sp. nov. E. tenuis sp. nov. One previously described species, E. peri Anufriev, newly recorded from China, is redescribed. The species of the genus have so far been recorded from Iran, Tajikistan, Kyrgyzstan and China; here several new species from Thailand are added. A checklist and a key to species (males) are also provided.

  18. Divergent karyotypes of the annual killifish genus Nothobranchius (Cyprinodontiformes, Nothobranchiidae)

    PubMed Central

    Krysanov, Eugene; Demidova, Tatiana; Nagy, Bela

    2016-01-01

    Abstract Karyotypes of two species of the African annual killifish genus Nothobranchius Peters, 1868, Nothobranchius brieni Poll, 1938 and Nothobranchius sp. from Kasenga (D.R. Congo) are described. Both species displayed diploid chromosome number 2n = 49/50 for males and females respectively with multiple-sex chromosome system type X1X2Y/X1X1X2X2. The karyotypes of studied species are considerably different from those previously reported for the genus Nothobranchius and similar to the Actinopterygii conservative karyotype. PMID:27830051

  19. The genus Unixenus Jones, 1944 (Diplopoda, Penicillata, Polyxenida) in Australia

    PubMed Central

    Short, Megan; Huynh, Cuong

    2011-01-01

    Abstract The penicillate genus Unixenus Jones, 1944 is widespread, with species found in Africa, Madagascar, India and Australia. Each of the two Australian species was originally described from single samples from Western Australia. In this study, collections of Penicillata from museums in all states of Australia were examined to provide further details of the two described species, to revise the diagnoses for both the genus and the species, and to better understand the distribution of the two species in Australia. In addition, two new species Unixenus karajinensis sp. n. and Unixenus corticolus sp. n. are described. PMID:22303098

  20. The genus Ontherus Erichson 1847 (Coleoptera: Scarabaeidae: Scarabaeinae): description of a new species, and notes on the genus in Colombia.

    PubMed

    González, Fabio Arturo; Medina U, Claudia Alejandra

    2015-04-23

    The state of knowledge of the genus Ontherus Erichson 1847 in Colombia is reviewed and updated since the revision of the genus by Génier (1996), and the species list for Colombia of Medina et al. (2001). Two new distributional records for Colombia are confirmed; Ontherus politus Génier 1996 and Ontherus gilli Génier 1996. An updated species list of Ontherus for Colombia is presented with comments on the species with doubtful distribution in Colombia. O. felicitae n. sp., a new species from the mexicanus species group, is described from Western Andes of Colombia.

  1. The South American genus Lagideus (Hymenoptera: Pergidae: Syzygoniinae), a supplement

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Six new species of the Neotropical pergid genus Lagideus are described and illustrated: Lagideus boyaca, L. magdalena, L. schmidti, and L. flavus from Colombia and L. tapanti and L. isidro from Costa Rica. Lagideus romius Smith is newly recorded from Colombia and the female lancet is illustrated. ...

  2. The genus Neotherina Dognin (Geometridae, Ennominae) in Costa Rica.

    PubMed

    Sullivan, J Bolling; Chacón, Isidro

    2011-01-01

    So far, two species of Neotherina Dognin have been recorded in Costa Rica. Neotherina imperilla (Dognin) occurs primarily at altitudes between 1100 and 1700 meters and Neotherina callas (Druce) which is widely distributed above 1100 meters. A third, new species, Neotherina xanthosa Sullivan and Chacón is described from altitudes above 2400 meters. Heterogeneity of the genus is discussed.

  3. The transfer of the genus Lytocaryum to Syagrus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Technical Abstract In this paper we formally transfer all four known species of Lytocaryum to the genus Syagrus based on recent molecular analyses, which show it as a monophyletic group either nested within Syagrus making Syagrus paraphyletic or sister to it. Because of these conflicting results bet...

  4. Phylogenetic diversity and position of the genus Campylobacter

    NASA Technical Reports Server (NTRS)

    Lau, P. P.; DeBrunner-Vossbrinck, B.; Dunn, B.; Miotto, K.; MacDonnell, M. T.; Rollins, D. M.; Pillidge, C. J.; Hespell, R. B.; Colwell, R. R.; Sogin, M. L.; Fox, G. E.

    1987-01-01

    RNA sequence analysis has been used to examine the phylogenetic position and structure of the genus Campylobacter. A complete 5S rRNA sequence was determined for two strains of Campylobacter jejuni and extensive partial sequences of the 16S rRNA were obtained for several strains of C. jejuni and Wolinella succinogenes. In addition limited partial sequence data were obtained from the 16S rRNAs of isolates of C. coli, C. laridis, C. fetus, C. fecalis, and C. pyloridis. It was found that W. succinogenes is specifically related to, but not included, in the genus Campylobacter as presently constituted. Within the genus significant diversity was noted. C. jejuni, C. coli and C. laridis are very closely related but the other species are distinctly different from one another. C. pyloridis is without question the most divergent of the Campylobacter isolates examined here and is sufficiently distinct to warrant inclusion in a separate genus. In terms of overall position in bacterial phylogeny, the Campylobacter/Wolinella cluster represents a deep branching most probably located within an expanded version of the Division containing the purple photosynthetic bacteria and their relatives. The Campylobacter/Wolinella cluster is not specifically includable in either the alpha, beta or gamma subdivisions of the purple bacteria.

  5. Phylogeny, phylogeography and genetic diversity of Pisum genus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Tribe Fabeae (formerly Vicieae) contains some of humanity's most important grain legume crops, namely Lathyrus; Lens; Pisum; Vicia and the monotypic genus Vavilovia. Our study based on molecular data, have positioned Pisum between Vicia and Lathyrus and being closely allied to Vavilovia. Study of p...

  6. First case of neonatal bacteremia due to Dyella genus.

    PubMed

    Hakima, Nesrine; Bidet, Philippe; Lopez, Maureen; Rioualen, Stéphane; Carol, Agnès; Bonacorsi, Stéphane

    2017-02-01

    We describe the first case of sepsis due to a yet unnamed species of Dyella genus associated to gastrointestinal perforation in a premature newborn. The rarity of such environmental bacteria in human infection, their misidentification with classical methods and their antibiotic resistance represent real challenges for both microbiologists and clinicians.

  7. Revision of the Late Jurassic teleosaurid genus Machimosaurus (Crocodylomorpha, Thalattosuchia).

    PubMed

    Young, Mark T; Hua, Stéphane; Steel, Lorna; Foffa, Davide; Brusatte, Stephen L; Thüring, Silvan; Mateus, Octávio; Ruiz-Omeñaca, José Ignacio; Havlik, Philipe; Lepage, Yves; De Andrade, Marco Brandalise

    2014-10-01

    Machimosaurus was a large-bodied genus of teleosaurid crocodylomorph, considered to have been durophagous/chelonivorous, and which frequented coastal marine/estuarine ecosystems during the Late Jurassic. Here, we revise the genus based on previously described specimens and revise the species within this genus. We conclude that there were three European Machimosaurus species and another taxon in Ethiopia. This conclusion is based on numerous lines of evidence: craniomandibular, dental and postcranial morphologies; differences in estimated total body length; geological age; geographical distribution; and hypothetical lifestyle. We re-diagnose the type species Machimosaurus hugii and limit referred specimens to only those from Upper Kimmeridgian-Lower Tithonian of Switzerland, Portugal and Spain. We also re-diagnose Machimosaurus mosae, demonstrate that it is an available name and restrict the species to the uppermost Kimmeridgian-lowermost Tithonian of northeastern France. We re-diagnose and validate the species Machimosaurus nowackianus from Harrar, Ethiopia. Finally, we establish a new species, Machimosaurus buffetauti, for the Lower Kimmeridgian specimens of France and Germany (and possibly England and Poland). We hypothesize that Machimosaurus may have been analogous to the Pliocene-Holocene genus Crocodylus in having one large-bodied taxon suited to traversing marine barriers and additional, geographically limited taxa across its range.

  8. Digitomyces, a new genus of hyphomycetes with cheiroid conidia.

    PubMed

    Mercado Sierra, Angel; Calduch, Misericordia; Gené, Josepa; Guarro, Josep; Delgado, Gregorio

    2003-01-01

    The new anamorphic genus Digitomyces, based on Dictyosporium verrucosum, is proposed. It is characterized by micronematous or semimacronematous conidiophores, integrated or discrete, holoblastic, determinate conidiogenous cells, and olivaceous to pale brown, verrucose, cheiroid conidia, with a truncate basal cell and (2-)3 arms. The new taxon is compared with morphologically similar anamorph genera.

  9. The oribatid mite genus Benoibates (Acari, Oribatida, Oripodidae).

    PubMed

    Ermilov, Sergey G; Alvarado-Rodríguez, Olman; Kontschán, Jenő; Retana-Salazar, Axel P

    2014-01-01

    Two species of oribatid mites of the genus Benoibates (Oribatida, Oripodidae), i.e., Benoibatesbolivianus Balogh & Mahunka, 1969(a) and Benoibatesminimus Mahunka, 1985, are recorded for the first time in Costa Rica. Both are redescribed in details, using drawings, images and SEM micrographs, on the basis of Costa Rican specimens. An identification key to the known species of Benoibates is given.

  10. Gondwanamyia, a new empidoid (Diptera) genus of uncertain placement

    PubMed Central

    Sinclair, Bradley J.; Cumming, Jeffrey M.; Brooks, Scott E.; Plant, Adrian R.; Saigusa, Toyohei

    2016-01-01

    Abstract A new minute-size empidoid fly genus, Gondwanamyia gen. n. and two new species (Gondwanamyia chilensis Cumming & Saigusa, sp. n., Gondwanamyia zealandica Sinclair & Brooks, sp. n.) are described, illustrated, and their distributions mapped. The family and subfamily assignments remain uncertain, but features of the female terminalia potentially suggest Trichopezinae (Brachystomatidae). PMID:27833421

  11. A new genus of Coelotinae (Araneae, Agelenidae) from southern China

    PubMed Central

    Chen, Lu; Li, Shuqiang; Zhao, Zhe

    2015-01-01

    Abstract One new genus of the spider subfamily Coelotinae, Flexicoelotes gen. n., with five new species is described from southern China: Flexicoelotes huyunensis sp. n. (female), Flexicoelotes jiaohanyanensis sp. n. (male and female), Flexicoelotes jinlongyanensis sp. n. (male and female), Flexicoelotes pingzhaiensis sp. n. (female), Flexicoelotes xingwangensis sp. n. (male and female). PMID:26798279

  12. A new genus of Coelotinae (Araneae, Agelenidae) from southern China.

    PubMed

    Chen, Lu; Li, Shuqiang; Zhao, Zhe

    2015-01-01

    One new genus of the spider subfamily Coelotinae, Flexicoelotes gen. n., with five new species is described from southern China: Flexicoelotes huyunensis sp. n. (female), Flexicoelotes jiaohanyanensis sp. n. (male and female), Flexicoelotes jinlongyanensis sp. n. (male and female), Flexicoelotes pingzhaiensis sp. n. (female), Flexicoelotes xingwangensis sp. n. (male and female).

  13. Taxonomic studies of nectrioid fungi in Japan: The genus Cosmospora

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seven species of the genus Cosmospora collected in Japan are reported in this article. Among them, Cosmospora japonica is described as a new species. Cosmospora henanensis, C. rubrisetosa and C. triqua, all of which are known only from their type localities, are added to the Japanese mycoflora. Othe...

  14. Revision of the Late Jurassic teleosaurid genus Machimosaurus (Crocodylomorpha, Thalattosuchia)

    PubMed Central

    Young, Mark T.; Hua, Stéphane; Steel, Lorna; Foffa, Davide; Brusatte, Stephen L.; Thüring, Silvan; Mateus, Octávio; Ruiz-Omeñaca, José Ignacio; Havlik, Philipe; Lepage, Yves; De Andrade, Marco Brandalise

    2014-01-01

    Machimosaurus was a large-bodied genus of teleosaurid crocodylomorph, considered to have been durophagous/chelonivorous, and which frequented coastal marine/estuarine ecosystems during the Late Jurassic. Here, we revise the genus based on previously described specimens and revise the species within this genus. We conclude that there were three European Machimosaurus species and another taxon in Ethiopia. This conclusion is based on numerous lines of evidence: craniomandibular, dental and postcranial morphologies; differences in estimated total body length; geological age; geographical distribution; and hypothetical lifestyle. We re-diagnose the type species Machimosaurus hugii and limit referred specimens to only those from Upper Kimmeridgian–Lower Tithonian of Switzerland, Portugal and Spain. We also re-diagnose Machimosaurus mosae, demonstrate that it is an available name and restrict the species to the uppermost Kimmeridgian–lowermost Tithonian of northeastern France. We re-diagnose and validate the species Machimosaurus nowackianus from Harrar, Ethiopia. Finally, we establish a new species, Machimosaurus buffetauti, for the Lower Kimmeridgian specimens of France and Germany (and possibly England and Poland). We hypothesize that Machimosaurus may have been analogous to the Pliocene–Holocene genus Crocodylus in having one large-bodied taxon suited to traversing marine barriers and additional, geographically limited taxa across its range. PMID:26064545

  15. The genus Neotherina Dognin (Geometridae, Ennominae) in Costa Rica

    PubMed Central

    Sullivan, J. Bolling; Chacón, Isidro

    2011-01-01

    Abstract So far, two species of Neotherina Dognin have been recorded in Costa Rica. Neotherina imperilla (Dognin) occurs primarily at altitudes between 1100 and 1700 meters and Neotherina callas (Druce) which is widely distributed above 1100 meters. A third, new species, Neotherina xanthosa Sullivan and Chacón is described from altitudes above 2400 meters. Heterogeneity of the genus is discussed. PMID:22207793

  16. A review of the genus Dudaia Hedicke, 1923 (Diptera, Sphaeroceridae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Species of the Afrotropical genus Dudaia Hedicke, 1923 of the subfamily Copromyzinae are revised. The status of Afroborborus Curran, 1931 as a junior synonym of Dudaia is corroborated. Twelve species have been described hitherto, two of them are proposed here to be junior synonyms: Copromyza (Dudaia...

  17. Troglobitic scorpions: a new genus and species from Brazil.

    PubMed

    Lourenço, Wilson R; Baptista, Renner Luiz Cerqueira; de Leão Giupponi, Alessandro Ponce

    2004-12-01

    A new genus and species of troglobitic buthid scorpion are described on the basis of a single specimen collected in Brazil. This is the first cavernicolous scorpion ever found in Brazil, and only the second to be found in South America. Some considerations on troglobitic scorpions are proposed.

  18. Mountain scorpions: a new genus and species from Tibet (China).

    PubMed

    Lourenço, Wilson R; Qi, Jian-xin

    2006-04-01

    A new genus and species of mountain liochelid scorpion are described on the basis of a single specimen collected in Tibet (China). This is the first liochelid scorpion found in the high Himalayan Mountains of Tibet, and the first example of the family to be collected out of its typical tropical and subtropical areas of distribution. Some considerations on mountain scorpions are proposed.

  19. Humicolous microcharmid scorpions: a new genus and species from Madagascar.

    PubMed

    Lourenço, Wilson R

    2004-01-01

    A new genus and species of humicolous microcharmid scorpion are described on the basis of a single specimen collected in the Ankarana Reserve, Madagascar. New considerations regarding the taxonomy and morphology of micro-buthoid Malagasy scorpions are proposed, based mainly on the study of the peg-shaped sensillae of the pectines by scanning electron microscopy.

  20. Australopithecus sediba and the earliest origins of the genus Homo.

    PubMed

    Berger, Lee

    2012-01-01

    Discovered in 2008, the site of Malapa has yielded a remarkable assemblage of early hominin remains attributed to the species Australopithecus sediba. The species shows unexpected and unpredicted mosaicism in its anatomy. Several commentators have questioned the specific status of Au. sediba arguing that it does not exceed the variation of Au. africanus. This opinion however, does not take into account that Au. sediba differs from Au. africanus in both craniodental and postcranial characters to a greater degree than Au.africanus differs from Au. afarensis in these same characters. Au. sediba has also been questioned as a potential ancestor of the genus Homo due to the perception that earlier specimens of the genus have been found than the c198 Ma date of the Malapa sample. This opinion however, does not take into account either the poor condition of these fossils, as well as the numerous problems with both the criteria used to associate them with the genus Homo, nor the questionable provenance of each of these specimens. This argument also does not acknowledge that Malapa is almost certainly not the first chronological appearance of Au. sediba, it is only the first known fossil occurrence. Au. sediba should therefore be considered a strong potential candidate ancestor of the genus Homo until better preserved specimens are discovered that would refute such a hypothesis.

  1. Sirdavidia, an extraordinary new genus of Annonaceae from Gabon

    PubMed Central

    Couvreur, Thomas L.P.; Niangadouma, Raoul; Sonké, Bonaventure; Sauquet, Hervé

    2015-01-01

    Abstract A distinctive new monotypic genus from Gabon is described in the tropical plant family Annonaceae: Sirdavidia, in honor to Sir David Attenborough. Molecular phylogenetic analyses confirm that Sirdavidia, which is very distinct from a morphological standpoint, is not nested in any existing genus of Annonaceae and belongs to tribe Piptostigmateae (subfamily Malmeoideae), which now contains a total of six genera. The genus is characterized by long acuminate leaves, fully reflexed red petals, 16–19 bright yellow, loosely arranged stamens forming a cone, and a single carpel topped by a conspicuous stigma. With just three known collections, a preliminary IUCN conservation status assessment is provided as “endangered” as well as a distribution map. The discovery of Sirdavidia is remarkable at several levels. First, it was collected near the road in one of the botanically best-known regions of Gabon: Monts de Cristal National Park. Second, its sister group is the genus Mwasumbia, also monotypic, endemic to a small area in a forest in Tanzania, some 3000 km away. Finally, the floral morphology is highly suggestive of a buzz pollination syndrome. If confirmed, this would be the first documentation of such a pollination syndrome in Magnoliidae and early-diverging angiosperms in general. PMID:25878546

  2. Vitilevumyia, an enigmatic new genus of Stratiomyidae from Fiji (Diptera)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new genus of Stratiomyidae, Vitilevumyia gen. nov. (type species, V. bobwoodleyi, sp. nov.) is described from the island of Viti Levu, Fiji. It exhibits an unusual combination of character states, but is tentatively placed in the tribe Prosopochrysini of the subfamily Stratiomyinae. ...

  3. Molecular signatures and phylogenomic analysis of the genus Burkholderia: proposal for division of this genus into the emended genus Burkholderia containing pathogenic organisms and a new genus Paraburkholderia gen. nov. harboring environmental species

    PubMed Central

    Sawana, Amandeep; Adeolu, Mobolaji; Gupta, Radhey S.

    2014-01-01

    The genus Burkholderia contains large number of diverse species which include many clinically important organisms, phytopathogens, as well as environmental species. However, currently, there is a paucity of biochemical or molecular characteristics which can reliably distinguish different groups of Burkholderia species. We report here the results of detailed phylogenetic and comparative genomic analyses of 45 sequenced species of the genus Burkholderia. In phylogenetic trees based upon concatenated sequences for 21 conserved proteins as well as 16S rRNA gene sequence based trees, members of the genus Burkholderia grouped into two major clades. Within these main clades a number of smaller clades including those corresponding to the clinically important Burkholderia cepacia complex (BCC) and the Burkholderia pseudomallei groups were also clearly distinguished. Our comparative analysis of protein sequences from Burkholderia spp. has identified 42 highly specific molecular markers in the form of conserved sequence indels (CSIs) that are uniquely found in a number of well-defined groups of Burkholderia spp. Six of these CSIs are specific for a group of Burkholderia spp. (referred to as Clade I in this work) which contains all clinically relevant members of the genus (viz. the BCC and the B. pseudomallei group) as well as the phytopathogenic Burkholderia spp. The second main clade (Clade II), which is composed of environmental Burkholderia species, is also distinguished by 2 identified CSIs that are specific for this group. Additionally, our work has also identified multiple CSIs that serve to clearly demarcate a number of smaller groups of Burkholderia spp. including 3 CSIs that are specific for the B. cepacia complex, 4 CSIs that are uniquely found in the B. pseudomallei group, 5 CSIs that are specific for the phytopathogenic Burkholderia spp. and 22 other CSI that distinguish two groups within Clade II. The described molecular markers provide highly specific means for

  4. Genus X. Lechevalieria Labeda, Hatano, Kroppenstedt and Tamura 2001, 1049vp

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The physiology, systematics and ecology of the species that currently compose the actinobacterial genus Lechevalieria is presented. The phylogenetic position of the taxa within this genus, including Lecehvalieria aerocolonigenes, Lechevalieria flava, Lechevalieria fradiae, and Lechevalieria xinjian...

  5. Tarphonomus, a new genus of ovenbird (Aves : Passeriformes : Furnariidae) from South America

    USGS Publications Warehouse

    Chesser, R.T.; Brumfield, R.T.

    2007-01-01

    Tarphonomus, a new genus of ovenbird (Aves: Passeriformes: Furnariidae) from South America, is described. Species included in the new genus, formerly placed in Upucerthia, are T. certhioides and T. harterti.

  6. Casuarinacola, a new genus of jumping plant lice (Hemiptera: Triozidae) from Casuarina (Casuarinaceae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new genus, Casuarinacola comprising four new species, namely C. equisetifoliae, C. acutialata, C. melanomaculata and C. warrigalensis, of jumping plant lice (Hemiptera: Triozidae), specific to the host genus Casuarina sensu stricto (Casuarinaceae) from Australia, are described. They are characteri...

  7. Genus VIII. Kibdelosporangium Shearer, Colman, Ferrin, Nisbet and Nash 1986, 48

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The morphology, physiology, systematics, ecology, and natural products of the species that currently compose the actinobacterial genus Kibdelosporangium is presented. The phylogenetic position of the taxa within this genus, including Kibdelosporangium aridum subsp. aridum, Kibdelosporangium aridum ...

  8. Description of two new species of the leafhopper genus Karachiota (Hemiptera: Cicadellidae: Typhlocybinae: Dikraneurini ) from China.

    PubMed

    Jiao, Meng

    2015-02-04

    Two new species of the dikraneurine leafhopper genus Karachiota Ahmed are reported from China: Karachiota recurva sp. nov. and Karachiota aristata sp. nov.. A key of all species of the genus is provided. 

