Radiological effluents released and public doses from nuclear power plants in Korea.
Son, Jung Kwon; Kim, Hee Geun; Kong, Tae Young; Ko, Jong Hyun; Lee, Goung Jin
2013-08-01
As of the end of 2010, there were 20 commercially operating nuclear reactors in Korea. Releases of radioactive effluents from nuclear power plants (NPPs) have increased continuously; the total radioactivity of effluent amount released in 2010 was 547.12 TBq. From 2001 to 2010, the annual average radioactivity of gaseous and liquid effluents per reactor was 11.61 TBq for pressurised water reactors and 118.12 TBq for pressurised heavy water reactors. Most of the radioactivity from gaseous and liquid effluents came from tritium. Based on the results of release trends and analyses, the characteristics of effluents have been investigated to improve the management of radioactive effluents from NPPs.
Tritium release during nuclear power operation in China.
Yang, D J; Chen, X Q; Li, B
2012-06-01
Overviews were evaluated of tritium releases and related doses to the public from airborne and liquid effluents from nuclear power plants on the mainland of China before 2009. The differences between tritium releases from various nuclear power plants were also evaluated. The tritium releases are mainly from liquid pathways for pressurised water reactors, but tritium releases between airborne and liquid effluents are comparable for heavy water reactors. The airborne release from a heavy water reactor is obviously higher than that from a pressurised water reactor.
Environmental Releases for Calendar Year 2001
DOE Office of Scientific and Technical Information (OSTI.GOV)
DYEKMAN, D L
2002-08-01
This report fulfills the annual reporting requirements of US Department of Energy (DOE) Order 5400.1, General Environmental Protection Program. The report contains tabular data summaries on air emissions and liquid effluents released to the environment as well as nonroutine releases during calendar year (CY) 2001. These releases, bearing radioactive and hazardous substances, were from Bechtel Hanford, Inc. (BHI), CH2M HILL Hanford Group, Inc. (CHG), and Fluor Hanford (FH) managed facilities and activities. These data were obtained from direct sampling and analysis and from estimates based upon approved release factors. This report further serves as a supplemental resource to the Hanfordmore » Site Environmental Report (HSER PNNL-13910), published by the Pacific Northwest National Laboratory. HSER includes a yearly accounting of the impacts on the surrounding populace and environment from major activities at the Hanford Site. HSER also summarizes the regulatory compliance status of the Hanford Site. Tables ES-1 through ES-5 display comprehensive data summaries of CY2001 air emission and liquid effluent releases. The data displayed in these tables compiles the following: Radionuclide air emissions; Nonradioactive air emissions; Radionuclides in liquid effluents discharged to ground; Total volumes and flow rates of radioactive liquid effluents discharged to ground; and Radionuclides discharged to the Columbia River.« less
Radioactive materials released from nuclear power plants
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Benkovitz, C.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1979 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1979 release data are compared with previous year's releases in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants. Annual report 1978
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Benkovitz, C.
Releases of radioactive materials in airborne and liquid effluents from commerical light water reactors during 1978 have been compiled and reported. Data on soild waste shipments as well as selected operating information have been included. This report supplements earlier annual reports by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1978 release data are compared with previous years releases in tabular form. Data covering specific radionuclides are summarized.
Research on denitrification efficiency of three types of solid carbon source
NASA Astrophysics Data System (ADS)
Cai, Y.; Zhang, J. D.; Li, F.; Cao, Y. X.; Zhu, L. Y.; Xiao, M. S.
2018-01-01
C/N rates can greatly influence efficiency of denitrification. It is difficult for current treated effluent to reach GB18918-2002 primary effluent standard because of its low C/N rate. To improve the efficiency of denitrification, the quality of effluent, and realize the waste recycling, this article selected magnolia leaves, loofah and degradable meal box as the solid carbon source and set different solid-liquid ratio of magnolia leaves for periodic denitrification stage to study the change of NO3 --N, TN, COD, NO2 --N, NH4 +, PO4 3- and color. The results showed that in the condition of influent nitrate concentration of 40 mg/L, carbon dosage of 10 g, the reaction temperature of 25