  9. Genus Goodfellowiella (Labeda and Kroppenstedt 2006) Labeda, Kroppenstedt, Euzeby and Tindall 2008, 1048vp

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The physiology, systematics and ecology of the species that currently composes the actinobacterial genus Goodfellowiella is presented. The phylogenetic position of the lone species within this genus, Goodfellowiella coeruleoviolacea relative to the other genera within the family Pseudonocardinaea i...

  10. Insights into the genus Diaporthe: phylogenetic species delimitation in the D. eres species complex

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Diaporthe comprises pathogenic, endophytic and saprobic species with both temperate and tropical distributions. Cryptic diversification, phenotypic plasticity and extensive host associations have long complicated accurate identifications of species in this genus. The delimitation of the ge...

  11. First record of the genus Phradis Förster (Hymenoptera, Ichneumonidae, Tersilochinae) from the Neotropical Region

    PubMed Central

    Khalaim, Andrey I.; Bordera, Santiago

    2012-01-01

    Abstract One new species of the genus Phradis, Phradis peruvianus sp. n., from the mountainous part of Peruvian Amazonia, is described and illustrated. This is the first record of the genus from South America and the Neotropical region. PMID:22371684

  12. A review of the leafhopper genus Scaphotettix Matsumura (Hemiptera: Cicadellidae: Deltocephalinae), with description of a new genus.

    PubMed

    Dai, Wu; Viraktamath, C A; Zhang, Yalin; Webb, M D

    2009-09-01

    The leafhopper genus Scaphotettix Matsumura is redescribed, and three new species are described and Illustrated: S. striatus Dai and Zhang, sp. nov. from Java (on bamboo) and China; S. bispinosus Dai and Zhang, sp. nov from China; and S. pectinatus Dai and Zhang, sp. nov. from Vietnam. Most other species of Scaphotettix were re-examined and found to belong to a new genus also described herein, Scaphomonus Viraktamath, gen. nov.. The new genus is compared with the superficially similar Melanetettix Knight and Fletcher, Scaphodhara Viraktamath and Mohan, and Scaphoideus Uhler and a new species, Scaphomonus vateriae Viraktamath, sp. nov. from India, is described and Illustrated. In addition, the following new combinations are proposed (all previously placed in Scaphotettix): Scaphomonus agumbensis (Viraktamath and Mohan) comb, nov.; S. arcuatus (Viraktamath and Mohan) comb, nov.; S. freytagi (Viraktamath and Mohan) comb, nov.; S. indicus (Distant) comb, nov.; S. longistylus (Li and Wang) comb, nov.; S. mainadicus (Viraktamath and Mohan) comb, nov.; S. quadrifidus (Viraktamath and Mohan) comb, nov.; S. redundans (Distant) comb, nov.; and S. splinterus (Li and Wang) comb. nov. Three species, Scaphotettix fanjingensis Li and Wang, Scaphotettix redstripeus Li and Wang, and Scaphotettix sienderus Li and Wang, do not belong to the genus Scaphotettix and are not treated further. Keys are provided for species of both Scaphotettix and Scaphomonus.

  13. Description of Nanocthulhu lovecrafti, a preternatural new genus and species of Trichoplastini (Figitidae: Eucoilinae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new genus and species, Nanocthulhu lovecrafti, is described. This genus is characterized by having a fuscina along the dorsal margin of the clypeus. This three-pronged protrusion is unique within Hymenoptera. The genus is also characterized by the possession of a corniculum, and the shared poss...

  14. The tryphosine genus Cheirimedon in Australian waters (Crustacea, Amphipoda, Lysianassidae, Tryphosinae).

    PubMed

    Kilgallen, N M; Lowry, J K

    2015-09-11

    The genus Cheirimedon is reviewed and the monotypic genus Tryphosoides placed in its synonymy. We describe fourteen new species of Cheirimedon, all from Australian waters, bringing the total number of species in the genus to 22. Full synonymies and distribution data are provided for all taxa. A key to the world species is provided.

  15. Microarray-based Comparative Genomic Indexing of the Cronobacter genus (Enterobacter sakazakii)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Cronobacter is a recently defined genus synonymous with Enterobacter sakazakii. This new genus currently comprises 6 genomospecies. To extend our understanding of the genetic relationship between Cronobacter sakazakii BAA-894 and the other species of this genus, microarray-based comparative genomi...

  16. Mitochondrial DNA-based genetic diversity of genus Lygus (Hemiptera: Miridae) in North America

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Lygus is widely distributed in North American and Eurasian continents. It is the most-studied genus in the family Miridae. However, very less information on the genetic diversity of this genus is available. Studying genetic variation among Lygus pest species and thereby constructing a ...

  17. A new species of the genus Linoderus Sharp, 1885 (Coleoptera, Staphylinidae, Philonthina) from the Colombian Andes.

    PubMed

    López-García, Margarita M; Méndez-Rojas, Diana M

    2014-05-09

    The monotypic genus Linoderus Sharp, 1885 was described based on a species from Panama and since the original description nearly nothing has been added to its taxonomical knowledge. The aim of the present paper is to describe a new species of the genus from Colombia and to report the genus for the first time from South America, adding some biological notes of the species.

  18. Phytochemicals and biological studies of plants in genus Hedysarum

    PubMed Central

    2013-01-01

    In China, several species (Hedysarum polybotrys Hand.-Mazz., Hedysarum limprichtii Hlbr., Hedysarum vicioider Turcz. var. Taipeicum Hand.-Mazz. Liu, Hedysarum smithianum, et al.) of genus Hedysarum have a long history of use in traditional Chinese medicine (TCM). In TCM, these plants are used to increase the energy of the body. To date, 155 compounds, including flavonoids, triterpenes, coumarins, lignanoids, nitrogen compounds, sterols, carbohydrates, fatty compounds, and benzofuran, have been isolated from plants of the genus Hedysarum. Various chemical constituents contribute to the antioxidant, anti-tumor, anti-aging, anti-diabetic, and anti-hypertensive properties of these plants. Hedysarum species are used to treat infestation with gastrointestinal nematodes and may support the immune system and peripheral nervous system. In the present review, we summarize the research on the phytochemistry and pharmacology of Hedysarum species, which will be useful for better utilization of these important species in TCM. PMID:23866043

  19. Fungal genus Hypocrea/Trichoderma: from barcodes to biodiversity* §

    PubMed Central

    Kubicek, Christian P.; Komon-Zelazowska, Monika; Druzhinina, Irina S.

    2008-01-01

    Hypocrea/Trichoderma is a genus of soil-borne or wood-decaying fungi containing members important to mankind as producers of industrial enzymes and biocontrol agents against plant pathogens, but also as opportunistic pathogens of immunocompromised humans and animals, while others can cause damage to cultivated mushroom. With the recent advent of a reliable, BarCode-aided identification system for all known taxa of Trichoderma and Hypocrea, it became now possible to study some of the biological fundamentals of the diversity in this fungal genus in more detail. In this article, we will therefore review recent progress in (1) the understanding of the geographic distribution of individual taxa; (2) mechanisms of speciation leading to development of mushroom diseases and facultative human mycoses; and (3) the possible correlation of specific traits of secondary metabolism and molecular phylogeny. PMID:18837102

  20. Genomic encyclopedia of type strains of the genus Bifidobacterium.

    PubMed

    Milani, Christian; Lugli, Gabriele Andrea; Duranti, Sabrina; Turroni, Francesca; Bottacini, Francesca; Mangifesta, Marta; Sanchez, Borja; Viappiani, Alice; Mancabelli, Leonardo; Taminiau, Bernard; Delcenserie, Véronique; Barrangou, Rodolphe; Margolles, Abelardo; van Sinderen, Douwe; Ventura, Marco

    2014-10-01

    Bifidobacteria represent one of the dominant microbial groups that are present in the gut of various animals, being particularly prevalent during the suckling stage of life of humans and other mammals. However, the overall genome structure of this group of microorganisms remains largely unexplored. Here, we sequenced the genomes of 42 representative (sub)species across the Bifidobacterium genus and used this information to explore the overall genetic picture of this bacterial group. Furthermore, the genomic data described here were used to reconstruct the evolutionary development of the Bifidobacterium genus. This reconstruction suggests that its evolution was substantially influenced by genetic adaptations to obtain access to glycans, thereby representing a common and potent evolutionary force in shaping bifidobacterial genomes.

  1. A review of the cicada genus Kosemia Matsumura (Hemiptera: Cicadidae).

    PubMed

    Qi, Shengping; Hayashi, Masami; Wei, Cong

    2015-01-21

    The genus Kosemia Matsumura is reviewed based on investigation of the described species and the descriptions of two new species, Kosemia castanea sp. n. and Kosemia guanzhongensis sp. n., from Shaanxi Province, China. Two species formerly belonging to the genus Cicadetta Kolenati, C. chinensis (Distant) and C. mogannia (Distant), are transferred to Kosemia Matsumura to become K. chinensis (Distant), comb. n. and K. mogannia (Distant), comb. n.. The male of K. chinensis (Distant), comb. n. is discovered and described for the first time. Melampsalta bifuscata Liu, 1940 is recognized to be a junior synonym of K. chinensis. Leptopsalta rubicosta Chou & Lei, 1997 and Lycurgus sinensis Jacobi, 1944 are recognized to be junior synonyms of K. mogannia. Kosemia radiator (Uhler, 1896) is removed from the Chinese cicada fauna. A key to species of Kosemia is provided. 

  2. Anaerobic Metabolism in Haloferax Genus: Denitrification as Case of Study.

    PubMed

    Torregrosa-Crespo, J; Martínez-Espinosa, R M; Esclapez, J; Bautista, V; Pire, C; Camacho, M; Richardson, D J; Bonete, M J

    2016-01-01

    A number of species of Haloferax genus (halophilic archaea) are able to grow microaerobically or even anaerobically using different alternative electron acceptors such as fumarate, nitrate, chlorate, dimethyl sulphoxide, sulphide and/or trimethylamine. This metabolic capability is also shown by other species of the Halobacteriaceae and Haloferacaceae families (Archaea domain) and it has been mainly tested by physiological studies where cell growth is observed under anaerobic conditions in the presence of the mentioned compounds. This work summarises the main reported features on anaerobic metabolism in the Haloferax, one of the better described haloarchaeal genus with significant potential uses in biotechnology and bioremediation. Special attention has been paid to denitrification, also called nitrate respiration. This pathway has been studied so far from Haloferax mediterranei and Haloferax denitrificans mainly from biochemical point of view (purification and characterisation of the enzymes catalysing the two first reactions). However, gene expression and gene regulation is far from known at the time of writing this chapter.

  3. Genomic Encyclopedia of Type Strains of the Genus Bifidobacterium

    PubMed Central

    Milani, Christian; Lugli, Gabriele Andrea; Duranti, Sabrina; Turroni, Francesca; Bottacini, Francesca; Mangifesta, Marta; Sanchez, Borja; Viappiani, Alice; Mancabelli, Leonardo; Taminiau, Bernard; Delcenserie, Véronique; Barrangou, Rodolphe; Margolles, Abelardo; van Sinderen, Douwe

    2014-01-01

    Bifidobacteria represent one of the dominant microbial groups that are present in the gut of various animals, being particularly prevalent during the suckling stage of life of humans and other mammals. However, the overall genome structure of this group of microorganisms remains largely unexplored. Here, we sequenced the genomes of 42 representative (sub)species across the Bifidobacterium genus and used this information to explore the overall genetic picture of this bacterial group. Furthermore, the genomic data described here were used to reconstruct the evolutionary development of the Bifidobacterium genus. This reconstruction suggests that its evolution was substantially influenced by genetic adaptations to obtain access to glycans, thereby representing a common and potent evolutionary force in shaping bifidobacterial genomes. PMID:25085493

  4. Revision of the genus Hemisaprinus Kryzhanovskij, 1976 (Coleoptera, Histeridae, Saprininae)

    PubMed Central

    Lackner, Tomáš

    2014-01-01

    Abstract The monophyletic genus Hemisaprinus Kryzhanovskij in Kryzhanovskij & Reichardt, 1976 is revised herein. All three species Hemisaprinus subvirescens (Ménétries, 1832), H. lutshniki (Reichardt, 1941) and H. cyprius (Dahlgren, 1981) are found to be correctly assigned to the genus and their monophyly is supported by the synapomorphy of the presence of prosternal foveae. The three species are re-described and supplemented with colour photographs as well as SEM micrographs outlining their differences. Male genitalia drawing of H. subvirescens and H. lutshniki are provided and a key to the species is given. Hemisaprinus subvirescens (Ménétries, 1832) is newly reported from Armenia, Azerbaijan, Kyrgyzstan, Uzbekistan, Turkmenistan, Tajikistan, Jordan, Cyprus and Mongolia. The lectotypes and paralectotypes of the following species are designated herein: Saprinus foveisternus Schmidt, 1884, Saprinus syriacus Marseul, 1855 and Saprinus viridulus Marseul, 1855. PMID:25147473

  5. Nutrient partitioning and seedling development in the genus Leucaena

    SciTech Connect

    Dovel, R.L.

    1987-01-01

    Slow establishment of the genus Leucaena from seed has been attributed to law seedling vigor and late nodulation. Observation of early seedling growth indicated that partitioning of a large proportion of resources to the root of young Leucaena seedlings could account, in part, for the slow initial shoot growth observed in this genus. Therefore, a series of experiments were conducted to examine the partitioning of stored seed reserves, photosynthate, and nitrogen in developing Leucaena seedlings. The effects of nodulation and nitrogen fertilization on partitioning of nutrients in the seedling were also examined. Seed reserves were initially used for radicle growth in dark grown seedlings; however, partitioning soon shifted to the hypocotyl. By four days after imbibition, hypocotyl weight exceeded radicle weight in both species tested (L. leucocephala and L. retusa), at all temperatures above 20/sup 0/C. Two experiments were conducted examining the carbon partitioning of L. leucocephala cultivar K-8 using /sup 14/CO/sub 2/ pulse labeling techniques.

  6. Resemblance and divergence: the "new" members of the genus Bordetella.

    PubMed

    Gross, Roy; Keidel, Kristina; Schmitt, Karin

    2010-08-01

    Bordetella pertussis, the etiological agent of whooping cough, belongs to the bacterial pathogens first described in the so-called golden era of microbiology more than 100 years ago. In the course of the following decades, several other closely related pathogens were described which are nowadays classified in the genus Bordetella together with B. pertussis. These are the human and animal pathogens B. parapertussis, B. bronchiseptica and B. avium which are of high medical or veterinary interest, and which, together with B. pertussis, are referred to as the "classical" Bordetella species. Only in the past 15 years, several additional species were classified in the genus, frequently isolated from patients with underlying disease, animals or from the environment. Very little is known about most of these bacteria. In the present review, the current knowledge about these "new" Bordetella species is briefly summarized.

  7. Exploitation of genus Rhodosporidium for microbial lipid production.

    PubMed

    Xu, Jingyang; Liu, Dehua

    2017-03-01

    Oleaginous microorganisms are receiving significant attention worldwide for their utility in biodiesel production and the potentiality to produce some specialty-type lipids. There is an increasing interest in isolation/adaption of robust microbe strains and design of innovative fermentation processes to make microbial lipid production a more efficient and economically feasible bio-process. Currently, the genus Rhodosporidium has been considered an important candidate, for the reason that several strains belonging to this genus have shown excellent capabilities of lipid accumulation, broad adaptabilities to various substrates, and co-production of some carotenoids. This paper reviews the current trends in the exploitation of Rhodosporidium species for microbial lipid production, including the utilization of various (single or mixed, pure or waste-derived) substrates, progress of genetic modification and metabolic engineering, innovations in fermentation mode, lipid characterizations and their potential applications. Finally, the constraints and perspectives of cultivating Rhodosporidium species for lipid production are also discussed.

  8. [Adaptation of yeasts of the genus Debaryomyces to protocatechuic acid].

    PubMed

    Karasevich, Iu N

    1980-01-01

    Among five yeast strains belonging to the genus Debaryomyces that were unable of utilizing aromatic compounds (phenols and hydroxybenzoic acids), three strains, viz. D. kloeckeri BKM-Y-1044, D. marama BKM-Y-100 and D. marama BKM-Y-2045, were adapted to protocatechuic acid. The adapted yeasts utilized protocatechuic acid if its concentration in the medium was 0.1%, but did not utilize it, or did at a very low rate, if the concentration of protocatechuic acid was decreased to 0.05%. The mechanism of adaptation is rare mutations occurring in succession, and the process takes therefore several months. The adaptation seems to be based on reversion of inactivated genes for enzymes involved in the preparative metabolism of protocatechuic acid. Three typical yeast species of the Debaryomyces genus are proposed (D. hansenii, D. kloeckeri and D. konokotinae) which include all of the Debaryomyces species and strains available at the Institute of Microbiology of the USSR Academy of Sciences.

  9. What do we know by now about the genus Naegleria?

    PubMed

    De Jonckheere, Johan F

    2014-11-01

    In this short overview of the genus Naegleria a brief historical sketch is given since the discovery of this amoeboflagellate in 1899 and the finding in 1970 that one species, Naegleria fowleri causes primary amoebic meningoencephalitis in man. Eight different types of this pathogen are known which have an uneven distribution over the world. Until now 47 different Naegleria spp. are described, of which two other species cause disease in experimental animals, and their geographical dispersal is indicated. The presence of group I introns in the SSU and in the LSU rDNA in the genus is discussed, as well as the possibility of sex or mating. It is also mentioned that the genome of N. fowleri should not be compared to that of Naegleria gruberi, to know why the former is pathogenic, but to the genome of its closest relative Naegleria lovaniensis.

  10. Taxonomy of the genus Lycalopex (Carnivora: Canidae) in Argentina

    USGS Publications Warehouse

    Zunino, G.E.; Vaccaro, O.B.; Canevari, M.; Gardner, A.L.

    1995-01-01

    Previously treated as species of Pseudalopex, Argentine members of the genus Lycalopex (L. griseus, L. gymnocercus, and L. culpaeus) are examined to clarify the taxonomic status of each named form. Principal components analyses of 26 cranial measurements of 151 adult specimens and 11 pelage characters of 111 specimens, clearly distinguish L. culpaeus from the other two taxa. Lycalopex griseus and L. gymnocercus show clinal variation in cranial measurements and pelage characters. Qualitative cranial characters, used as diagnostic for L. griseus and L. gymnocercus, revealed great nongeographic variation. We conclude that L. griseus and L. gymnocercus are conspecific, and should be known as L. gymnocercus. Therefore, we recognize only two species of the genus Lycalopex (L. culpaeus and L. gymnocercus) in Argentina. We also use this opportunity to review synonymies of the recognized species of Lycalopex.

  11. Taxonomy of mayapple rust: the genus Allodus resurrected.

    PubMed

    Minnis, Andrew M; McTaggart, Alistair R; Rossman, Amy Y; Aime, M Catherine

    2012-01-01

    Mayapple rust is a common, disfiguring disease that is widespread in temperate eastern North America wherever the host, Podophyllum peltatum, occurs. Puccinia podophylli, the etiological agent of this rust, has been shown to be distantly related to both Puccinia and Uromyces as exemplified by their types. A systematic study was made to determine the generic classification of P. podophylli. Phylogenetic analyses of two rDNA loci from multiple specimens support the recognition of this taxon as a separate genus of Pucciniaceae. Based on historical literature and type material, P. podophylli was found to represent the type of the forgotten genus Allodus and it is correctly named Allodus podophylli. A neotype is designated for Puccinia podophylli Schwein. (≡ Allodus podophylli) and a lectotype is designated for Aecidium podophylli.

  12. A new genus of Neelidae (Collembola) from Mexican caves

    PubMed Central

    Papáč, Vladimír; Palacios-Vargas, José G.

    2016-01-01

    Abstract The new genus Spinaethorax, whose proposal is based on specimens of Megalothorax spinotricosus Palacios-Vargas & Sánchez, 1999, is given a new name combination and a redescription. The type species comes from two caves in Campeche State, México. A new combination is also suggested for Megalothorax tonoius Palacios-Vargas & Sánchez, 1999. The new genus is similar to Megalothorax Willem, 1900 and Neelus Folsom, 1896, but it clearly differs from all genera within family Neelidae by a peculiar combination of characters and the presence of some new features, e.g. globular sensillum on Ant. III, sword-like macrosetae on oral fold. A comparative table and an identification key for all Neelidae genera as well as some summary tables of antennae chaetotaxy and legs setation for type species are provided. PMID:27110149

  13. Distribution of beta-glucanases within the genus Bacillus.

    PubMed Central

    Martin, D F; Priest, F G; Todd, C; Goodfellow, M

    1980-01-01

    Representative strains (368) from 36 species in the genus Bacillus were screened for the secretion of beta-glucanases. (1 leads to 6)-beta-glucanases active on pustulan were produced by a minority of the organisms studied (4%), but (1 leads to 3)-beta-glucanases which hydrolyzed laminarin and pachyman were more widespread and were secreted by 56 and 44% of the strains, respectively. PMID:7458311

  14. A review of the genus Scaponopselaphus Scheerpeltz (Insecta: Coleoptera: Staphylinidae)

    PubMed Central

    2015-01-01

    Abstract Background The genus Scaponopselaphus Scheerpeltz was originally described to accommodate the species Trigonopselaphus mutator Sharp. New information In this paper, I review Scaponopselaphus and describe a new species from Colombia as Scaponopselaphus diaspartos n. sp. Illustrations are provided for the identification of specimens and the presence of spatulate setae on first mesotarsomere is shown to be a unique characteristic of Scaponopselaphus within Xanthopygina. PMID:25892923

  15. Phylogenetic species delimitation for crayfishes of the genus Pacifastacus

    PubMed Central

    Castelin, Magalie; Williams, Bronwyn W.; Olden, Julian D.; Abbott, Cathryn L.

    2016-01-01

    Molecular genetic approaches are playing an increasing role in conservation science by identifying biodiversity that may not be evident by morphology-based taxonomy and systematics. So-called cryptic species are particularly prevalent in freshwater environments, where isolation of dispersal-limited species, such as crayfishes, within dendritic river networks often gives rise to high intra- and inter-specific genetic divergence. We apply here a multi-gene molecular approach to investigate relationships among extant species of the crayfish genus Pacifastacus, representing the first comprehensive phylogenetic study of this taxonomic group. Importantly, Pacifastacus includes both the widely invasive signal crayfish Pacifastacus leniusculus, as well as several species of conservation concern like the Shasta crayfish Pacifastacus fortis. Our analysis used 83 individuals sampled across the four extant Pacifastacus species (omitting the extinct Pacifastacus nigrescens), representing the known taxonomic diversity and geographic distributions within this genus as comprehensively as possible. We reconstructed phylogenetic trees from mitochondrial (16S, COI) and nuclear genes (GAPDH), both separately and using a combined or concatenated dataset, and performed several species delimitation analyses (PTP, ABGD, GMYC) on the COI phylogeny to propose Primary Species Hypotheses (PSHs) within the genus. All phylogenies recovered the genus Pacifastacus as monophyletic, within which we identified a range of six to 21 PSHs; more abundant PSHs delimitations from GMYC and ABGD were always nested within PSHs delimited by the more conservative PTP method. Pacifastacus leniusculus included the majority of PSHs and was not monophyletic relative to the other Pacifastacus species considered. Several of these highly distinct P. leniusculus PSHs likely require urgent conservation attention. Our results identify research needs and conservation priorities for Pacifastacus crayfishes in western

  16. A revision of the spirit loaches, genus Lepidocephalus (Cypriniformes, Cobitidae).

    PubMed

    Deein, Gridsada; Tangjitjaroen, Weerapongse; Page, Lawrence M

    2014-03-17

    Lepidocephalus has been assumed to include only two species and confined to peninsular Malaysia and Indonesia. However, based on records and collections reported herein, the genus contains five species and is most common in the Chao Phraya basin of Thailand. Large rivers seem to be the preferred habitat, and difficulty in collecting these rivers may account for the paucity of specimens in collections. The known range of these five species includes western and southern Borneo, Java, Sumatra, peninsular Malaysia, and central Thailand.

  17. The oribatid mite genus Benoibates (Acari, Oribatida, Oripodidae)

    PubMed Central

    Ermilov, Sergey G.; Alvarado-Rodríguez, Olman; Kontschán, Jenő; Retana-Salazar, Axel P.

    2014-01-01

    Abstract Two species of oribatid mites of the genus Benoibates (Oribatida, Oripodidae), i.e., Benoibates bolivianus Balogh & Mahunka, 1969(a) and Benoibates minimus Mahunka, 1985, are recorded for the first time in Costa Rica. Both are redescribed in details, using drawings, images and SEM micrographs, on the basis of Costa Rican specimens. An identification key to the known species of Benoibates is given. PMID:25349489

  18. Uapaca genus (Euphorbiaceae), a good source of betulinic acid.

    PubMed

    Nyasse, Barthelemy; Nono, Jean-Jules; Nganso, Yves; Ngantchou, Igor; Schneider, Bernd

    2009-01-01

    Betulinic acid, isolated in substantial amounts from stem barks of five distinct species of Uapaca could be considered as an important chemotaxomic marker of the Uapaca genus. It inhibited Trypanosoma brucei GAPDH with an IC(50) value of 240 microM and has been shown to be a competitive reversible inhibitor (Ki=200+/-10 microM) of this enzyme with respect to its cofactor NAD(+).

  19. The diatom genus Actinocyclus in the Western United States

    USGS Publications Warehouse

    Bradbury, J. Platt; Krebs, William N.

    1995-01-01

    Ten new and four known taxa of the diatom genus Actinocyclus are described, illustrated, and (or) noted from middle Miocene lake deposits in the Western United States. A key is presented to help separate the taxa based on morphological criteria visible in the light microscope. The geologic ranges of Actinocyclus species in the Western United States are discussed based on examination of over 100 localities of diatomaceous lacustrine deposits.

  20. Revision of the genus Pseudeurybata Hennig (Diptera, Micropezidae, Taeniapterinae).

    PubMed

    Marshall, S A

    2016-06-29

    The previously monotypic genus Pseudeurybata Hennig is revised to include seven species from Central America and Mexico and one species from South America. Pseudeurybata rufilabris (Enderlein) and Pseudeurybata compeditus (Hennig) are given as new combinations and a lectotype is designated for P. rufilabris (Enderlein). Pseudeurybata browni and P. alces from Costa Rica, P. guatemalensis from Guatemala, P. dasypogon from Mexico, and P. zeta from Colombia and Ecuador are described as new. All species are keyed and illustrated.

  1. [The spread of nematodes from Toxocara genus in the world].

    PubMed

    Borecka, Anna

    2010-01-01

    Twenty seven species belong to the genus Toxocara. Most of the species infect Carnivora from families: Canidae, Felidae, Viverridae, Procyonidae, Mustelidae and Herpestidae. The most widespread species are: T. canis, T. cati and T. vitulorum. The life cycle of Toxocara spp. is connected with young animals and adults with the lowered immune response. Three of the Toxocara species: T. canis, T. cati and T. pteropodis are the aetiological agents of human toxocariasis.

  2. The genus Rhodosporidium: a potential source of beta-carotene.

    PubMed

    de Miguel, T; Calo, P; Díaz, A; Villa, T G

    1997-03-01

    Four wild-type species of the genus Rhodosporidium have been studied as as possible sources for the industrial production of beta-carotene. HPLC-based studies showed that their carotenoid composition consisted of almost pure beta-carotene at concentrations ranging from 226 to 685 micrograms/g of dried yeast biomass. These results are consistent with those obtained by spectrophotometry at 480 nm.

  3. Four New Species of the Genus Hemicriconemoides (Nematoda:Criconematidae)

    PubMed Central

    Pinochet, J.; Raski, D. J.

    1975-01-01

    Four new species of the genus Hemicriconemoides (H. californianus n.sp., H. taiwanensis n.sp., H. annulatus n. sp., and H. nitida n.sp.) are described. The range of total length of H. mangiferae is increased on the basis of specimens collected in Israel, Observations on H. mangiferae and H. litchi support the validity of H. litchi as distinct from H. mangiferae. PMID:19308169

  4. Essential Oil and Volatile Components of the Genus Hypericum (Hypericaceae)

    PubMed Central

    Crockett, Sara L.

    2010-01-01

    The flowering plant genus Hypericum (Hypericaceae) contains the well-known medicinally valuable species Hypericum perforatum (common St. John’s wort). Species of Hypericum contain many bioactive constituents, including proanthocyanins, flavonoids, biflavonoids, xanthones, phenylpropanes and naphthodianthrones that are characterized by their relative hydrophilicity, as well as acylphloroglucinols and essential oil components that are more hydrophobic in nature. A concise review of the scientific literature pertaining to constituents of Hypericum essential oils and volatile fractions is presented. PMID:20923012

  5. General occurrence of the glucosinolate glucocochlearin within the Cochlearia genus.

    PubMed

    Dauvergne, Xavier; Cérantola, Stéphane; Salaün, Stéphanie; Magné, Christian; Kervarec, Nelly; Bessières, Marie-Anne; Deslandes, Eric

    2006-09-04

    A natural compound, glucocochlearin, was isolated from the aerial parts of 10 different Cochlearia species. The purification of this compound was achieved through HPLC. The identity of the product was established mainly on the basis of spectroscopic NMR (1H, 13C, COSY, TOCSY, HMQC, HMBC, J-MOD) and high resolution mass spectroscopy data. This compound can be considered as a chemomarker of the genus Cochlearia.

  6. A new species of genus Nishada Moore, 1878 (Lepidoptera, Erebidae, Arctiinae) from India.

    PubMed

    Joshi, Rahul; Kirti, Jagbir S; Singh, Navneet

    2016-10-28

    Genus Nishada Moore (1878) was proposed as a monotypic genus, under subfamily Lithosiinae, family Lithosiidae (now Lithosiini), including only Nishada flabrifera Moore (1878) from Calcutta (now as Kolkata), India. The genus is distributed from China to India, Thailand, Malaysia and up to Australia. The Indian fauna of Nishada is reported from North-East Himalayas, West Bengal (Kolkata) and South India. Members of this genus are unmarked, yellow to brown with short and broad wings. Genus Nishada has been taxonomically dealt by many authors but awaits thorough revision.

  7. Phylogenetic placement and taxonomy of the genus Hederorkis (Orchidaceae).

    PubMed

    Mytnik-Ejsmont, Joanna; Szlachetko, Dariusz L; Baranow, Przemysław; Jolliffe, Kevin; Górniak, Marcin

    2015-01-01

    Three plastid regions, matK, rpl32-trnL and rpl16 intron and the ITS1-5.8S-ITS2 nuclear ribosomal DNA were used to demonstrate a phylogenetic placement of the genus Hederorkis (Orchidaceae) for the first time. The taxonomic position of this genus has been unclear thus far. The phylogenetic and morphological relations of Hederorkis to the most closely related genera Sirhookera, Adrorhizon, Bromheadia and Polystachya are also discussed. A hypothesis concerning an origin and evolution of Hederorkis is proposed. Hederorkis is an epiphytic two-leaved orchid genus with lateral inflorescence, non-resupinate flowers, elongate gynostemium and rudimentary column foot. It is native to the Indian Ocean Islands. Two species of Hederorkis are recognized worldwide, H. scandens endemic to Mauritius and Réunion and H. seychellensis endemic to Seychelles. For each of the species treated a full synonymy, detailed description and illustration are included. The distribution map and dichotomous keys to the species have also been provided.

  8. Phylogenetic Placement and Taxonomy of the Genus Hederorkis (Orchidaceae)

    PubMed Central

    Mytnik-Ejsmont, Joanna; Szlachetko, Dariusz L.; Baranow, Przemysław; Jolliffe, Kevin; Górniak, Marcin

    2015-01-01

    Three plastid regions, matK, rpl32-trnL and rpl16 intron and the ITS1-5.8S-ITS2 nuclear ribosomal DNA were used to demonstrate a phylogenetic placement of the genus Hederorkis (Orchidaceae) for the first time. The taxonomic position of this genus has been unclear thus far. The phylogenetic and morphological relations of Hederorkis to the most closely related genera Sirhookera, Adrorhizon, Bromheadia and Polystachya are also discussed. A hypothesis concerning an origin and evolution of Hederorkis is proposed. Hederorkis is an epiphytic two-leaved orchid genus with lateral inflorescence, non-resupinate flowers, elongate gynostemium and rudimentary column foot. It is native to the Indian Ocean Islands. Two species of Hederorkis are recognized worldwide, H. scandens endemic to Mauritius and Réunion and H. seychellensis endemic to Seychelles. For each of the species treated a full synonymy, detailed description and illustration are included. The distribution map and dichotomous keys to the species have also been provided. PMID:25902058

  9. Diversity and Evolution of Salt Tolerance in the Genus Vigna

    PubMed Central

    Iseki, Kohtaro; Takahashi, Yu; Muto, Chiaki; Naito, Ken; Tomooka, Norihiko

    2016-01-01

    Breeding salt tolerant plants is difficult without utilizing a diversity of wild crop relatives. Since the genus Vigna (family Fabaceae) is comprised of many wild relatives adapted to various environmental conditions, we evaluated the salt tolerance of 69 accessions of this genus, including that of wild and domesticated accessions originating from Asia, Africa, Oceania, and South America. We grew plants under 50 mM and 200 mM NaCl for two weeks and then measured the biomass, relative quantum yield of photosystem II, leaf Na+ concentrations, and leaf K+ concentrations. The accessions were clustered into four groups: the most tolerant, tolerant, moderately susceptible, and susceptible. From the most tolerant group, we selected six accessions, all of which were wild accessions adapted to coastal environments, as promising sources of salt tolerance because of their consistently high relative shoot biomass and relative quantum yield. Interestingly, variations in leaf Na+ concentration were observed between the accessions in the most tolerant group, suggesting different mechanisms were responsible for their salt tolerance. Phylogenetic analysis with nuclear DNA sequences revealed that salt tolerance had evolved independently at least four times in the genus Vigna, within a relatively short period. The findings suggested that simple genetic changes in a few genes might have greatly affected salt tolerances. The elucidation of genetic mechanisms of salt tolerances in the selected accessions may contribute to improving the poor salt tolerance in legume crops. PMID:27736995

  10. Ceratomyxa (Myxozoa: Bivalvulida): robust taxon or genus of convenience?

    PubMed

    Gunter, Nicole L; Whipps, Christopher M; Adlard, Robert D

    2009-10-01

    The genus Ceratomyxa (Myxozoa: Myxosporea: Bivalvulida) contains parasites that typically infect the gall bladders of marine teleosts. Species of this genus have also been recorded from elasmobranchs, while the best known species (Ceratomyxa shasta) is a systemic pathogen of fresh water salmonid fishes. Here we characterise 10 new species of Ceratomyxa from marine teleosts using morphometric and rDNA sequence data. A phylogeny of all Ceratomyxa species for which ssrDNA sequence is available was estimated by parsimony, maximum likelihood and Bayesian analyses. Mapping host fish taxonomy, geographic locality and morphology onto the phylogenetic tree provided some concordance of these characters to groups of Ceratomyxa species, but in no case was it consistent throughout the inferred phylogeny. The position of C. shasta as a sister species to the Ceratomyxa clade contradicts previous estimates of marine myxozoan phylogeny which suggested C. shasta was an unrelated lineage. Comparative DNA sequence data is available for more than 17% of some 200 described Ceratomyxa species and the genus now represents one of the most cohesive lineages within the Myxozoa. The independent branching of all atypical Ceratomyxa species and Palliatusindecorus, indicates a review of the diagnostic characters and possible division into more genera is warranted when further data are available.

  11. Genome structure and phylogeny in the genus Brucella.

    PubMed Central

    Michaux-Charachon, S; Bourg, G; Jumas-Bilak, E; Guigue-Talet, P; Allardet-Servent, A; O'Callaghan, D; Ramuz, M

    1997-01-01

    PacI and SpeI restriction maps were obtained for the two chromosomes of each of the six species of the genus Brucella: B. melitensis, B. abortus, B. suis, B. canis, B. ovis, and B. neotomae. Three complementary techniques were used: hybridization with the two replicons as probes, cross-hybridization of restriction fragments, and a new mapping method. For each type strain, a unique I-SceI site was introduced in each of the two replicons, and the location of SpeI sites was determined by linearization at the unique site, partial digestion, and end labeling of the fragments. The restriction and genetic maps of the six species were highly conserved. However, numerous small insertions or deletions, ranging from 1 to 34 kb, were observed by comparison with the map of the reference strain of the genus, B. melitensis 16M. A 21-kb Spel fragment specific to B. ovis was found in the small chromosome of this species. A 640-kb inversion was demonstrated in the B. abortus small chromosome. All of these data allowed the construction of a phylogenetic tree, which reflects the traditional phenetic classification of the genus. PMID:9150220

  12. A descriptive morphology of the ant genus Procryptocerus (Hymenoptera: Formicidae).

    PubMed

    Serna, F; Mackay, W

    2010-01-01

    Morphology is the most direct approach biologists have to recognize uniqueness of insect species as compared to close relatives. Ants of the genus Procryptocerus possess important morphologic characters yet have not been explored for use in a taxonomic revision. The genus is characterized by the protrusion of the clypeus forming a broad nasus and antennal scrobes over the eyes. The toruli are located right posterior to the flanks of the nasus opposite to each other. The vertex is deflexed posteriorly in most species. An in-group comparison of the external morphology is presented focusing on the workers. A general morphology for gynes and males is also presented. Previously mentioned characters as well as new ones are presented, and their character states in different species are clarified. For the metasoma a new system of ant metasomal somite nomenclature is presented that is applicable to Aculeata in general. Finally, a Glossary of morphological terms is offered for the genus (available online). Most of the terminology can be used in other members of the Formicidae and Aculeata.

  13. Molecular Systematics of the Phoxinin Genus Pteronotropis (Otophysi: Cypriniformes)

    PubMed Central

    Mayden, Richard L.; Allen, Jason S.

    2015-01-01

    The genus Pteronotropis is widely distributed along the gulf slope of eastern North America from Louisiana to Florida and rivers in South Carolina along the Atlantic slope. Pteronotropis have very distinctive, flamboyant coloration. The habitats most frequently associated with these species include heavily vegetated backwater bayous to small sluggish or flowing tannin-stained streams. Although Pteronotropis is recognized as a valid genus, no phylogenetic analysis of all the species has corroborated its monophyly. In recent years, four additional species have been either described or elevated from synonymy: P. merlini, P. grandipinnis, P. stonei, and P. metallicus, with the wide-ranging P. hypselopterus complex. To examine relationships within this genus and test its monophyly, phylogenetic analyses were conducted using two nuclear genes, recombination activating gene 1, RAG1, and the first intron of S7 ribosomal protein gene in both maximum parsimony and Bayesian analyses. In no analysis was Pteronotropis, as currently recognized, recovered as monophyletic without the inclusion of the currently recognized Notropis harperi, herein referred to as Pteronotropis. Two major clades are supported: one inclusive of P. hubbsi, P. welaka, and P. harperi and the second inclusive of P. signipinnis, P. grandipinnis, P. hypselopterus plus P. merlini sister to P. euryzonus, and P. metallicus plus P. stonei. PMID:26114103

  14. The Malassezia Genus in Skin and Systemic Diseases

    PubMed Central

    Magiatis, Prokopios; Hantschke, Markus; Bassukas, Ioannis D.; Velegraki, Aristea

    2012-01-01

    Summary: In the last 15 years, the genus Malassezia has been a topic of intense basic research on taxonomy, physiology, biochemistry, ecology, immunology, and metabolomics. Currently, the genus encompasses 14 species. The 1996 revision of the genus resulted in seven accepted taxa: M. furfur, M. pachydermatis, M. sympodialis, M. globosa, M. obtusa, M. restricta, and M. slooffiae. In the last decade, seven new taxa isolated from healthy and lesional human and animal skin have been accepted: M. dermatis, M. japonica, M. yamatoensis, M. nana, M. caprae, M. equina, and M. cuniculi. However, forthcoming multidisciplinary research is expected to show the etiopathological relationships between these new species and skin diseases. Hitherto, basic and clinical research has established etiological links between Malassezia yeasts, pityriasis versicolor, and sepsis of neonates and immunocompromised individuals. Their role in aggravating seborrheic dermatitis, dandruff, folliculitis, and onychomycosis, though often supported by histopathological evidence and favorable antifungal therapeutic outcomes, remains under investigation. A close association between skin and Malassezia IgE binding allergens in atopic eczema has been shown, while laboratory data support a role in psoriasis exacerbations. Finally, metabolomic research resulted in the proposal of a hypothesis on the contribution of Malassezia-synthesized aryl hydrocarbon receptor (AhR) ligands to basal cell carcinoma through UV radiation-induced carcinogenesis. PMID:22232373

  15. Phylogenomics and the Dynamic Genome Evolution of the Genus Streptococcus

    PubMed Central

    Richards, Vincent P.; Palmer, Sara R.; Pavinski Bitar, Paulina D.; Qin, Xiang; Weinstock, George M.; Highlander, Sarah K.; Town, Christopher D.; Burne, Robert A.; Stanhope, Michael J.

    2014-01-01

    The genus Streptococcus comprises important pathogens that have a severe impact on human health and are responsible for substantial economic losses to agriculture. Here, we utilize 46 Streptococcus genome sequences (44 species), including eight species sequenced here, to provide the first genomic level insight into the evolutionary history and genetic basis underlying the functional diversity of all major groups of this genus. Gene gain/loss analysis revealed a dynamic pattern of genome evolution characterized by an initial period of gene gain followed by a period of loss, as the major groups within the genus diversified. This was followed by a period of genome expansion associated with the origins of the present extant species. The pattern is concordant with an emerging view that genomes evolve through a dynamic process of expansion and streamlining. A large proportion of the pan-genome has experienced lateral gene transfer (LGT) with causative factors, such as relatedness and shared environment, operating over different evolutionary scales. Multiple gene ontology terms were significantly enriched for each group, and mapping terms onto the phylogeny showed that those corresponding to genes born on branches leading to the major groups represented approximately one-fifth of those enriched. Furthermore, despite the extensive LGT, several biochemical characteristics have been retained since group formation, suggesting genomic cohesiveness through time, and that these characteristics may be fundamental to each group. For example, proteolysis: mitis group; urea metabolism: salivarius group; carbohydrate metabolism: pyogenic group; and transcription regulation: bovis group. PMID:24625962

  16. Genome structure and phylogeny in the genus Brucella.

    PubMed

    Michaux-Charachon, S; Bourg, G; Jumas-Bilak, E; Guigue-Talet, P; Allardet-Servent, A; O'Callaghan, D; Ramuz, M

    1997-05-01

    PacI and SpeI restriction maps were obtained for the two chromosomes of each of the six species of the genus Brucella: B. melitensis, B. abortus, B. suis, B. canis, B. ovis, and B. neotomae. Three complementary techniques were used: hybridization with the two replicons as probes, cross-hybridization of restriction fragments, and a new mapping method. For each type strain, a unique I-SceI site was introduced in each of the two replicons, and the location of SpeI sites was determined by linearization at the unique site, partial digestion, and end labeling of the fragments. The restriction and genetic maps of the six species were highly conserved. However, numerous small insertions or deletions, ranging from 1 to 34 kb, were observed by comparison with the map of the reference strain of the genus, B. melitensis 16M. A 21-kb Spel fragment specific to B. ovis was found in the small chromosome of this species. A 640-kb inversion was demonstrated in the B. abortus small chromosome. All of these data allowed the construction of a phylogenetic tree, which reflects the traditional phenetic classification of the genus.

  17. Evolution of corallivory in the gastropod genus Drupella

    NASA Astrophysics Data System (ADS)

    Claremont, M.; Reid, D. G.; Williams, S. T.

    2011-12-01

    Although muricid gastropods in the genus Drupella are well-known consumers of Indo-Pacific corals, their evolutionary and ecological history is unclear, as is their relationship to the apparently facultative coral-feeder Ergalatax margariticola, which has been reported to feed upon corals in Hong Kong. We use a well resolved molecular phylogeny (reconstructed from one nuclear and two mitochondrial genes) to show that the monophyletic genus Drupella falls into the muricid subfamily Ergalataxinae and that the genus includes ` E. margariticola', which is composed of two cryptic species. We show that genetic structure within the here reassigned ` Drupella margariticola' species complex does not relate to feeding mode, but instead seems to correspond to broad patterns of habitat ecology found in other gastropod taxa. Our analyses suggest that Drupella originated in the late Miocene (approximately 9.6 Ma) and diversified approximately 5.0 Ma, much later than the appearance of modern coral reefs in the early Cenozoic. Thus, it is possible that corallivory in Drupella evolved in response to the major expansion and reorganization of reefs that took place in the early Miocene.

  18. Prion protein degradation by lichens of the genus Cladonia

    USGS Publications Warehouse

    Bennett, James P.; Rodriguez, Cynthia M.; Johnson, Christopher J.

    2012-01-01

    It has recently been discovered that lichens contain a serine protease capable of degrading the pathogenic prion protein, the etiological agent of prion diseases such as sheep scrapie and cervid chronic wasting disease. Limited methods are available to degrade or inactivate prion disease agents, especially in the environment, and lichens or their serine protease could prove important for management of these diseases. Scant information is available regarding the presence or absence of the protease responsible for degrading prion protein (PrP) in lichen species and, in this study, we tested the hypothesis that PrP degradation activity in lichens is phylogenetically-based by testing 44 species of Cladonia lichens, a genus for which a significant portion of the phylogeny is well established. We categorized PrP degradation activity among the 44 species (high, moderate, low or none) and found that activity in Cladonia species did not correspond with phylogenetic position of the species. Degradation of PrP did correspond, however, with three classical taxonomic characters within the genus: species with brown apothecia, no usnic acid, and the presence of a cortex. Of the 44 species studied, 18 (41%) had either high or moderate PrP degradation activity, suggesting the protease may be frequent in this genus of lichens.

  19. Taxonomy, Epidemiology, and Clinical Relevance of the Genus Arcobacter

    PubMed Central

    Collado, Luis; Figueras, Maria José

    2011-01-01

    Summary: The genus Arcobacter, defined almost 20 years ago from members of the genus Campylobacter, has become increasingly important because its members are being considered emergent enteropathogens and/or potential zoonotic agents. Over recent years information that is relevant for microbiologists, especially those working in the medical and veterinary fields and in the food safety sector, has accumulated. Recently, the genus has been enlarged with several new species. The complete genomes of Arcobacter butzleri and Arcobacter nitrofigilis are available, with the former revealing diverse pathways characteristic of free-living microbes and virulence genes homologous to those of Campylobacter. The first multilocus sequence typing analysis showed a great diversity of sequence types, with no association with specific hosts or geographical regions. Advances in detection and identification techniques, mostly based on molecular methods, have been made. These microbes have been associated with water outbreaks and with indicators of fecal pollution, with food products and water as the suspected routes of transmission. This review updates this knowledge and provides the most recent data on the taxonomy, species diversity, methods of detection, and identification of these microbes as well as on their virulence potential and implication in human and animal diseases. PMID:21233511

  20. Homology of Melanoma-Inducing Loci in the Genus Xiphophorus

    PubMed Central

    Schartl, M.

    1990-01-01

    Several species of the genus Xiphophorus are polymorphic for specific pigment patterns. Some of these give rise to malignant melanoma following the appropriate crossings. For one of these pattern loci from the platyfish Xiphophorus maculatus the melanoma-inducing gene has been cloned and found to encode a novel receptor tyrosine kinase, designated Xmrk. Using molecular probes from this gene in Southern blot analyses on single fish DNA preparations from 600 specimens of different populations of various species of the genus Xiphophorus and their hybrids, either with or without melanoma-predisposing pattern, it was shown that all individuals contain the Xmrk gene as a proto-oncogene. It is located on the sex chromosome. All fish that carry a melanoma-predisposing locus which has been identified by Mendelian genetics contain an additional copy of Xmrk, closely linked to a specific melanophore pattern locus on the sex chromosome. The melanoma-inducing loci of the different species and populations are homologous. The additional copy of Xmrk obviously arose by a gene-duplication event, thereby acquiring the oncogenic potential. The homology of the melanoma-inducing loci points to a similar mechanism of tumor suppression in all feral fish populations of the different species of the genus Xiphophorus. PMID:1981761

  1. Taxonomic revision of the genus Carasobarbus Karaman, 1971 (Actinopterygii, Cyprinidae)

    PubMed Central

    Borkenhagen, Kai; Krupp, Friedhelm

    2013-01-01

    Abstract Representatives of the fish genus Carasobarbus Karaman, 1971 (Actinopterygii: Cyprinidae) from the Middle East and North Africa were previously placed in 14 different genus-group taxa (Barbellion, Barbus, Barynotus, Capoeta, Carasobarbus, Cyclocheilichthys, Kosswigobarbus, Labeobarbus, Luciobarbus, Pseudotor, Puntius, Systomus, Tor and Varicorhinus). The generic assignment of several species changed frequently, necessitating a re-evaluation of their taxonomic status. In this study, the genus Carasobarbus is revised based on comparative morphological examinations of about 1300 preserved specimens from collections of several museums and freshly collected material. The species Carasobarbus apoensis, Carasobarbus canis, Carasobarbus chantrei, Carasobarbus exulatus, Carasobarbus fritschii, Carasobarbus harterti, Carasobarbus kosswigi, Carasobarbus luteus and Carasobarbus sublimus form a monophyletic group that shares the following combination of characters: medium-sized barbels with a smooth last unbranched dorsal-fin ray, nine or 10 branched dorsal-fin rays and six branched anal fin-rays; scales large, shield-shaped, with many parallel radii; the lateral line containing 25 to 39 scales; the pharyngeal teeth hooked, 2.3.5-5.3.2 or 2.3.4-4.3.2; one or two pairs of barbels. The species are described in detail, their taxonomic status is re-evaluated and an identification key is provided. A lectotype of Systomus luteus Heckel, 1843 is designated. Carasobarbus Karaman, 1971, Kosswigobarbus Karaman, 1971, and Pseudotor Karaman, 1971 are subjective synonyms, and acting as First Reviser we gave precedence to the name Carasobarbus. PMID:24146585

  2. A Descriptive Morphology of the Ant Genus Procryptocerus (Hymenoptera: Formicidae)

    PubMed Central

    Serna, F.; Mackay, W.

    2010-01-01

    Morphology is the most direct approach biologists have to recognize uniqueness of insect species as compared to close relatives. Ants of the genus Procryptocerus possess important morphologic characters yet have not been explored for use in a taxonomic revision. The genus is characterized by the protrusion of the clypeus forming a broad nasus and antennal scrobes over the eyes. The toruli are located right posterior to the flanks of the nasus opposite to each other. The vertex is deflexed posteriorly in most species. An in-group comparison of the external morphology is presented focusing on the workers. A general morphology for gynes and males is also presented. Previously mentioned characters as well as new ones are presented, and their character states in different species are clarified. For the metasoma a new system of ant metasomal somite nomenclature is presented that is applicable to Aculeata in general. Finally, a Glossary of morphological terms is offered for the genus (available online). Most of the terminology can be used in other members of the Formicidae and Aculeata. PMID:20874568

  3. Molecular characterisation of the species of the genus Zygosaccharomyces.

    PubMed

    Esteve-Zarzoso, Braulio; Zorman, Tina; Belloch, Carmela; Querol, Amparo

    2003-09-01

    The restriction fragments polymorphisms of the mitochondrial DNA and the PCR fragment that comprised the internal transcribes spacers and the 5.8S rRNA gene, together with the electrophoretic karyotypes of 40 strains from the 10 species of the genus Zygosaccharomyces, including the new species Z. lentus were examined. The RFLP's of the ITS-5.8S region showed a specific restriction pattern for each species, including the new species Z. lentus. The only exception were the species Z. cidri and Z. fermentati that produced identical restriction profiles. The electrophoretic chromosome patterns confirmed the differences between the species of this genus, including the phylogenetic closest species Z. cidri and Z. fermentati. They present few chromosomes ranging from 3 bands (4 or 5 chromosomes) for Z. florentinus to 7 bands (8 to 10 chromosomes) for Z. cidri and Z. fermentati. The strain level resolution power of RFLP's of mtDNA of this genus enabled the characterisation of strains from the same species, even where they are isolated from the same substrate. However, in the cases of Z. bailii and Z. lentus, electrophoretic karyotyping there was considerable variation.

  4. Biogeography and divergence times of genus Macroptilium (Leguminosae)

    PubMed Central

    Espert, Shirley M.; Burghardt, Alicia D.

    2010-01-01

    Background and aims Macroptilium is a herbaceous legume genus with 18 currently accepted species, seven of them with economic importance due to their use as forage, green fertilizer and in medicine. The genus is strictly American, with an unknown biogeographic history. The aim of this study was to infer a biogeographic pattern of Macroptilium and to estimate its divergence times, using sequences from the nuclear ribosomal DNA internal transcribed spacers. Methodology To study the historical biogeography of Macroptilium, two approaches were used: area optimization on a previously obtained phylogeny and a dispersal–vicariance analysis. Divergence times were calculated by Bayesian methods. Principal results The analyses revealed that Macroptilium has its origin in the middle Pliocene, with an estimated age that ranges from 2.9 to 4 million years. The biogeographic analyses placed its origin in South America, specifically on the Chaquean sub-region, where most of the cladogenetic events of the genus took place. Conclusions Macroptilium constitutes a further example of the geographic pattern displayed by numerous Neotropical taxa that moved north from South America to dominate the Central American lowlands after the land connection across the Isthmus of Panama was established. PMID:22476076

  5. Flavonoids as chemotaxonomic markers in the genus Drosera.

    PubMed

    Braunberger, Christina; Zehl, Martin; Conrad, Jürgen; Wawrosch, Christoph; Strohbach, Jaqueline; Beifuss, Uwe; Krenn, Liselotte

    2015-10-01

    The botanical classification of the huge genus Drosera remains controversial since long. In the present study, the pattern of major phenolic compounds in ten Drosera species belonging to seven different subgenera and/or sections of the genus was investigated for chemotaxonomic allocation. The composition of flavonoids and ellagic acid derivatives in Drosera adelae, Drosera burmannii, Drosera dielsiana, Drosera hilaris, Drosera montana, Drosera petiolaris, and Drosera pygmaea was elucidated for the first time. The scarce data on these compounds in Drosera binata, Drosera aliciae, and Drosera spatulata were complemented significantly. Detailed LC-DAD-MS, LC-NMR, and offline 1D and 2D NMR analyses resulted in the unambiguous identification of around 40 different substances, three of them (8-hydroxy-luteolin-8-O-arabinopyranoside, tricetin-7-O-xylopyranoside and 8-hydroxytricetin-8-O-arabinopyranoside) being natural products described for the first time. The distribution of the compounds characterized underlines their potential to serve as chemotaxonomic markers in this genus.

  6. Molecular Systematics of the Phoxinin Genus Pteronotropis (Otophysi: Cypriniformes).

    PubMed

    Mayden, Richard L; Allen, Jason S

    2015-01-01

    The genus Pteronotropis is widely distributed along the gulf slope of eastern North America from Louisiana to Florida and rivers in South Carolina along the Atlantic slope. Pteronotropis have very distinctive, flamboyant coloration. The habitats most frequently associated with these species include heavily vegetated backwater bayous to small sluggish or flowing tannin-stained streams. Although Pteronotropis is recognized as a valid genus, no phylogenetic analysis of all the species has corroborated its monophyly. In recent years, four additional species have been either described or elevated from synonymy: P. merlini, P. grandipinnis, P. stonei, and P. metallicus, with the wide-ranging P. hypselopterus complex. To examine relationships within this genus and test its monophyly, phylogenetic analyses were conducted using two nuclear genes, recombination activating gene 1, RAG1, and the first intron of S7 ribosomal protein gene in both maximum parsimony and Bayesian analyses. In no analysis was Pteronotropis, as currently recognized, recovered as monophyletic without the inclusion of the currently recognized Notropis harperi, herein referred to as Pteronotropis. Two major clades are supported: one inclusive of P. hubbsi, P. welaka, and P. harperi and the second inclusive of P. signipinnis, P. grandipinnis, P. hypselopterus plus P. merlini sister to P. euryzonus, and P. metallicus plus P. stonei.

  7. The Malassezia genus in skin and systemic diseases.

    PubMed

    Gaitanis, Georgios; Magiatis, Prokopios; Hantschke, Markus; Bassukas, Ioannis D; Velegraki, Aristea

    2012-01-01

    In the last 15 years, the genus Malassezia has been a topic of intense basic research on taxonomy, physiology, biochemistry, ecology, immunology, and metabolomics. Currently, the genus encompasses 14 species. The 1996 revision of the genus resulted in seven accepted taxa: M. furfur, M. pachydermatis, M. sympodialis, M. globosa, M. obtusa, M. restricta, and M. slooffiae. In the last decade, seven new taxa isolated from healthy and lesional human and animal skin have been accepted: M. dermatis, M. japonica, M. yamatoensis, M. nana, M. caprae, M. equina, and M. cuniculi. However, forthcoming multidisciplinary research is expected to show the etiopathological relationships between these new species and skin diseases. Hitherto, basic and clinical research has established etiological links between Malassezia yeasts, pityriasis versicolor, and sepsis of neonates and immunocompromised individuals. Their role in aggravating seborrheic dermatitis, dandruff, folliculitis, and onychomycosis, though often supported by histopathological evidence and favorable antifungal therapeutic outcomes, remains under investigation. A close association between skin and Malassezia IgE binding allergens in atopic eczema has been shown, while laboratory data support a role in psoriasis exacerbations. Finally, metabolomic research resulted in the proposal of a hypothesis on the contribution of Malassezia-synthesized aryl hydrocarbon receptor (AhR) ligands to basal cell carcinoma through UV radiation-induced carcinogenesis.

  8. Review of the Australian wolf spider genus Venator (Araneae, Lycosidae).

    PubMed

    Framenau, Volker W

    2015-09-11

    Species of the Australian wolf spider genus Venator are reviewed including the type species, V. spenceri Hogg, 1900, from south-eastern Australia and V. immansuetus (Simon, 1909) comb. nov., a common species in south-west Western Australia. Venator marginatus Hogg, 1900 is only known from two female specimens and the genital morphology of this species does not conform to the diagnosis of genus as presented here. Therefore V. marginatus is considered incerta sedis. Venator includes medium-sized (9.0-22 mm body length) wolf spiders of overall brownish colouration, and with a black patch covering the anterior three quarters of the venter. They differ from all other wolf spiders in particular by genitalic characters, namely an elevated atrium of the female epigyne that forms a raised edged against the inverted T-shaped median septum. This edge often corresponds to a retrolateral incision on the tegular apophysis of the male pedipalp. The genus is mainly a representative of the Bassian fauna of the Australian continent where it occurs predominantly in dry sclerophyll forests.

  9. New species of Cordana and epitypification of the genus.

    PubMed

    Hernández-Restrepo, Margarita; Gené, Josepa; Mena-Portales, Julio; Cano, Jose; Madrid, Hugo; Castañeda-Ruiz, Rafael F; Guarro, Josep

    2014-01-01

    Two interesting fungi belonging to the genus Cordana have been isolated recently in Spain from plant debris. Both are proposed here as new species, described and illustrated. Cordana mercadiana sp. nov. produces 0-1-septate conidia, with a prominent basal scar. Cordana verruculosa sp. nov. differs from the other species of the genus by its unique combination of aseptate, verruculose and small conidia. Both species are compared morphologically with other species of Cordana and their identities supported by the analysis of rDNA sequences. LSU sequence analysis revealed the congeneric relationship of Cordana and Pseudobotrytis; the members of both genera are in a well supported monophyletic lineage that appears to be related to the Coniochaetales but remains incertae sedis within the Sordariomycetes. To establish nomenclatural stability of the genus Cordana, an isolate of C. pauciseptata is designed here as epitype and the two species of Pseudobotrytis are transferred to Cordana. A dichotomous key is provided to identify the currently accepted species of Cordana.

  10. Review of the oriental leafhopper genus Lampridius (Hemiptera: Cicadellidae: Deltocephalinae), with description of a related new genus.

    PubMed

    Dai, Wu; Dietrich, Christopher H; Zhang, Yalin

    2011-05-01

    The leafhopper genus Lampridius Distant, 1918 (type species: L. spectabilis Distant, 1918 ) is redescribed, and a second species, L. cuspidatus sp. nov. (Thailand: Loei), is described. A related new genus Paralampridius gen. nov. and four new species are described: P. mimicus sp. nov. (China: Guangdong, Hainan), P. rotundatus sp. nov. (Thailand: Loei), P. sinuatus sp. nov. (Thailand: Loei, Suphanburi, Petchaburi), and P. truncatus sp. nov. (Thailand: Chaiyaphum, Ubon Ratchathani). Both genera are tentatively included in the tribe Opsiini, although only Lampridius has paired aedeagal shafts with separate gonopores. All six species are illustrated, and a key is provided for their identification. Problems with the current tribal classification are discussed in light of the present discovery of closely related species that show variation in characters previously assumed to be stable at the tribal level in the subfamily Deltocephalinae.

  11. A revision of the genus Antepione Packard with description of the new genus Pionenta Ferris (Lepidoptera, Geometridae, Ennominae).

    PubMed

    Ferris, Clifford D

    2010-12-14

    Based on genitalic studies, the new genus Pionenta is established for two taxa formerly placed under Antepione. The taxa hewesata and ochreata (and previously associated synonyms) are now synonomized as Pionenta ochreata. Three species of Antepione are now recognized: Antepione thisoaria, Antepione imitata, Antepione tiselaaria with the taxa comstocki, constans, and indiscretata synonomized under Antepione imitata. No new species are described. Adults and genitalia are illustrated, including type specimens.

  12. A revision of the genus Antepione Packard with description of the new genus Pionenta Ferris (Lepidoptera, Geometridae, Ennominae)

    PubMed Central

    Ferris, Clifford D.

    2010-01-01

    Abstract Based on genitalic studies, the new genus Pionenta is established for two taxa formerly placed under Antepione. The taxa hewesata and ochreata (and previously associated synonyms) are now synonomized as Pionenta ochreata. Three species of Antepione are now recognized: Antepione thisoaria, Antepione imitata, Antepione tiselaaria with the taxa comstocki, constans, and indiscretata synonomized under Antepione imitata. No new species are described. Adults and genitalia are illustrated, including type specimens. PMID:21594048

  13. Revisiting the taxonomy of the family Circoviridae: establishment of the genus Cyclovirus and removal of the genus Gyrovirus.

    PubMed

    Rosario, Karyna; Breitbart, Mya; Harrach, Balázs; Segalés, Joaquim; Delwart, Eric; Biagini, Philippe; Varsani, Arvind

    2017-02-02

    The family Circoviridae contains viruses with covalently closed, circular, single-stranded DNA (ssDNA) genomes, including the smallest known autonomously replicating, capsid-encoding animal pathogens. Members of this family are known to cause fatal diseases in birds and pigs and have been historically classified in one of two genera: Circovirus, which contains avian and porcine pathogens, and Gyrovirus, which includes a single species (Chicken anemia virus). However, over the course of the past six years, viral metagenomic approaches as well as degenerate PCR detection in unconventional hosts and environmental samples have elucidated a broader host range, including fish, a diversity of mammals, and invertebrates, for members of the family Circoviridae. Notably, these methods have uncovered a distinct group of viruses that are closely related to members of the genus Circovirus and comprise a new genus, Cyclovirus. The discovery of new viruses and a re-evaluation of genomic features that characterize members of the Circoviridae prompted a revision of the classification criteria used for this family of animal viruses. Here we provide details on an updated Circoviridae taxonomy ratified by the International Committee on the Taxonomy of Viruses in 2016, which establishes the genus Cyclovirus and reassigns the genus Gyrovirus to the family Anelloviridae, a separate lineage of animal viruses that also contains circular ssDNA genomes. In addition, we provide a new species demarcation threshold of 80% genome-wide pairwise identity for members of the family Circoviridae, based on pairwise identity distribution analysis, and list guidelines to distinguish between members of this family and other eukaryotic viruses with circular, ssDNA genomes.

  14. Genus delineation of Chlamydiales by analysis of the percentage of conserved proteins justifies the reunifying of the genera Chlamydia and Chlamydophila into one single genus Chlamydia.

    PubMed

    Pannekoek, Yvonne; Qi-Long, Qin; Zhang, Yu-Zhong; van der Ende, Arie

    2016-08-01

    Many studies have aimed to set up boundaries for the classification and definition of prokaryotic genus and species classification; however, studies that focused on genus-level genomic differences for existing taxonomy systems are limited. Recently, a novel method was described for prokaryotic genus delineation using the percentage of conserved proteins (POCP) between two strains to estimate their evolutionary and phenotypic distance (Qin et al. A proposed genus boundary for the prokaryotes based on genomic insights. J Bacteriol 2014; 196: :2210-5). Here, we extended the POCP analysis of the order Chlamydiales and pairwise compared all currently recognized species and candidate species of the family Chlamydiaceae as well as some species from other families. Using the taxonomy advised by the International Committee on Systematics of Prokaryotes, subcommittee on the taxonomy of the Chlamydiae, POCP analysis revealed that all pairwise comparisons of species from different families resulted in values lower than 50%, the proposed threshold for genus boundary. In contrast, all interspecies pairwise comparisons of species from the single genus within the family Chlamydiaceae resulted in POCP values higher than 70%. We conclude that the recommended genus classification of the family Chlamydiaceae is rational and that POCP analyses can provide a robust genomic index for the taxonomy of members of the order Chlamydiales in terms of genus demarcation.

  15. The genus Alterosa Blahnik, 2005 (Trichoptera, Philopotamidae, Philopotaminae) in northeastern Brazil, including the description of three new species and an identification key for the genus

    PubMed Central

    Dumas, Leandro Lourenço; Calor, Adolfo Ricardo; Nessimian, Jorge Luiz

    2013-01-01

    Abstract Alterosa Blahnik, 2005 contains 35 described species distributed in southern and southeastern Brazil. Three new species of Alterosa from northeastern Brazil are described and illustrated, Alterosa amadoi sp. n., Alterosa castroalvesi sp. n. and Alterosa caymmii sp. n., the first records of the genus from northeastern Brazil. An identification key for all known species of the genus is also presented. PMID:23950667

  16. Reinstatement of the genus Colopalpus Pritchard and Baker (1958) and re-description of Colopalpus matthyssei Pritchard and Baker (1958), the type species of this genus (Acari, Tenuipalpidae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Pritchard and Baker (1958) erected the genus Colopalpus with Tenuipalpus matthyssei (Pritchard and Baker) a species described from Laguna, The Philippines, as the type species. Meyer (1979) treated the genus as a junior synonym of Tenuipalpus Donnadieu. In this paper, we re-describe the female, male...

  17. Molecular phylogeny and evolution of the genus Neoerysiphe (Erysiphaceae, Ascomycota).

    PubMed

    Takamatsu, Susumu; Havrylenko, Maria; Wolcan, Silvia M; Matsuda, Sanae; Niinomi, Seiko

    2008-06-01

    The genus Neoerysiphe belongs to the tribe Golovinomyceteae of the Erysiphaceae together with the genera Arthrocladiella and Golovinomyces. This is a relatively small genus, comprising only six species, and having ca 300 species from six plant families as hosts. To investigate the molecular phylogeny and evolution of the genus, we determined the nucleotide sequences of the rDNA ITS regions and the divergent domains D1 and D2 of the 28S rDNA. The 30 ITS sequences from Neoerysiphe are divided into three monophyletic groups that are represented by their host families. Groups 1 and 3 consist of N. galeopsidis from Lamiaceae and N. galii from Rubiaceae, respectively, and the genetic diversity within each group is extremely low. Group 2 is represented by N. cumminsiana from Asteraceae. This group also includes Oidium baccharidis, O. maquii, and Oidium spp. from Galinsoga (Asteraceae) and Aloysia (Verbenaceae), and is further divided into four subgroups. N. galeopsidis is distributed worldwide, but is especially common in western Eurasia from Central Asia to Europe. N. galii is also common in western Eurasia. In contrast, the specimens of group 2 were all collected in the New World, except for one specimen that was collected in Japan; this may indicate a close relationship of group 2 with the New World. Molecular clock calibration demonstrated that Neoerysiphe split from other genera of the Erysiphaceae ca 35-45M years ago (Mya), and that the three groups of Neoerysiphe diverged between 10 and 15Mya, in the Miocene. Aloysia citriodora is a new host for the Erysiphaceae and the fungus on this plant is described as O. aloysiae sp. nov.

  18. Evolutionary Roots and Diversification of the Genus Aeromonas

    PubMed Central

    Sanglas, Ariadna; Albarral, Vicenta; Farfán, Maribel; Lorén, J. G.; Fusté, M. C.

    2017-01-01

    Despite the importance of diversification rates in the study of prokaryote evolution, they have not been quantitatively assessed for the majority of microorganism taxa. The investigation of evolutionary patterns in prokaryotes constitutes a challenge due to a very scarce fossil record, limited morphological differentiation and frequently complex taxonomic relationships, which make even species recognition difficult. Although the speciation models and speciation rates in eukaryotes have traditionally been established by analyzing the fossil record data, this is frequently incomplete, and not always available. More recently, several methods based on molecular sequence data have been developed to estimate speciation and extinction rates from phylogenies reconstructed from contemporary taxa. In this work, we determined the divergence time and temporal diversification of the genus Aeromonas by applying these methods widely used with eukaryotic taxa. Our analysis involved 150 Aeromonas strains using the concatenated sequences of two housekeeping genes (approximately 2,000 bp). Dating and diversification model analyses were performed using two different approaches: obtaining the consensus sequence from the concatenated sequences corresponding to all the strains belonging to the same species, or generating the species tree from multiple alignments of each gene. We used BEAST to perform a Bayesian analysis to estimate both the phylogeny and the divergence times. A global molecular clock cannot be assumed for any gene. From the chronograms obtained, we carried out a diversification analysis using several approaches. The results suggest that the genus Aeromonas began to diverge approximately 250 millions of years (Ma) ago. All methods used to determine Aeromonas diversification gave similar results, suggesting that the speciation process in this bacterial genus followed a rate-constant (Yule) diversification model, although there is a small probability that a slight

  19. On the genus Cosmopelma Simon, 1889 (Araneae, Barychelidae).

    PubMed

    Mori, Andre; Bertani, Rogerio

    2016-07-13

    Among neotropical mygalomorph spider families, Barychelidae is one of the most neglected in taxonomic studies. Most genera have never been revised and only the original descriptions are available. Herein, one of these more obscure genera, Cosmopelma Simon, 1892, with two described species in Brazil and Venezuela, is revised. The type species C. decoratum Simon, 1889 is redescribed, and the male is described for first time. A new species, C. ceplac sp. nov., is described, and new occurrences are presented. Additionally, C. dentatum Fischel, 1927, whose holotype is lost, is considered a nomen dubium. Cosmopelma is an endemic genus, known only from the state of Bahia in northeastern Brazil.

  20. Chemotaxonomy of mints of genus Mentha by applying Raman spectroscopy.

    PubMed

    Rösch, P; Kiefer, W; Popp, J

    2002-01-01

    The characterization of mints is often problematic because Mentha is a taxonomically complex genus. In order to provide a fast and easy characterization method, we use a combination of micro-Raman spectroscopy and hierarchical cluster analysis. A classification trial of different mint taxa is possible for one collection time. For spectra measured at different points during the growing season, a more sophisticated pretreatment of the data is necessary to receive good discrimination between the species, as well as between the subspecies and varieties of the mints.

  1. A new genus to accommodate Gymnopus acervatus (Agaricales).

    PubMed

    Hughes, Karen W; Mather, David A; Petersen, Ronald H

    2010-01-01

    Phylogenies based on ITS and LSU nrDNA sequences show Agaricus (Gymnopus) acervatus as unique within the Gymnopus/Rhodocollybia complex. These phylogenies imply that a separate genus is necessary, and Connopus is proposed. Infraspecific morphological and DNA-based variation within C. acervatus suggests that a western North American clade might be reproductively isolated from the eastern North American/Scandinavian clade and that in this species complex the European and eastern North American clade might be conspecific. A Scandinavian exemplar is selected for bar-coding. Two GenBank sequences with name-phylogenetic placement inconsistencies are identified.

  2. A third species of Polyspatha, an Africanendemic genus of Commelinaceae

    PubMed Central

    Faden, Robert B.

    2011-01-01

    Abstract Polyspatha oligospatha Faden, the third species in a small African endemic genus of Commelinaceae, is described. It is widespread but has been overlooked because of its small stature and resemblance to small plants of Polyspatha paniculata. It differs from both Polyspatha paniculata and Polyspatha hirsuta, the two other species, by its leaf pubescence, fewer, more widely spaced and usually patent spathes, deeply ridged seeds with numerous knobby, transversely interrupted ridges, and morning anthesis. It occurs throughout the Congolian forests from Cameroon to Uganda, but it is also disjunct in Ivory Coast, across the Dahomey gap. PMID:22171175

  3. [Bioactive secondary metabolites produced by plants of the genus Physalis].

    PubMed

    Agata, Karolina; Kusiak, Joanna; Stępień, Bartłomiej; Bergier, Katarzyna; Kuźniak, Elżbieta

    2010-12-30

    Plants from the genus Physalis L. (family Solanaceae), native to warm and subtropical regions of Central and South America, are particularly rich in secondary metabolites, e.g.: withanolides, physalins, calystegines, tropane and nortropane alkaloids. Due to the high biological activities of these compounds, in the tropics Physalis plants have been used for centuries as medicinal herbs in the treatment of urinary and skin diseases, gonorrhea, ulcers, sores and as a vermicidal drug. This review describes the main categories of secondary metabolites, their distribution, chemistry, biosynthesis as well as biological activities. Particular attention is given to their potent anticancer activities.

  4. Revision of the genus Trypogeus Lacordaire, 1869 (Cerambycidae, Dorcasominae)

    PubMed Central

    Vives, Eduard

    2015-01-01

    Abstract The ten species of the genus Trypogeus Lacordaire are revised. Trypogeus apicalis Fisher, 1936, is proposed as a new synonym of Trypogeus javanicus Aurivillius, 1925. A neotype for Trypogeus sericeus (Gressitt, 1951) and lectotypes for Toxotus fuscus Nonfried, 1894 and Trypogeus javanicus are designated. Trypogeus fuscus auct. nec Nonfried is a misidentification of Philus ophthalmicus Pascoe. All the species are described and keys are given for distinguishing the species. Photographs of the types of all the Trypogeus species are published for the first time. PMID:26019663

  5. Bioactivities from Marine Algae of the Genus Gracilaria

    PubMed Central

    de Almeida, Cynthia Layse F.; Falcão, Heloina de S.; Lima, Gedson R. de M.; Montenegro, Camila de A.; Lira, Narlize S.; de Athayde-Filho, Petrônio F.; Rodrigues, Luis C.; de Souza, Maria de Fátima V.; Barbosa-Filho, José M.; Batista, Leônia M.

    2011-01-01

    Seaweeds are an important source of bioactive metabolites for the pharmaceutical industry in drug development. Many of these compounds are used to treat diseases like cancer, acquired immune-deficiency syndrome (AIDS), inflammation, pain, arthritis, as well as viral, bacterial, and fungal infections. This paper offers a survey of the literature for Gracilaria algae extracts with biological activity, and identifies avenues for future research. Nineteen species of this genus that were tested for antibacterial, antiviral, antifungal, antihypertensive, cytotoxic, spermicidal, embriotoxic, and anti-inflammatory activities are cited from the 121 references consulted. PMID:21845096

  6. The Genus Phyllanthus: An Ethnopharmacological, Phytochemical, and Pharmacological Review

    PubMed Central

    Mao, Xin; Wu, Ling-Fang; Guo, Hong-Ling; Chen, Wen-Jing; Cui, Ya-Ping; Qi, Qi; Li, Shi; Liang, Wen-Yi; Yang, Guang-Hui; Shao, Yan-Yan; Zhu, Dan; She, Gai-Mei; You, Yun; Zhang, Lan-Zhen

    2016-01-01

    The plants of the genus Phyllanthus (Euphorbiaceae) have been used as traditional medicinal materials for a long time in China, India, Brazil, and the Southeast Asian countries. They can be used for the treatment of digestive disease, jaundice, and renal calculus. This review discusses the ethnopharmacological, phytochemical, and pharmacological studies of Phyllanthus over the past few decades. More than 510 compounds have been isolated, the majority of which are lignins, triterpenoids, flavonoids, and tannins. The researches of their remarkable antiviral, antioxidant, antidiabetic, and anticancer activities have become hot topics. More pharmacological screenings and phytochemical investigations are required to support the traditional uses and develop leading compounds. PMID:27200104

  7. Characteristic gamma-lactone odor production of the genus Pityrosporum.

    PubMed Central

    Labows, J N; McGinley, K J; Leyden, J J; Webster, G F

    1979-01-01

    Mass spectrometric-gas chromatographic analysis of culture headspaces revealed that members of the genous Pityrosporum produce volatile gamma-lactones during growth on lipid-containing media. Representative members of other yeast genera found on humans failed to produce these compounds. Addition of lecithin, oleic acids, triolein, or human sebum to the culture media stimulated gamma-lactone production by Pityrosporum species. All yeasts tested produced isopentanol and phenylethanol. Production of gamma-lactones may serve as a valuable characteristic in the identification of organisms of the genus Pityrosporum. PMID:533274

  8. Two new species of Acervus (Pezizales) with a key to species of the genus.

    PubMed

    Zhuang, Wen-Ying; Luo, Jing; Zhao, Peng

    2011-01-01

    Studies on the genus Acervus from China are reviewed briefly. Six of the seven known species of the genus are currently recorded in this country. Acervus beijingense and A. changchunense are described as new based on morphological features and molecular data, and A. flavidus with minor emendation is added to the Chinese fungus flora. Phylogenetic relationships among four of the seven species of the genus are investigated based on the 28S rDNA sequence analysis. Species of the genus formed a single clade with high bootstrap support. The sequences of A. epispartius forma epispartius and that of A. flavidus obtained from materials in different geographical regions together formed a group with 100% bootstrap support. Ascospore size and shape are important criteria in the taxonomy of the genus and are phylogenetically informative. A dichotomous key to all described species of the genus is provided.

  9. Systematics of the seed beetle genus Decellebruchus Borowiec, 1987 (Coleoptera, Bruchidae).

    PubMed

    Nápoles, Jesús Romero

    2016-01-01

    Keys to species, descriptions, synonymy, host plants, and geographical distributions are presented for the three species in the genus Decellebruchus (Borowiec 1987); of those, Decellebruchus walker (Pic 1912) was the only species included at the time of the genus denomination, Decellebruchus atrolineatus (Pic 1921) is transferred to this genus, and Decellebruchus lunae is described as a new species. The shortest and most parsimonious phylogenetic tree for genera with pectinate antennae had a length of 33, consistency index 87, and retention index 81.

  10. Terpenes from the soft corals of the genus Sarcophyton: chemistry and biological activities.

    PubMed

    Liang, Lin-Fu; Guo, Yue-Wei

    2013-12-01

    This review covers structural diversity and biological activities of terpenes from soft corals of the genus of Sarcophyton, reported from 1995 to July, 2011. During this period, besides undefined species, 16 species of the genus Sarcophyton, from different geographical areas, had been chemically examined. Two hundred and five terpenes had been isolated from this genus, including eleven sesquiterpenes, 165 diterpenes, 29 biscembranoids, some of which had novel skeletons. They exhibited various biological features, such as antifeedant, anti-inflammatory, antiviral, and antifouling activities.

  11. A new genus and species of freshwater crab from Madagascar (Decapoda, Brachyura, Potamoidea, Potamonautidae).

    PubMed

    Meyer, Kirstin S; Cumberlidge, Neil; Koppin, Jennifer C

    2014-11-12

    A new genus and species of freshwater crab is described from Madagascar. The new species is morphologically closest to the three species of the genus Foza Reed & Cumberlidge, 2006, but can easily be distinguished by having a completely smooth carapace with an unarmed anterolateral margin and a mandible with a distinctly shortened anterior lobe. This unusual suite of characters is sufficient to warrant the recognition of a new monotypic genus to accommodate this species.

  12. A new genus and new species of family Antedonidae (Echinodermata: Crinoidea) from southern Japan.

    PubMed

    Obuchi, Masami; Omori, Akihito

    2015-06-12

    A new genus and new species of antedonid comatulid is described from southern Japan. Belonometra n. gen. has a unique appearance with ten long arms, numerous cirri, and remarkably long and crowded pinnules. The new genus shares some characters with subfamily Heliometrinae. However, the comparative length of pinnules, which is a diagnostic character to determine subfamily Antedonidae, is different. The subfamily into which the new genus should be placed is unclear.

  13. Synopsis of the Argentinian scarab genus Pseudogeniates Ohaus (Coleoptera, Scarabaeidae, Rutelinae)

    PubMed Central

    Jameson, Mary Liz; Ocampo, Federico

    2012-01-01

    Abstract The scarab beetle genus Pseudogeniates Ohaus (Scarabaeidae: Rutelinae: Rutelini) is endemic to Argentina. The genus includes three species: Pseudogeniates cordobaensis Soula, Pseudogeniates intermedius Ohaus, and Pseudogeniates richterianus Ohaus. We characterize the genus, provide a key to species, redescribe and diagnose each species, provide spatial and temporal distributions, and discuss distributions of the species in relation to eco-regions and areas of endemism in Argentina. PMID:23372412

  14. Synopsis of the Argentinian scarab genus Pseudogeniates Ohaus (Coleoptera, Scarabaeidae, Rutelinae).

    PubMed

    Jameson, Mary Liz; Ocampo, Federico

    2012-01-01

    The scarab beetle genus Pseudogeniates Ohaus (Scarabaeidae: Rutelinae: Rutelini) is endemic to Argentina. The genus includes three species: Pseudogeniates cordobaensis Soula, Pseudogeniates intermedius Ohaus, and Pseudogeniates richterianus Ohaus. We characterize the genus, provide a key to species, redescribe and diagnose each species, provide spatial and temporal distributions, and discuss distributions of the species in relation to eco-regions and areas of endemism in Argentina.

  15. Re-establishment of the genus Ania Lindl. (Orchidaceae).

    PubMed

    Li, Lin; Yan, Hai-Fei; Niu, Miao; Tu, Tie-Yao; Li, Shi-Jin; Xing, Fu-Wu

    2014-01-01

    Ania Lindl. is a small genus of the tribe Collabieae subtribe Collabiinae (Orchidaceae). For the last 150 years, it has generally been treated as a synonym of Tainia Blume. In this study, we critically re-examined morphological characters that have been used to distinguish Ania from Tainia, and assessed the phylogeny of Tainia using morphological and palynological characters. Sequences of the nuclear ribosomal ITS, chloroplast trnL intron and combined DNA data sets were analysed to clarify the delimitation and the phylogeny of these groups. The morphological and palynological survey revealed a number of useful diagnostic characters which permit a clear definition of Ania, after the exclusion of a single taxonomically questionable species. Results confirmed that Ania is distinct from Tainia. Phylogenetic reconstructions based on molecular data provided the greatest resolution and produced a morphologically well differentiated clade of Ania. In addition to morphological and suggested palynological characters, the phylogenies were also supported by karyological evidence. Our results support the independent generic status of Ania. The genus name Ania is revived and re-established.

  16. Re-Establishment of the Genus Ania Lindl. (Orchidaceae)

    PubMed Central

    Li, Lin; Yan, Hai-Fei; Niu, Miao; Tu, Tie-Yao; Li, Shi-Jin; Xing, Fu-Wu

    2014-01-01

    Ania Lindl. is a small genus of the tribe Collabieae subtribe Collabiinae (Orchidaceae). For the last 150 years, it has generally been treated as a synonym of Tainia Blume. In this study, we critically re-examined morphological characters that have been used to distinguish Ania from Tainia, and assessed the phylogeny of Tainia using morphological and palynological characters. Sequences of the nuclear ribosomal ITS, chloroplast trnL intron and combined DNA data sets were analysed to clarify the delimitation and the phylogeny of these groups. The morphological and palynological survey revealed a number of useful diagnostic characters which permit a clear definition of Ania, after the exclusion of a single taxonomically questionable species. Results confirmed that Ania is distinct from Tainia. Phylogenetic reconstructions based on molecular data provided the greatest resolution and produced a morphologically well differentiated clade of Ania. In addition to morphological and suggested palynological characters, the phylogenies were also supported by karyological evidence. Our results support the independent generic status of Ania. The genus name Ania is revived and re-established. PMID:25047255

  17. Molecular species delimitation in the genus Eumerus (Diptera: Syrphidae).

    PubMed

    Chroni, A; Djan, M; Vidaković, D Obreht; Petanidou, T; Vujić, A

    2017-02-01

    Eumerus is one of the most diverse genera of hoverfly worldwide. Species delimitation within genus is considered to be difficult due to: (a) lack of an efficient key; (b) non-defined taxonomical status of a large number of species; and (c) blurred nomenclature. Here, we present the first molecular study to delimit species of the genus by using a fragment of the mitochondrial cytochrome-c oxidase subunit I gene (COI) gene. We assessed 75 specimens assigned to 28 taxa originating from two biogeographic zones: 22 from the western Palaearctic and six from the Afrotropical region. Two datasets were generated based on different sequence lengths to explore the significance of availability of more polymorphic sites for species delimitation; dataset A with a total length of 647 bp and dataset B with 746 bp. Various tree inference approaches and Poisson tree processes models were applied to evaluate the putative 'taxonomical' vs. 'molecular' taxa clusters. All analyses resulted in high taxonomic resolution and clear species delimitation for both the dataset lengths. Furthermore, we revealed a high number of mitochondrial haplotypes and high intraspecific variability. We report two major monophyletic clades, and seven 'molecular' groups of taxa formed, which are congruent with morphology-based taxonomy. Our results support the use of the mitochondrial COI gene in species diagnosis of Eumerus.

  18. A Revision of the Neotropical Caddisfly Genus Rhyacopsyche (Trichoptera: Hydroptilidae)

    NASA Astrophysics Data System (ADS)

    Wasmund, A. M.; Holzenthal, R. W.

    2005-05-01

    The Neotropical genus Rhyacopsyche, Müller 1879, was last reviewed in 1971 when 5 species were known. Since that time, the genus has gradually grown to 13 species. Recent material collected throughout South America has uncovered at least 22 new species. Taxonomic knowledge of the caddisflies of this region is not only useful for understanding local aquatic ecosystems, but essential in establishing biomonitoring programs. Hydroptilids, or microcaddisflies, are among the smallest Trichoptera and are therefore often unintentionally ignored in collection surveys. Relatively little is known of Rhyacopsyche. Larvae construct silken cases, sometimes using sand particles, and attach themselves to the side of rocks by silken threads which are at least as long as the case, and sometimes twice as long. The attached final-instar larvae float freely, either singly or in clusters, in fast flowing water. Identification is dependent on male genitalia and is facilitated by standard genitalic preparations for Trichoptera. Detailed illustrations have been produced for all species as well as diagnoses, descriptions and a taxonomic key. A preliminary assignment of newly described species to three currently recognized groups is proposed.

  19. Phylogeny, identification and nomenclature of the genus Aspergillus

    PubMed Central

    Samson, R.A.; Visagie, C.M.; Houbraken, J.; Hong, S.-B.; Hubka, V.; Klaassen, C.H.W.; Perrone, G.; Seifert, K.A.; Susca, A.; Tanney, J.B.; Varga, J.; Kocsubé, S.; Szigeti, G.; Yaguchi, T.; Frisvad, J.C.

    2014-01-01

    Aspergillus comprises a diverse group of species based on morphological, physiological and phylogenetic characters, which significantly impact biotechnology, food production, indoor environments and human health. Aspergillus was traditionally associated with nine teleomorph genera, but phylogenetic data suggest that together with genera such as Polypaecilum, Phialosimplex, Dichotomomyces and Cristaspora, Aspergillus forms a monophyletic clade closely related to Penicillium. Changes in the International Code of Nomenclature for algae, fungi and plants resulted in the move to one name per species, meaning that a decision had to be made whether to keep Aspergillus as one big genus or to split it into several smaller genera. The International Commission of Penicillium and Aspergillus decided to keep Aspergillus instead of using smaller genera. In this paper, we present the arguments for this decision. We introduce new combinations for accepted species presently lacking an Aspergillus name and provide an updated accepted species list for the genus, now containing 339 species. To add to the scientific value of the list, we include information about living ex-type culture collection numbers and GenBank accession numbers for available representative ITS, calmodulin, β-tubulin and RPB2 sequences. In addition, we recommend a standard working technique for Aspergillus and propose calmodulin as a secondary identification marker. PMID:25492982

  20. Diversification and reticulation in the circumboreal fern genus Cryptogramma.

    PubMed

    Metzgar, Jordan S; Alverson, Edward R; Chen, Sinian; Vaganov, Alexey V; Ickert-Bond, Stefanie M

    2013-06-01

    We investigated the evolutionary complexity that resulted from cryptic diversification and polyploidy in parsley ferns (Cryptogramma). A total of 14 species were included in our data set, with six outgroup species and eight Cryptogramma species. DNA sequence data from six plastid loci (rbcL, rbcL-accD, rbcL-atpB, rps4-trnS, trnG-trnR and trnP-petG) were analyzed using maximum likelihood and Bayesian methods to provide the first rigorous assessment of diversification in the genus, including testing the monophyly of the genus and sections. Cryptogramma and Coniogramme are recovered as reciprocally monophyletic sister genera. We established the monophyly of both sections within Cryptogramma. Furthermore, our sequence data reveal that described species reflect mostly allopatric reciprocally monophyletic lineages that are independent evolutionary trajectories. Using sequence data from the nuclear locus (gapCp) we find that the European C. crispa is an autotetraploid with a partially diploidized genome, while the North American tetraploid Cryptogramma sitchensis is an allopolyploid derived from C. acrostichoides and C. raddeana. Subsequent backcrossing between C. sitchensis and C. acrostichoides has allowed the introgression of C. raddeana alleles into northern populations of C. acrostichoides.

  1. Swedish Plectida (Nematoda). Part 9. The genus Leptolaimoides Vitiello, 1971.

    PubMed

    Holovachov, Oleksandr

    2015-05-01

    Three known and two new species of Leptolaimoides are described from bottom sediments collected in Skagerrak off the west coast of Sweden. The following known species are redescribed: Leptolaimoides haploopis Jensen, 1978, L. tubulosus Vitiello, 1971 and L. hexatubulosus Hoang Lai-Phu et al., 2009. Leptolaimoides filicaudatus sp. n. is characterised by the 431-543 µm long body; cephalic sensilla papilliform; amphid 23-26 µm long, located 9-10 µm from anterior end; first body pore located 35-37 µm from anterior end; lateral field simple along most of body, areolated on tail, arising 36-40 µm from anterior end; female without supplements, vagina without pars refringens, vulva midventral; male without tubular and without alveolar supplements; spicules arcuate and 16 µm long. Leptolaimoides leptomicron sp. n. is characterised by the 776-847 µm long body; cephalic sensilla papilliform; amphid 15-17 µm long, located 9-13 µm from anterior end; first body pore located 40-46 µm from anterior end; lateral field areolated, arising 26-28 µm from anterior end; female without supplements, vagina without pars refringens, vulva midventral; male with three tubular and without alveolar supplements, spicules arcuate and 28-29 µm long. The diagnosis of the genus Leptolaimoides is emended and a tabular compendium and dichotomous identification key to species of the genus Leptolaimoides are provided.

  2. Evolution of alkaloid biosynthesis in the genus Narcissus.

    PubMed

    Berkov, Strahil; Martínez-Francés, Vanessa; Bastida, Jaume; Codina, Carles; Ríos, Segundo

    2014-03-01

    In an attempt to reveal the relationships between alkaloid biosynthesis and phylogeny, we investigated by GC-MS the alkaloid patterns of 22 species and 3 hybrids (from 45 locations) from seven main sections of the genus Narcissus (Amaryllidaceae). The results indicate that the first alkaloids to evolve in the genus Narcissus were of the lycorine- and homolycorine-type. The alkaloid pattern of the Nevadensis section supports its recent separation from the Pseudonarcissus section. The plants of Narcissus pallidulus (Ganymedes section) show a predominance of Sceletium-type compounds, which are quite rare in the Amaryllidaceae family. Two successful evolutionary strategies involving alkaloid biosynthesis and leading to an expansion in taxa and occupied area were determined. Firstly, a diversification of alkaloid patterns and a high alkaloid concentration in the organs of the large Narcissus species (in the Pseudonarcissus section) resulted in an improved chemical defence in diverse habitats. Secondly, both plant size and alkaloid biosynthesis were reduced (in the Bulbocodium and Apodanthi sections) relegated to dry pastures and rocky places.

  3. PHYLOGEOGRAPHY OF THE GENUS SPONGITES (CORALLINALES, RHODOPHYTA) FROM CHILE(1).

    PubMed

    Vidal, Rodrigo; Meneses, Isabel; Smith, Macarena

    2008-02-01

    Both the records and the descriptions of the crustose species of coralline algae on the southeastern coast of South America are from the early 1900s. Unlike other algae species on the coast of Chile, the biogeography and distribution of crustose corallines have not been studied despite their abundance. Through recent studies, it has been determined that the genus Spongites is the most conspicuous genus along the rocky intertidal of the Chilean coasts. It is also common to the entire coast of the Southern Hemisphere; however, the relationship between species and the possible reasons for their distribution is unknown. We used nuclear and mitochondrial genetic markers and SEM observations of morphological characters to examine Spongites samples from the Southern Hemisphere and to establish the phylogeographic relationships of Chilean Spongites with specimens from other southern coasts. The combination of these analyses revealed the following: (i) a monophyletic clade that represents the Chilean Spongites and (ii) a paraphyletic clade for South African, New Zealand, and Argentine samples. Consequently, we postulate two nonexclusive hypotheses regarding the relationship of Spongites species in the Southern Hemisphere: (i) a complex history of extinction, speciation, and recolonization that might have erased original Gondwanan split patterns, and (ii) an Antarctic Peninsula origin for the Chilean Spongites species.

  4. Timely approaches to identify probiotic species of the genus Lactobacillus

    PubMed Central

    2013-01-01

    Over the past decades the use of probiotics in food has increased largely due to the manufacturer’s interest in placing “healthy” food on the market based on the consumer’s ambitions to live healthy. Due to this trend, health benefits of products containing probiotic strains such as lactobacilli are promoted and probiotic strains have been established in many different products with their numbers increasing steadily. Probiotics are used as starter cultures in dairy products such as cheese or yoghurts and in addition they are also utilized in non-dairy products such as fermented vegetables, fermented meat and pharmaceuticals, thereby, covering a large variety of products. To assure quality management, several pheno-, physico- and genotyping methods have been established to unambiguously identify probiotic lactobacilli. These methods are often specific enough to identify the probiotic strains at genus and species levels. However, the probiotic ability is often strain dependent and it is impossible to distinguish strains by basic microbiological methods. Therefore, this review aims to critically summarize and evaluate conventional identification methods for the genus Lactobacillus, complemented by techniques that are currently being developed. PMID:24063519

  5. Species limits in the Andean toad genus Osornophryne (Bufonidae).

    PubMed

    Páez-Moscoso, Diego J; Guayasamin, Juan M

    2012-12-01

    As Darwin observed, the differentiation among varieties, subspecies, and species seems, often times, arbitrary. Nowadays, however, novel tools provide the possibility of testing hypotheses of species. Using the Andean toad genus Osornophryne, we address the following questions: (1) How many species are within the genus? (2) Are morphological and molecular traits congruent when delimiting species? (3) Which morphological traits are the most divergent among species? We use recently developed methods for testing species boundaries and relationships using a multilocus data set consisting of two mitochondrial genes (12S, 16S; 1647bp aligned matrix), one exon (RAG-1; 923 aligned matrix), and one intron (RPL3Int5; 1410bp aligned matrix). As another line of evidence for species delimitation, we integrated analyses of 12 morphometric variables and 10 discrete traits commonly used in amphibian systematics. The molecular and morphological approaches support the validity of most of the described species in Osornophryne. We find, however, contradictory lines of evidence regarding the status of O. angel. Within O. guacamayo, we found a genetically divergent population that, we argue, represents a new species. We consider that O. bufoniformis represents a species complex that deserves further study. We highlight the importance of incorporating morphological data when delimiting species, especially for lineages that have a recent origin and have not achieved reciprocal monophyly in molecular phylogenies. Finally, the most divergent morphological traits among Osornophryne species are associated with locomotion (finger, toes and limbs) and feeding (head), suggesting an association between morphology and the ecological habits of the species.

  6. [Surface proteins of bacteria of the genus Bifidobacterium].

    PubMed

    Dylus, Ewa; Buda, Barbara; Górska-Frączek, Sabina; Brzozowska, Ewa; Gamian, Andrzej

    2013-05-13

    Beneficial effects due to the presence of probiotic bacteria of the genus Bifidobacterium in the human intestinal tract are still an interesting object of study. So far activities have been confirmed of bifidobacteria in stimulation of the host immune system, stimulation of tumor cell apoptosis, improvement of bowel motility, alleviation of symptoms of lactose intolerance, cholesterol lowering capacity, prevention and treatment of diarrhea and irritable bowel syndrome, alleviation of allergy or atopic dermatitis, maintenance of homeostasis of the intestine, and stimulation of the development of normal intestinal microflora in infants. A multitude of therapeutic properties encourages researchers to investigate the possibility of using the potential of Bifidobacterium in the prevention and treatment of other conditions such as rheumatoid arthritis and depression. Although it is known that the beneficial effects are due to intestinal mucosal colonization by these bacteria, the cell components responsible for the colonization are still not determined. In addition to the beneficial effects of probiotic administration, there were also negative effects including sepsis. Therefore research has been directed to identify specific components of Bifidobacterium responsible for probiotic effects. Currently researchers are focused on identifying, isolating and evaluating the properties of surface proteins that are probably involved in the adhesion of bacterial cells to the intestinal epithelium, improving colonization. This paper is an overview of current knowledge on Bifidobacterium surface proteins. The ways of transport and anchoring proteins in Gram-positive bacterial cells, the assembly of cell wall, and a description of the genus Bifidobacterium are presented.

  7. Diversity and Karyotypic Evolution in the Genus Neacomys (Rodentia, Sigmodontinae).

    PubMed

    da Silva, Willam O; Pieczarka, Julio C; Rossi, Rogério V; Schneider, Horacio; Sampaio, Iracilda; Miranda, Cleuton L; da Silva, Cláudia R; Cardoso, Elizandra M; Nagamachi, Cleusa Y

    2015-01-01

    Neacomys (Sigmodontinae) comprises 8 species mainly found in the Amazonian region. We describe 5 new karyotypes from Brazilian Amazonia: 2 cytotypes for N. paracou (2n = 56/FNa = 62-66), 1 for N. dubosti (2n = 64/FNa = 68), and 2 for Neacomys sp. (2n = 58/FNa = 64-70), with differences in the 18S rDNA. Telomeric probes did not show ITS. We provide a phylogeny using Cytb, and the analysis suggests that 2n = 56 with a high FNa is ancestral for the genus, as found in N. paracou, being retained by the ancestral forms of the other species, with an increase in 2n occurring independently in N. spinosus and N. dubosti. Alternatively, an increase in 2n may have occurred in the ancestral taxon of the other species, followed by independent 2n-reduction events in Neacomys sp. and in the ancestral species of N. tenuipes, N. guianae, N. musseri, and N. minutus. Finally, a drastic reduction event in the diploid number occurred in the ancestral species of N. musseri and N. minutus which exhibit the lowest 2n of the genus. The karyotypic variations found in both intra- and interspecific samples, associated with the molecular phylogeny, suggest a chromosomal evolution with amplification/deletion of constitutive heterochromatin and rearrangements including fusions, fissions, and pericentric inversions.

  8. New karyotypes of Atlantic tree rats, genus Phyllomys (Rodentia: Echimyidae).

    PubMed

    Araújo, Naiara Pereira; Loss, Ana Carolina; Cordeiro-Junior, Dirceu A; da Silva, Kátia Regina; Leite, Yuri L R; Svartman, Marta

    2014-01-01

    Phyllomys (Echimyidae, Rodentia) is a genus of Neotropical rodents with available cytogenetic data restricted to six out of 13 species, mainly based on simple staining methods, without detailed analyses. In this work, we present new karyotypes for Phyllomys lamarum (diploid number 2n = 56, fundamental number or number of autosomal arms FN = 102) and Phyllomys sp. (2n = 74, FN = 140) from the state of Minas Gerais, southeastern Brazil. We provide the first GTG- and CBG-banding patterns, silver-staining of the nucleolar organizer regions (Ag-NORs), and fluorescence in situ hybridization (FISH) with telomeric and 45S rDNA probes of Phyllomys. In addition to examining their chromosomes and phenotypic characters, we sequenced mitochondrial DNA from the specimens analyzed to confirm their taxonomic identification. The comparison of the distinctive chromosome complements of our specimens with those of other species of Phyllomys already published allowed us to conclude that chromosome data may be very useful for the taxonomy of the genus, as no two species analyzed presented the same diploid and fundamental numbers (2n and FN).

  9. Evolution and dispersal of the genus Homo: A landscape approach.

    PubMed

    Winder, Isabelle C; Devès, Maud H; King, Geoffrey C P; Bailey, Geoffrey N; Inglis, Robyn H; Meredith-Williams, Matthew

    2015-10-01

    The notion of the physical landscape as an arena of ecological interaction and human evolution is a powerful one, but its implementation at larger geographical and temporal scales is hampered by the challenges of reconstructing physical landscape settings in the geologically active regions where the earliest evidence is concentrated. We argue that the inherently dynamic nature of these unstable landscapes has made them important agents of biological change, creating complex topographies capable of selecting for, stimulating, obstructing or accelerating the latent and emerging properties of the human evolutionary trajectory. We use this approach, drawing on the concepts and methods of active tectonics, to develop a new perspective on the origins and dispersal of the Homo genus. We show how complex topography provides an easy evolutionary pathway to full terrestrialisation in the African context, and would have further equipped members of the genus Homo with a suite of adaptive characteristics that facilitated wide-ranging dispersal across ecological and climatic boundaries into Europe and Asia by following pathways of complex topography. We compare this hypothesis with alternative explanations for hominin dispersal, and evaluate it by mapping the distribution of topographic features at varying scales, and comparing the distribution of early Homo sites with the resulting maps and with other environmental variables.

  10. Essential oil biosynthesis and regulation in the genus Cymbopogon.

    PubMed

    Ganjewala, Deepak; Luthra, Rajesh

    2010-01-01

    Essential oils distilled from Cymbopogon species are of immense commercial value as flavors and fragrances in the perfumery, cosmetics, soaps, and detergents and in pharmaceutical industries. Two major constituents of the essential oil, geraniol and citral, due to their specific rose and lemon like aromas are widely used as flavors, fragrances and cosmetics. Citral is also used for the synthesis of vitamin A and ionones (for example, beta-ionone, methyl ionone). Moreover, Cymbopogon essential oils and constituents possess many useful biological activities including cytotoxic, anti-inflammatory and antioxidant. Despite the immense commercial and biological significance of the Cymbopogon essential oils, little is known about their biosynthesis and regulatory mechanisms. So far it is known that essential oils are biosynthesized via the classical acetate-MVA route and existence of a newly discovered MEP pathway in Cymbopogon remains as a topic for investigation. The aim of the present review is to discuss the biosynthesis and regulation of essential oils in the genus Cymbopogon with given emphasis to two elite members, lemongrass (C. flexuosus Nees ex Steud) and palmarosa (C. martinii Roxb.). This article highlights the work done so far towards understanding of essential oil biosynthesis and regulation in the genus Cymbopogon. Also, based on our experiences with Cymbopogon species, we would like to propose C. flexuosus as a model system for the study of essential oil metabolism beyond the much studied plant family Lamiaceae.

  11. Medicinal chemistry and pharmacology of genus Tripterygium (Celastraceae)

    PubMed Central

    Brinker, Anita M.; Ma, Jun; Lipsky, Peter E.; Raskin, Ilya

    2013-01-01

    Plants in the genus Tripterygium, such as Tripterygium wilfordii Hook. f., have a long history of use in traditional Chinese medicine. In recent years there has been considerable interest in the use of Tripterygium extracts and of the main bioactive constituent, the diterpene triepoxide triptolide (1), to treat a variety of autoimmune and inflammation-related conditions. The main mode of action of the Tripterygium extracts and triptolide (1) is the inhibition of expression of proinflammatory genes such as those for interleukin-2 (IL-2), inducible nitric oxide synthase (iNOS), tumor necrosis factor-α (TNF-α), cyclooxygenase-2 (COX-2) and interferon-gamma (IFN-γ). The efficacy and safety of certain types of Tripterygium extracts were confirmed in human clinical trials in the US and abroad. Over 300 compounds have been identified in the genus Tripterygium, and many of these have been evaluated for biological activity. The overall activity of the extract is based on the interaction between its components. Therefore, the safety and efficacy of the extract cannot be fully mimicked by any individual constituent. This review discusses the biochemical composition and biological and pharmacological activities of Tripterygium extracts, and their main bioactive components. PMID:17250858

  12. Revision of the genus Hydroides (Annelida: Serpulidae) from Australia.

    PubMed

    Sun, Yanan; Wong, Eunice; ten Hove, Harry A; Hutchings, Pat A; Williamson, Jane E; Kupriyanova, Elena K

    2015-09-01

    Hydroides Gunnerus, 1768 is the largest and one of the economically most important genera of calcareous tubeworms (Serpulidae, Annelida) that includes a number of notorious fouling and bioinvading species. Although the representatives of the genus are typically found in shallow waters of tropical and subtropical areas worldwide, the species composition of the genus in Australia has never been revised. We conducted the first detailed regional taxonomic revision of Hydroides species based both on the historical collections from Australian museums (Australian Museum, Museum Victoria, South Australian Museum, Western Australian Museum, Queensland Museum, and Museum and Art Gallery of Northern Territory) and newly collected material from New South Wales, Victoria, Queensland, Northern Territory, and Western Australia. In total, 25 species are currently considered valid in Australia, including three new species: H. amri n. sp. from NSW, SA, and Vic (previously referred to as H. cf. brachyacantha), as well as H. glasbyi n. sp. and H. qiui n. sp., both from NT, and two new records of H. furcifera and H. multispinosa for Australia. We have synonymised H. spiratubus with H. albiceps, and H. spiculitubus with H. tambalagamensis in this study. The status of the taxon H. cf. recta remains undecided. An identification key and diagnoses accompanied by original high-quality photographs for all species recorded in Australia are provided. Application of molecular genetics is needed to resolve the status of some problematic species.

  13. A new genus and species of Placusini from a high mountain in Mexico

    PubMed Central

    Santiago-Jiménez, Quiyari J.; Santiago-Navarro, Rosny

    2016-01-01

    Abstract A new genus and species are described from the Cofre de Perote volcano, in the state of Veracruz, Mexico. Although the new genus is very similar to Placusa, it presents tergite VIII completely modified to form a horn, in both females and males, in addition to other differences in mouthparts. A map and illustrations are provided, as well as an identification key to the genera of Placusini. No morphological characters are apparent to separate Kirtusa Pace from Euvira Sharp in our genus key. The specimens of the new genus were collected using Lindgren and cross traps baited with a mix of semiochemicals: ipsenol, ipsdienol and lanierone. PMID:28138285

  14. A new species of the genus Microgecko Nikolsky, 1907 (Sauria: Gekkonidae) from southern Iran.

    PubMed

    Gholamifard, Ali; Rastegar-Pouyani, Nasrullah; Rastegar-Pouyani, Eskandar; Khosravani, Azar; Yousefkhani, Seyyed Saeed Hosseinian; Oraei, Hamzeh

    2016-03-20

    The dwarf geckos of the recently revived genus Microgecko Nikolsky, 1907 comprise four species, ranging from western Iran to northwestern India. Iran hosts three species of the four recognized species of the genus Microgecko. Here, we describe a new species of this genus based on two and single specimens from southeastern and southern Iran, respectively. Combinations of scalation characters and distinct morphology, coloration and habitat peculiarities in calcareous mountains distinguish Microgecko chabaharensis sp. nov. from its congeners. Detailed information and an updated identification key for the genus Microgecko are also presented.

  15. A new genus of moss inhabiting flea beetles (Coleoptera: Chrysomelidae) from Nicaragua

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Nicaltica new genus and new species (N. selvanegra), from Nicaragua are described and illustrated. Nicaltica is compared to Kiskeya Konstantinov and Chamorro, Monotalla Bechyne, and Normaltica Konstantinov....

  16. First record of the genus Kuwaita (Annelida: Lumbrineridae) in Europe with the description of a new species and new ultramorphological data for the genus.

    PubMed

    Arias, Andrés; Carrera-Parra, Luis F

    2014-11-21

    A new species of the genus Kuwaita Mohammad, 1973, collected intertidally from a northern Spain estuary (Bay of Biscay), is described. Kuwaita hanneloreae sp. nov. constitutes the first evidence of this genus in European waters and is characterised by: prostomium with three small antennae protruding from nuchal fold, lack of eyes; simple multidentate hooded hooks with long hood in anterior chaetigers, and short hood in posterior ones with well defined proximal and distal teeth with several teeth between them; posterior chaetigers with very small nephridial papillae; branchiae reduced to little knobs in posterior parapodia; maxillary apparatus with five pairs of maxillae, MIII bidentate with distal tooth bigger than proximal one. We present brief notes on its ecology and remarks on the presence and ultrastructure of a notopodial sense organ newly recorded for the genus. Furthermore, an updated key of the genus Kuwaita is included.

  17. Descriptions of four kleptoparasitic spiders of the genus Mysmenopsis (Araneae, Mysmenidae) and their potential host spider species in the genus Linothele (Araneae, Dipluridae) from Ecuador.

    PubMed

    Dupérré, Nadine; Tapia, Elicio

    2015-06-12

    Four new species of the genus Mysmenopsis are described: M. onorei n. sp., M. otonga n. sp., M. fernandoi n. sp. and M. chiquita n. sp. All species were collected in diplurid webs and are therefore assumed to be kleptoparasitic. Five potential host species of the genus Linothele (Dipluridae) that were collected with the symbionts are also described: Linothele yanachanka n. sp., L. pukachumpi n. sp., L. zaia n. sp., L. tsachilas n. sp. and L. quori n. sp.

  18. Carajathemis simone, new genus and species from Brazil (Odonata: Libellulidae).

    PubMed

    Machado, Angelo B M

    2012-12-01

    Carajathemis simone n. gen., n.sp. from the state of Pará, Brazil, is described and illustrated based on 22 specimens collected in a "canga" (laterite) lake within the forest at the Flona de Carajás, Parauapebas Municipality. The new libellulid genus fits in the subfamily Sympetrinae and the male keys out to Erythemis in Garrison et al. (2006). The new taxon has a combination of characters that makes it different from all genera of Sympetrinae including Erythemis. The species is remarkable by its large size, pleural striping and especially by the complex and strongly dimorphic leg armature. It seems to be restricted to shallow, rainfall-dependent, iron-rich lakes.

  19. Humpback Dolphin (Genus Sousa) Behavioural Responses to Human Activities.

    PubMed

    Piwetz, Sarah; Lundquist, David; Würsig, Bernd

    2015-01-01

    Humpback dolphins (genus Sousa) use shallow, near-shore waters throughout their range. This coastal distribution makes them vulnerable to recreational and commercial disturbances, especially near heavily populated and industrialized areas. Most research focusing on Sousa and human activities has emphasized direct impacts and threats, involving injury and death, with relatively little focus on indirect effects on dolphins, such as changes in behaviour that may lead to deleterious effects. Understanding behaviour is important in resolving human-wildlife conflict and is an important component of conservation. This chapter gives an overview of animal behavioural responses to human activity with examples from diverse taxa; reviews the scientific literature on behavioural responses of humpback dolphins to human activity throughout their range, including marine vessel traffic, dolphin tourism, cetacean-fishery interactions, noise pollution, and habitat alteration; and highlights information and data gaps for future humpback dolphin research to better inform behaviour-based management decisions that contribute to conservation efforts.

  20. The genus Paracholula (Hemiptera: Heteroptera: Lygaeoidea: Rhyparochromidae: Rhyparochrominae: Myodochini).

    PubMed

    Peredo, Luis Cervantes; Santacruz, Jezabel Baez

    2014-01-07

    The genus Paracholula Harrington has been represented by two species, P. picta (Fab) and P. thoracica (Distant), both recorded from Mexico. Individuals of one population from Guerrero were studied and compared with individuals of both species from different collections, including the types. Using scanning electron micrographs of different structures, and observation of the male genitalia of some individuals, together with a close examination of all the individuals from the population from Guerrero, we discovered, that there is great variation in all the structures and that some characters that were used to separate the two species are present within the population from Guerrero. Therefore we synonymize both species, stating that the valid name for this species is Paracholula picta (Fab). Descriptions and illustrations of all the immature stages from the Guerrero population are included. Notes about host plants, biology and distributional records are also included.

  1. THE GENUS VEILLONELLA. 3. HYDROGEN SULFIDE PRODUCTION BY GROWING CULTURES.

    PubMed

    ROGOSA, M; BISHOP, F S

    1964-07-01

    Rogosa, Morrison (National Institute of Dental Research, Bethesda, Md.), and Ferial S. Bishop. The genus Veillonella. III. Hydrogen sulfide production by growing cultures. J. Bacteriol. 88:37-41. 1964.-The conditions necessary for H(2)S production by 105 strains of Veillonella, from a variety of sources and comprising seven anti-genic groups, are presented and discussed. All strains, during 1 to 2 days of growth, produced H(2)S in a defined medium supplemented with proper amounts of l-cysteine, l-cystine, reduced glutathione, thiosulfate, thiocyanate, or thioglycolate. Erratic or negative results were obtained with some commonly used media containing yeast extract and casein digest, but which were not supplemented with appropriate substrates for H(2)S production. Previous literature descriptions of V. alcalescens as not producing H(2)S are incorrect; H(2)S production, or the previously presumed lack of it, cannot be used as a criterion differentiating V. alcalescens from V. parvula.

  2. Members of the methanotrophic genus Methylomarinum inhabit inland mud pots

    PubMed Central

    Fradet, Danielle T.; Orphan, Victoria J.

    2016-01-01

    Proteobacteria capable of converting the greenhouse gas methane to biomass, energy, and carbon dioxide represent a small but important sink in global methane inventories. Currently, 23 genera of methane oxidizing (methanotrophic) proteobacteria have been described, although many are represented by only a single validly described species. Here we describe a new methanotrophic isolate that shares phenotypic characteristics and phylogenetic relatedness with the marine methanotroph Methylomarinum vadi. However, the new isolate derives from a terrestrial saline mud pot at the northern terminus of the Eastern Pacific Rise (EPR). This new cultivar expands our knowledge of the ecology of Methylomarinum, ultimately towards a fuller understanding of the role of this genus in global methane cycling. PMID:27478692

  3. Biting Midges of the Genus Culicoides in South Carolina Zoos

    PubMed Central

    Nelder, Mark P.; Swanson, Dustin A.; Adler, Peter H.; Grogan, William L.

    2010-01-01

    Biting midges of the genus Culicoides (Diptera: Ceratopogonidae) were collected during the summer of 2007 at the Greenville and Riverbanks Zoos in South Carolina with Centers for Disease Control and Prevention (CDC) traps equipped with ultraviolet or incandescent lights and baited with carbon dioxide. Sixteen species of Culicoides were collected, four of which represented more than 80%. They were Culicoides guttipennis (Coquillett), Culicoides mulrenanni Beck, Culicoides obsoletus (Meigen), and Culicoides sanguisuga (Coquillett). C. guttipennis was found on a dead colobus monkey and a dead golden-headed lion tamarin; Culicoides husseyi Wirth & Blanton was collected from an unidentified, abandoned bird's nest. Ultraviolet light-equipped traps captured significantly more Culicoides specimens than traps with incandescent light. Half of the collected species previously have been associated with vertebrate pathogens, indicating a potential risk to captive animals. PMID:20569132

  4. Revision of the Genus Hemicriconemoides Chitwood &Birchfield, 1957 (Nematoda: Criconematidae)

    PubMed Central

    Dasgupta, D. R.; Raski, D. J.; Van Gundy, S. D.

    1969-01-01

    In the present study, evaluations of the nominal species and descriptions (H. parvus, H. intermedius, H. insignis, H. microdoratus and H. brevicaudatus) are made of five new species. H. squamosus is proposed as a species inquirenda; H. mangiferae is judged a valid species. H. litchi and H. birchfieldi are synonymized with H. mangiferae and H. ureshinoensis with H. kanayaensis. H. strictathecatus is considered a valid species. A key to the species of the genus is given. The limitation of use of male diagnostic characters in a mixture of populations of Hemicriconemoides with some other criconematids is discussed. The life cycle of H. chitwoodi has four complete molts; one in the egg, three in soil, two of which have spines. The adult female has a sheath cuticle from an incomplete fifth molt. PMID:19325667

  5. Molecular systematics and global phylogeography of angel sharks (genus Squatina).

    PubMed

    Stelbrink, Björn; von Rintelen, Thomas; Cliff, Geremy; Kriwet, Jürgen

    2010-02-01

    Angel sharks of the genus Squatina represent a group comprising 22 extant benthic species inhabiting continental shelves and upper slopes. In the present study, a comprehensive phylogenetic reconstruction of 17 Squatina species based on two mitochondrial markers (COI and 16S rRNA) is provided. The phylogenetic reconstructions are used to test biogeographic patterns. In addition, a molecular clock analysis is conducted to estimate divergence times of the emerged clades. All analyses show Squatina to be monophyletic. Four geographic clades are recognized, of which the Europe-North Africa-Asia clade is probably a result of the Tethys Sea closure. A second sister group relationship emerged in the analyses, including S. californica (eastern North Pacific) and S. dumeril (western North Atlantic), probably related to the rise of the Panamanian isthmus. The molecular clock analysis show that both lineage divergences coincide with the estimated time of these two geological events.

  6. Evolutionary patterns of diversification in the Andean hummingbird genus Adelomyia.

    PubMed

    Chaves, Jaime A; Smith, Thomas B

    2011-08-01

    The patterns of genetic diversity and morphological variation are of central importance in understanding the evolutionary process that drive diversification. We use molecular, morphological, and ecological data to explore the influence of geography and ecology in promoting speciation in the widespread Andean hummingbird genus Adelomyia. Six monophyletic clades were recovered which show distributional limits at well-defined geographic barriers. Percentage sequence divergence ranged between 5.8% and 8.2% between phylogroups separated by large (>4000 km) and small (<50 km) distances respectively, suggesting that geographic isolation may be influential at very different scales. We show that morphological traits in independent phylogroups are more related to environmental heterogeneity than to geographic barriers. We provide a molecular reconstruction of relationships within Adelomyia and recommend its use in future comparative studies of historical biogeography and diversification in the Andes.

  7. Baudoinia, a new genus to accommodate Torula compniacensis.

    PubMed

    Scott, James A; Untereiner, Wendy A; Ewaze, Juliet O; Wong, Bess; Doyle, David

    2007-01-01

    Baudoinia gen. nov. is described to accommodate Torula compniacensis. Reported originally from the walls of buildings near brandy maturation warehouses in Cognac, France, species of Baudoinia are cosmopolitan colonists of exposed surfaces subjected to large diurnal temperature shifts, episodic high relative humidity and wetting, and ambient airborne ethanol. Morphologically B. compniacensis resembles some anamorphic Mycosphaerellaceae in possessing dark brown, nonseptate or uniseptate conidia with coarsely roughened walls that are borne acropetally in unbranched chains and released by schizolytic dehiscence. Analysis of partial nuclear rDNA SSU sequences positions B. compniacensis in the order Capnodiales and reveals that it is most closely related to the microcolonial genus Friedmanniomyces. Heat resistance is induced by brief sublethal temperature exposure.

  8. A new genus of Boletaceae from eastern North America.

    PubMed

    Halling, Roy E; Baroni, Timothy J; Binder, Manfred

    2007-01-01

    Bothia is described as a new genus in the Boletaceae based on Boletinus castanellus described by C.H. Peck from eastern North America. A widespread, occasionally encountered taxon, Bothia castanella possesses a combination of macro- and microscopic features that has prompted past placement in seven different genera. Yet, as a species it is readily recognizable with its chestnut brown, dry pileus, decurrent, pale brown hymenophore with radially elongated tubes, a short, sometimes eccentric, exannulate stipe, yellow brown spore deposit and constant association with Quercus. Phylogenetic analyses of large subunit rDNA and BLAST searches using the ITS region confirm the placement of B. castanella as a unique generic lineage in the Boletaceae.

  9. Phylogeny and biogeography of the remarkable genus Bondarzewia (Basidiomycota, Russulales)

    PubMed Central

    Song, Jie; Chen, Jia-Jia; Wang, Min; Chen, Yuan-Yuan; Cui, Bao-Kai

    2016-01-01

    Bondarzewia is a conspicuous and widely distributed mushroom genus, but little is known about its origin and biogeography. Here, we investigated the systematics and biogeography of Bondarzewia species using multi-locus phylogenetic analysis. Four genetic markers, including the internal transcribed spacer (ITS), large nuclear ribosomal RNA subunit (nLSU), elongation factor 1-α (tef1) and mitochondrial small subunit rDNA (mtSSU), were used to infer the phylogenetic relationships of Bondarzewia. We performed Bayesian evolutionary analysis on the gene datasets of the largest and second largest subunits of RNA polymerase II (RPB1 and RPB2). From the results, we inferred that the maximum crown age of Bondarzewia is approximately 25.5 million-years-ago (Mya) and that tropical East Asia is likely to be its ancestral area, with three possible expansions leading to its distribution in North America, Europe and Oceania. PMID:27680391

  10. The Genus Carissa: An Ethnopharmacological, Phytochemical and Pharmacological Review.

    PubMed

    Kaunda, Joseph Sakah; Zhang, Ying-Jun

    2017-02-27

    Carissa L. is a genus of the family Apocynaceae, with about 36 species as evergreen shrubs or small trees native to tropical and subtropical regions of Africa, Asia and Oceania. Most of Carissa plants have been employed and utilized in traditional medicine for various ailments, such as headache, chest complains, rheumatism, oedema, gonorrhoea, syphilis, rabies. So far, only nine Carissa species have been phytochemically studied, which led to the identification of 123 compounds including terpenes, flavonoids, lignans, sterols, simple phenolic compounds, fatty acids and esters, and so on. Pharmacological studies on Carissa species have also indicated various bioactive potentials. This review covers the peer-reviewed articles between 1954 and 2016, retrieved from Pubmed, ScienceDirect, SciFinder, Wikipedia and Baidu, using "Carissa" as search term ("all fields") and with no specific time frame set for search. Fifteen important medicinal or ornamental Carissa species were selected and summarized on their botanical characteristics, geographical distribution, traditional uses, phytochemistry, and pharmacological activities.

  11. Development of SSR markers for the genus Patellifolia (Chenopodiaceae)1

    PubMed Central

    Nachtigall, Marion; Bülow, Lorenz; Schubert, Jörg; Frese, Lothar

    2016-01-01

    Premise of the study: Microsatellite primers were developed to promote studies on the patterns of genetic diversity within Patellifolia patellaris (Chenopodiaceae) and the relationship between the three species of the genus Patellifolia. Methods and Results: The genomic sequence from P. procumbens was screened for simple sequence repeats (SSRs), and 3648 SSRs were identified. A subset of 53 SSR markers was validated, of which 25 proved to be polymorphic in the three species except for the P. webbiana–specific marker JKIPat16. The number of alleles ranged from 85 in P. patellaris, 187 in P. procumbens, and 202 in P. webbiana. Conclusions: The set of 25 new markers will facilitate studies of the relationships between the three Patellifolia species and of the spatial and temporal distribution of genetic diversity within the species. PMID:27610279

  12. Revision of the genus Exaesiopus Reichardt, 1926 (Coleoptera, Histeridae, Saprininae)

    PubMed Central

    Lackner, Tomáš

    2015-01-01

    Abstract The genus Exaesiopus Reichardt, 1926 is revised herein. It now contains seven species; one new combination is proposed: Pachylopus glaucus = Exaesiopus glaucus (Bickhardt, 1914), comb. n., and one species is described as new: Exaesiopus therondi sp. n. from Afghanistan. Subspecies Exaesiopus grossipes berberus Peyerimhoff, 1936 is sunk in synonymy with Exaesiopus grossipes (Marseul, 1855), syn. n. Lectotypes and paralectotypes, respectively, for Saprinus grossipes Marseul, 1855, Exaesiopus grossipes berberus Peyerimhoff, 1936 and a neotype for Pachylopus glaucus Bickhardt, 1914 are designated. Exaesiopus grossipes is re-described; other species are provided with diagnostic descriptions and supplemented by SEM micrographs, colour images, and line drawings of their male genitalia. A key to species is given. Exaesiopus glaucus (Bickhardt, 1914) is newly recorded from the Republic of South Africa; Exaesiopus torvus Reichardt, 1926 is new to Uzbekistan and Russia; Exaesiopus atrovirens Reichardt, 1926 is new to Ukraine and Tajikistan; and Exaesiopus henoni (Schmidt, 1896) is new to Libya and Djibouti. PMID:25685017

  13. New primate genus from the Miocene of Argentina

    PubMed Central

    Tejedor, Marcelo F.; Tauber, Adán A.; Rosenberger, Alfred L.; Swisher, Carl C.; Palacios, María E.

    2006-01-01

    Killikaike blakei is a new genus and species of anthropoid from the late Early Miocene of southeastern Argentina based on the most pristine fossil platyrrhine skull and dentition known so far. It is part of the New World platyrrhine clade (Family Cebidae; Subfamily Cebinae) including modern squirrel (Saimiri) and capuchin monkeys (Cebus) and their fossil relatives known from Early to Middle Miocene and subrecent periods. Living cebines are relatively large-brained, adroit predatory foragers and live within complex social groups, and wild capuchins exhibit a wide range of behaviors associated with enhanced intelligence. We show that K. blakei lacks diagnostic derived characteristics of the lower face and premolar dentition that are shared by modern cebines, but its strongly vaulted frontal bone and capacious anterior cranial fossa indicate the early evolution of an enlarged forebrain. PMID:16567649

  14. Lantibiotics, class I bacteriocins from the genus Bacillus.

    PubMed

    Lee, Hyungjae; Kim, Hae-Yeong

    2011-03-01

    Antimicrobial peptides exhibit high levels of antimicrobial activity against a broad range of spoilage and pathogenic microorganisms. Compared with bacteriocins produced by lactic acid bacteria, antimicrobial peptides from the genus Bacillus have been relatively less recognized despite their broad antimicrobial spectra. These peptides can be classified into two different groups based on whether they are ribosomally (bacteriocins) or nonribosomally (polymyxins and iturins) synthesized. Because of their broad spectra and high activity, antimicrobial peptides from Bacillus spp. may have great potential for applications in the food, agricultural, and pharmaceutical industries to prevent or control spoilage and pathogenic microorganisms. In this review, we introduce ribosomally synthesized antimicrobial peptides, the lantibiotic bacteriocins produced by members of Bacillus. In addition, the biosynthesis, genetic organization, mode of action, and regulation of subtilin, a well-investigated lantibiotic from Bacillus subtilis, are discussed.

  15. Evolution of a genetic incompatibility in the genus Xiphophorus.

    PubMed

    Scarpino, Samuel V; Hunt, Patrick J; Garcia-De-Leon, Francisco J; Juenger, Thomas E; Schartl, Manfred; Kirkpatrick, Mark

    2013-10-01

    Genetic incompatibilities are commonly observed between hybridizing species. Although this type of isolating mechanism has received considerable attention, we have few examples describing how genetic incompatibilities evolve. We investigated the evolution of two loci involved in a classic example of a Bateson-Dobzhansky-Muller (BDM) incompatibility in Xiphophorus, a genus of freshwater fishes from northern Central America. Hybrids develop a lethal melanoma due to the interaction of two loci, an oncogene and its repressor. We cloned and sequenced the putative repressor locus in 25 Xiphophorus species and an outgroup species, and determined the status of the oncogene in those species from the literature. Using phylogenetic analyses, we find evidence that a repeat region in the proximal promoter of the repressor is coevolving with the oncogene. The data support a hypothesis that departs from the standard BDM model: it appears the alleles that cause the incompatibilities have coevolved simultaneously within lineages, rather than in allopatric or temporal isolation.

  16. Beneficial and harmful roles of bacteria from the Clostridium genus.

    PubMed

    Samul, Dorota; Worsztynowicz, Paulina; Leja, Katarzyna; Grajek, Włodzimierz

    2013-01-01

    Bacteria of the Clostridium genus are often described only as a biological threat and a foe of mankind. However, many of them have positive properties and thanks to them they may be used in many industry branches (e.g., in solvents and alcohol production, in medicine, and also in esthetic cosmetology). During the last 10 years interest in application of C. botulinum and C. tetani in medicine significantly increased. Currently, the structure and biochemical properties of neurotoxins produced by these bacterial species, as well as possibilities of application of such toxins as botulinum as a therapeutic factor in humans, are being intensely researched. The main aim of this article is to demonstrate that bacteria from Clostridium spp. are not only pathogens and the enemy of humanity but they also have many important beneficial properties which make them usable among many chemical, medical, and cosmetic applications.

  17. Revision of the genus Prionotropis Fieber, 1853 (Orthoptera: Pamphagidae: Thrinchinae).

    PubMed

    Massa, Bruno; Ünal, Mustafa; Lo Verde, Gabriella

    2015-12-23

    The genus Prionotropis Fieber, 1853 is revised. It is distributed in scattered areas of the Mediterranean region from Turkey in the East to Spain in the West. Overall, seven species are listed, namely P. maculinervis (Stål, 1878) (Turkey; P. urfensis Ramme, 1933 is here considered its synonym), P. willemsorum n. sp. (Greece, Epirus; previously considered P. appula), P. appula (O.G. Costa, 1836) (South Italy), P. hystrix (Germar, 1817) (Bosnia and Herzegovina, Slovenia, Croatia, North-East Italy; P. hystrix sontiaca is here synonymized), P. rhodanica Uvarov, 1923 resurrected status (France, Crau, Rhone delta; here considered a valid species), P. azami Uvarov, 1923 n. status (France, Var region; here considered a valid species), and P. flexuosa (Serville, 1838) (Spain; the ssp. pereezi Bolívar, 1921 and sulphurans Bolívar, 1921 are here considered its synonyms). A key to species is presented.

  18. An Ethnopharmacological, Phytochemical and Pharmacological Review of the Genus Meconopsis.

    PubMed

    Guo, Qiang; Bai, Ruifeng; Zhao, Baosheng; Feng, Xiao; Zhao, Yunfang; Tu, Pengfei; Chai, Xingyun

    2016-01-01

    The Meconopsis plants (Chinese: ), belonging to the family Papaveraceae, have been used as traditional Tibetan medicine (TTM) for thousands of years. Meconopsis has the effects of clearing heat, reducing swelling, and easing pain, and is mainly prescribed for heat syndromes, hepatitis, pneumonia, and pain in joints. Phytochemical studies have revealed the presence of major isoquinoline alkaloids and flavonoids. Modern pharmacological research has demonstrated its antitumor, hepatoprotective, analgestic, antimicrobial, anti-oxidant, antitussive, and anti-inflammatory activities. However, resource availability, in-depth in vivo pharmacological study and qualitative and quantitative analysis are still insufficient and deserve further efforts. This paper provides a comprehensive advance on the ethnopharmacological, phytochemical, and pharmacological studies of the genus, in hopes of promoting a better understanding of their medicinal values.

  19. Conservation Strategies in the Genus Hypericum via Cryogenic Treatment

    PubMed Central

    Bruňáková, Katarína; Čellárová, Eva

    2016-01-01

    In the genus Hypericum, cryoconservation offers a strategy for maintenance of remarkable biodiversity, emerging from large inter- and intra-specific variability in morphological and phytochemical characteristics. Long-term cryostorage thus represents a proper tool for preservation of genetic resources of endangered and threatened Hypericum species or new somaclonal variants with unique properties. Many representatives of the genus are known as producers of pharmacologically important polyketides, namely naphthodianthrones and phloroglucinols. As a part of numerous in vitro collections, the nearly cosmopolitan Hypericum perforatum – Saint John’s wort – has become a suitable model system for application of biotechnological approaches providing an attractive alternative to the traditional methods for secondary metabolite production. The necessary requirements for efficient cryopreservation include a high survival rate along with an unchanged biochemical profile of plants regenerated from cryopreserved cells. Understanding of the processes which are critical for recovery of H. perforatum cells after the cryogenic treatment enables establishment of cryopreservation protocols applicable to a broad number of Hypericum species. Among them, several endemic taxa attract a particular attention due to their unique characteristics or yet unrevealed spectrum of bioactive compounds. In this review, recent advances in the conventional two-step and vitrification-based cryopreservation techniques are presented in relation to the recovery rate and biosynthetic capacity of Hypericum spp. The pre-cryogenic treatments which were identified to be crucial for successful post-cryogenic recovery are discussed. Being a part of genetic predisposition, the freezing tolerance as a necessary precondition for successful post-cryogenic recovery is pointed out. Additionally, a beneficial influence of cold stress on modulating naphthodianthrone biosynthesis is outlined. PMID:27200032

  20. Phylogeny and biogeography of the amphi-Pacific genus Aphananthe.

    PubMed

    Yang, Mei-Qing; Li, De-Zhu; Wen, Jun; Yi, Ting-Shuang

    2017-01-01

    Aphananthe is a small genus of five species showing an intriguing amphi-Pacific distribution in eastern, southern and southeastern Asia, Australia, and Mexico, also with one species in Madagascar. The phylogenetic relationships of Aphananthe were reconstructed with two nuclear (ITS & ETS) and two plastid (psbA-trnH & trnL-trnF) regions. Clade divergence times were estimated with a Bayesian approach, and the ancestral areas were inferred using the dispersal-extinction-cladogenesis and Bayesian Binary MCMC analyses. Aphananthe was supported to be monophyletic, with the eastern Asian A. aspera resolved as sister to a clade of the remaining four species. Aphananthe was inferred to have originated in the Late Cretaceous (71.5 mya, with 95% HPD: 66.6-81.3 mya), and the crown age of the genus was dated to be in the early Miocene (19.1 mya, with 95% HPD: 12.4-28.9 mya). The fossil record indicates that Aphananthe was present in the high latitude thermophilic forests in the early Tertiary, and experienced extinctions from the middle Tertiary onwards. Aphananthe originated in Europe based on the inference that included fossil and extant species, but eastern Asia was estimated to be the ancestral area of the clade of the extant species of Aphananthe. Both the West Gondwanan vicariance hypothesis and the boreotropics hypothesis could be excluded as explanation for its amphi-Pacific distribution. Long-distance dispersals out of eastern Asia into North America, southern and southeastern Asia and Australia, and Madagascar during the Miocene account for its wide intercontinental disjunct distribution.

  1. Phylogeny and biogeography of the amphi-Pacific genus Aphananthe

    PubMed Central

    Yang, Mei-Qing; Li, De-Zhu; Wen, Jun; Yi, Ting-Shuang

    2017-01-01

    Aphananthe is a small genus of five species showing an intriguing amphi-Pacific distribution in eastern, southern and southeastern Asia, Australia, and Mexico, also with one species in Madagascar. The phylogenetic relationships of Aphananthe were reconstructed with two nuclear (ITS & ETS) and two plastid (psbA-trnH & trnL-trnF) regions. Clade divergence times were estimated with a Bayesian approach, and the ancestral areas were inferred using the dispersal-extinction-cladogenesis and Bayesian Binary MCMC analyses. Aphananthe was supported to be monophyletic, with the eastern Asian A. aspera resolved as sister to a clade of the remaining four species. Aphananthe was inferred to have originated in the Late Cretaceous (71.5 mya, with 95% HPD: 66.6–81.3 mya), and the crown age of the genus was dated to be in the early Miocene (19.1 mya, with 95% HPD: 12.4–28.9 mya). The fossil record indicates that Aphananthe was present in the high latitude thermophilic forests in the early Tertiary, and experienced extinctions from the middle Tertiary onwards. Aphananthe originated in Europe based on the inference that included fossil and extant species, but eastern Asia was estimated to be the ancestral area of the clade of the extant species of Aphananthe. Both the West Gondwanan vicariance hypothesis and the boreotropics hypothesis could be excluded as explanation for its amphi-Pacific distribution. Long-distance dispersals out of eastern Asia into North America, southern and southeastern Asia and Australia, and Madagascar during the Miocene account for its wide intercontinental disjunct distribution. PMID:28170425

  2. A revision of the genus Atelecrinus PH Carpenter (Echinodermata: Crinoidea).

    PubMed

    Messing, Charles G

    2013-01-01

    The unusual bathyal comatulid crinoid genus Atelecrinus is widespread in the Atlantic and tropical Pacific Oceans and currently includes three recognized species. A re-assessment based on examination of new and existing specimens requires establishment of two new genera and five new species, and returns three junior synonyms to species-level status. Paratelecrinus is erected to accommodate Atelecrinus wyvilli PH Carpenter, A. conifer AH Clark, A. cubensis PH Carpenter, P. orthotriremis, new species, P. amenouzume new species, P. laticonulus new species and P. telo new species. Adelatelecrinus is erected to accommodate Atelecrinus sulcatus AH Clark and Adelatelecrinus vallatus new species. Atelecrinus retains A. balanoides PH Carpenter and A. helgae AH Clark, which restricts the genus to the Atlantic. In both Paratelecrinus and Adelatelecrinus, the basals articulate with the centrodorsal via ligament bundles anchored in deep ringlike interradial pits that project into the centrodorsal cavity, whereas in Atelecrinus the centrodorsal rim has shallow interradial concavities and attaches to the basals via a tight junction with no obvious ligament bundles. The spoon-shaped aboral fossa in the basals of Paratelecrinus appears to be unique among articulate crinoids and differs from the smooth fossa found in both Atelecrinus and Adelatelecrinus. New material extends the range of the family to the Indian Ocean. A few species are now known from enough specimens to identify some ontogenetic and distributional variations. Proximal ray morphology varies substantially with size in P. cubensis and P. orthotriremis. A. balanoides generally occurs in deeper water in the Lesser Antilles than in the Bahamas and Strait of Florida, while P. orthotriremis occurs in shallower water in the Lesser Antilles and deeper in the Bahamas.

  3. Conservation Strategies in the Genus Hypericum via Cryogenic Treatment.

    PubMed

    Bruňáková, Katarína; Čellárová, Eva

    2016-01-01

    In the genus Hypericum, cryoconservation offers a strategy for maintenance of remarkable biodiversity, emerging from large inter- and intra-specific variability in morphological and phytochemical characteristics. Long-term cryostorage thus represents a proper tool for preservation of genetic resources of endangered and threatened Hypericum species or new somaclonal variants with unique properties. Many representatives of the genus are known as producers of pharmacologically important polyketides, namely naphthodianthrones and phloroglucinols. As a part of numerous in vitro collections, the nearly cosmopolitan Hypericum perforatum - Saint John's wort - has become a suitable model system for application of biotechnological approaches providing an attractive alternative to the traditional methods for secondary metabolite production. The necessary requirements for efficient cryopreservation include a high survival rate along with an unchanged biochemical profile of plants regenerated from cryopreserved cells. Understanding of the processes which are critical for recovery of H. perforatum cells after the cryogenic treatment enables establishment of cryopreservation protocols applicable to a broad number of Hypericum species. Among them, several endemic taxa attract a particular attention due to their unique characteristics or yet unrevealed spectrum of bioactive compounds. In this review, recent advances in the conventional two-step and vitrification-based cryopreservation techniques are presented in relation to the recovery rate and biosynthetic capacity of Hypericum spp. The pre-cryogenic treatments which were identified to be crucial for successful post-cryogenic recovery are discussed. Being a part of genetic predisposition, the freezing tolerance as a necessary precondition for successful post-cryogenic recovery is pointed out. Additionally, a beneficial influence of cold stress on modulating naphthodianthrone biosynthesis is outlined.

  4. Oligotyping reveals community level habitat selection within the genus Vibrio.

    PubMed

    Schmidt, Victor T; Reveillaud, Julie; Zettler, Erik; Mincer, Tracy J; Murphy, Leslie; Amaral-Zettler, Linda A

    2014-01-01

    The genus Vibrio is a metabolically diverse group of facultative anaerobic bacteria, common in aquatic environments and marine hosts. The genus contains several species of importance to human health and aquaculture, including the causative agents of human cholera and fish vibriosis. Vibrios display a wide variety of known life histories, from opportunistic pathogens to long-standing symbionts with individual host species. Studying Vibrio ecology has been challenging as individual species often display a wide range of habitat preferences, and groups of vibrios can act as socially cohesive groups. Although strong associations with salinity, temperature and other environmental variables have been established, the degree of habitat or host specificity at both the individual and community levels is unknown. Here we use oligotyping analyses in combination with a large collection of existing Vibrio 16S ribosomal RNA (rRNA) gene sequence data to reveal patterns of Vibrio ecology across a wide range of environmental, host, and abiotic substrate associated habitats. Our data show that individual taxa often display a wide range of habitat preferences yet tend to be highly abundant in either substrate-associated or free-living environments. Our analyses show that Vibrio communities share considerable overlap between two distinct hosts (i.e., sponge and fish), yet are distinct from the abiotic plastic substrates. Lastly, evidence for habitat specificity at the community level exists in some habitats, despite considerable stochasticity in others. In addition to providing insights into Vibrio ecology across a broad range of habitats, our study shows the utility of oligotyping as a facile, high-throughput and unbiased method for large-scale analyses of publically available sequence data repositories and suggests its wide application could greatly extend the range of possibilities to explore microbial ecology.

  5. Revision of the genus Morphosphaera Baly (Coleoptera: Chrysomelidae: Galerucinae).

    PubMed

    Lee, Chi-Feng; Bezdĕk, Jan

    2016-10-28

    The genus Morphosphaera Baly, 1861 is revised. Eleven species are considered as valid, including, M. takizawai sp. nov. (Mt. Basor, 90 km N of Gua Musang, Malaysia, W. Kelantan), described from Malaysia and Indonesia. Color photos of habitus and drawings of diagnostic characters from eleven species are presented. The following synonymies are proposed: M. sodalis Chen, 1935 and M. brunnea Maulik, 1936 are junior synonyms of M. albipennis Allard, 1889; M. margaritacea Laboissière, 1930, M. viridipennis Laboissière, 1930, and M. prava Maulik, 1936 are junior synonyms of M. coomani Laboissière, 1930; M. gracilicornis Chen, 1963 is a junior synonym of M. maculicollis Baly, 1861; M. cavaleriei Laboissière, 1930, M. cincticollis Laboissière, 1930, M. marginata Laboissière, 1930, M. purpurea Laboissière, 1930, M. gingkoae Gressitt & Kimoto, 1963, and M. metallescens Gressitt & Kimoto, 1963 are junior synonyms of M. sumatrana Jacoby, 1886. The type material of M. impunctata Allard, 1890 from the Philippines was not found and its taxonomic status remains uncertain. Morphosphaera peregrina Weise, 1913 is transferred to the genus Borneola Mohamedsaid, 1998 nov. comb. A neotype is designated for Chrysomela japonica Hornstedt, 1788. Lectotypes are designated for the following species: Adorium chrysomeloides Bates, 1866, A. japonicum Baly, 1874, Morphosphaera albipennis Allard, 1889, M. bimaculata Chûjô, 1938, M. caerulea Jacoby, 1896, M. cavaleriei Laboissière, 1930, M. collaris Laboissière, 1930, M. formosa Laboissière, 1930, M. marginata Laboissière, 1930, M. montivaga Maulik, 1936, M. prava Maulik, 1936, M. purpurea Laboissière, 1930, M. sumatrana Jacoby, 1886, M. viridipennis Laboissière, 1930, and Galerucida simplex Weise, 1922.

  6. Conservation of Meningococcal Antigens in the Genus Neisseria

    PubMed Central

    Muzzi, Alessandro; Mora, Marirosa; Pizza, Mariagrazia; Rappuoli, Rino; Donati, Claudio

    2013-01-01

    ABSTRACT Neisseria meningitidis, one of the major causes of bacterial meningitis and sepsis, is a member of the genus Neisseria, which includes species that colonize the mucosae of many animals. Three meningococcal proteins, factor H-binding protein (fHbp), neisserial heparin-binding antigen (NHBA), and N. meningitidis adhesin A (NadA), have been described as antigens protective against N. meningitidis of serogroup B, and they have been employed as vaccine components in preclinical and clinical studies. In the vaccine formulation, fHbp and NHBA were fused to the GNA2091 and GNA1030 proteins, respectively, to enhance protein stability and immunogenicity. To determine the possible impact of vaccination on commensal neisseriae, we determined the presence, distribution, and conservation of these antigens in the available genome sequences of the genus Neisseria, finding that fHbp, NHBA, and NadA were conserved only in species colonizing humans, while GNA1030 and GNA2091 were conserved in many human and nonhuman neisseriae. Sequence analysis showed that homologous recombination contributed to shape the evolution and distribution of both NHBA and fHbp, three major variants of which have been defined. fHbp variant 3 was probably the ancestral form of meningococcal fHbp, while fHbp variant 1 from N. cinerea was introduced into N. meningitidis by a recombination event. fHbp variant 2 was the result of a recombination event inserting a stretch of 483 bp from variant 1 into the variant 3 background. These data indicate that a high rate of exchange of genetic material between neisseriae that colonize the human upper respiratory tract exists. PMID:23760461

  7. Review of the genus Craspedolcus Enderlein sensu lato in China, with the description of a new genus and four new species (Hymenoptera, Braconidae, Braconinae)

    PubMed Central

    Li, Yang; van Achterberg, Cornelis; Chen, Xue-xin

    2017-01-01

    Abstract A new genus is split off the genus Craspedolcus Enderlein, 1920 (Hymenoptera, Braconidae, Braconinae): Maculibracon gen. n. with type species Maculibracon abruptus sp. n. The genus Craspedolcus Enderlein sensu stricto is redefined, a key to both genera and to their species in China, Thailand and Vietnam is included. Craspedolcus obscuriventris Enderlein, 1920, (syn. n.) is a new synonym of Craspedolcus vagatus (Smith, 1858), as Ipobracon maculicosta Enderlein, 1920 and Iphiaulax bhotanensis Cameron, 1907 of Maculibracon simlaensis (Cameron, 1899), comb. n. The genus Craspedolcus is recorded from China for the first time with two species: Craspedolcus fraternus Enderlein, 1920, and Craspedolcus politus sp. n. The genus Maculibracon is represented by three species in China: Maculibracon simlaensis (Cameron, 1899), comb. n. (also present in Vietnam), Maculibracon hei sp. n. and Maculibracon luteonervis sp. n. and a fourth species is described from Thailand: Maculibracon abruptus sp. n. Hybogaster zebripterae Wang & Chen, 2008, from China (Fujian) is transferred to Iphiaulax Foerster, 1863, (comb. n.) and the following names are new combinations in Maculibracon gen. n.: Bracon lepcha Cameron, 1899; Bracon phaedo Cameron, 1899; Bracon simlaensis Cameron, 1899; Iphiaulax bhotanensis Cameron, 1907; Iphiaulax laertius Cameron, 1903; Iphiaulax leptopterus Cameron, 1903; Iphiaulax lineaticarinatus Cameron, 1907; Ipobracon lissotomus Roman, 1914; Ipobracon maculicosta Enderlein, 1920 and Iphiaulax pallidicornis Roman, 1914. Craspedolcus montezuma (Cameron, 1887) is provisionally transferred to the genus Digonogastra Viereck, 1912. PMID:28325963

  8. Phylogenetic investigation of the genus Raoiella (Prostigmata: Tenuipalpidae): Diversity, distribution, and world invasions

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Raoiella is most well known because of the red palm mite, R. indica, a major pest of palms spreading aggressively throughout the Americas. Not much was known about the biology, geographic origins, or evolutionary history of the genus when R. indica emerged as a major invasive pest. This pa...

  9. A new click beetle genus from the Chilean Central Andes: Bohartina (Coleoptera, Elateridae, Elaterinae)

    PubMed Central

    Arias, Elizabeth T.

    2006-01-01

    Bohartina Arias, a new genus of Elateridae from forests in the Andean Cordillera of Central Chile, is here described and illustrated with 2 species: B. vilchesensis sp. nov. and B. palmae sp. nov. The genus Bohartina belongs to the subfamily Elaterinae and to the tribe Agriotini. PMID:19537982

  10. The South American Dung Beetle Genus Ennearabdus Lansberge (Coleoptera: Scarabaeidae: Scarabaeinae: Eucraniini)

    PubMed Central

    Ocampo, Federico C.

    2010-01-01

    The South American endemic dung beetle genus Ennearabdus Lansberge is revised. Description, diagnosis and illustrations are presented for the only known species of the genus, E. lobocephalus (Harold). A lectotype is designated for Onthophagus lobocephalus Harold, the type species of Ennearabdus. The biology, biogeography, conservation status, and distribution based on the predictive distribution model of E. lobocephalus are also discussed. PMID:20673117

  11. A New Click Beetle Genus from Southern Chile: Llanquihue (Coleoptera, Elateridae, Elaterinae, Pomachiliini)

    PubMed Central

    Arias, Elizabeth T.

    2008-01-01

    Llanquihue, a new genus of Elateridae from Southern Chile, is here described and illustrated with 2 species: Llanquihue vittipennis (Candèze) new comb., and L. carlota sp. nov. The genus Llanquihue belongs to the subfamily Elaterinae and to the tribe Pomachiliini. PMID:20233094

  12. Uncovering the diversity of the neotropical genus Elaphopsocus ('Psocoptera': Psocidae: Amphigerontiinae): from one to ten species.

    PubMed

    Román-Palacios, Cristian; Obando, Ranulfo González; Aldrete, Alfonso N García

    2016-09-09

    For 75 years, the genus Elaphopsocus was considered a monotypic lineage of neotropical psocids. As a result of recent work in South America, this genus presently includes seven species from Brazil and Colombia. We here describe three new species from the East Colombian high Andes.

  13. Haruchlora maesi, a new emerald moth genus and species from Mesoamerica (Lepidoptera, Geometridae, Geometrinae).

    PubMed

    Viidalepp, Jaan; Lindt, Aare

    2014-09-30

    A new genus and species of Neotropical emerald geometrid moths, Haruchlora Viidalepp & Lindt, gen. nov., and Haruchlora maesi Viidalepp & Lindt, sp. nov. are described. The new genus differs from all other New World Geometrinae genera in having a bifid uncus, in characters of the pregenital segments of the male abdomen, and in the male genitalia. 

  14. A new species of the rare African wool carder bee genus Anthidioma (Hymenoptera: Megachilidae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new species of the genus Anthidioma Pasteels (Megachilidae: Anthidiini) is described and figured from a female collected in the Obib Dunes in Namibia. Anthidioma obibense, new species, is differentieated from the only other species of the genus, A. chalicodomoides, on the basis of its integumenta...

  15. A new species of Golinca Thomson (Coleoptera: Scarabaeidae: Cetoniinae): first record of the genus for Brazil.

    PubMed

    Valois, M; Silva, F

    2015-02-16

    Golinca trevisani Valois & Silva, new species (Coleoptera: Scarabaeidae: Cetoniinae: Trichiini: Incina) from Ouro Preto do Oeste, Rondônia, and Amazonas, Brazil is described, representing the first record of the genus Golinca for Brazil. Diagnosis, illustrations of key morphological characters, the first male genitalia description in the genus, and a key for identification of four species of Golinca are provided.

  16. A new genus of the tribe Parahiraciini (Hemiptera: Fulgoromorpha: Issidae) from Hainan Island.

    PubMed

    Meng, Rui; Qin, Daozheng; Wang, Yinglun

    2015-05-12

    A new issid genus in the tribe Parahiraciini (Hemiptera: Fulgoromorpha: Issidae) is erected for Fortunia jianfenglingensis Chen, Zhang et Chang, 2014 (China: Hainan). Male of the species is described and illustrated for the first time. A key for the 15 genera of Parahiraciini is provided. Morphological peculiarity and phylogenetic position of the new genus and the distribution of the tribe Parahiraciini are briefly discussed.

  17. A new genus of mimetic longhorned beetle from St. Lucia, Lesser Antilles (Coleoptera: Cerambycidae: Rhinotragini)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A species originally described as Fortuneleptura romei Touroult 2011 (Lepturinae) is placed in a new genus, Iyanola Lingafelter & Ivie (Cerambycinae: Rhinotragini). Along with the new genus description, the species is redescribed and additional collection data is recorded. A key to the genera and ...

  18. A new genus of predatory katydids (Orthoptera: Tettigoniidae: Listroscelidinae) from the Amazonian Rainforest.

    PubMed

    Mendes, Diego Matheus De Mello; Chamorro-Rengifo, Juliana; Rafael, José Albertino

    2016-09-12

    Most of the predatory katydids Listroscelidini species known were described from the Brazilian Atlantic Forest. Here a new genus and species from the Amazonian Rainforest is described. Based on its morphological characteristics, this new genus represents an intermediate form between two closely related genera, Listroscelis Serville and Monocerophora Walker.

  19. Revision of the southeast Asian soldier-fly genus Parastratiosphecomyia Brunetti, 1923 (Diptera, Stratiomyidae, Pachygastrinae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The genus Parastratiosphecomyia Brunetti is revised with the description of two new species: P. freidbergi Woodley, sp. n. from India and P. rozkosnyi Woodley, sp. n. from Laos and Thailand. All four species in the genus are illustrated and a key to species is provided. Type localities of previous...

  20. The genus Platytenerus Miyatake, 1985 (Coleoptera: Cleridae: Neorthopleurinae), with description of a new species from Japan.

    PubMed

    Murakami, Hiroyuki

    2015-03-23

    The genus Platytenerus Miyatake, 1985 (Coleoptera: Cleridae) is redescribed and classified into the subfamily Neorthopleurinae Opitz, 2009. A phylogenetic tree is supplementally provided for Platytenerus based on twenty morphological and two geographical characters. A new species of the genus, Platytenerus iriomotensis sp. n. is described from Iriomote Island, Okinawa, Japan.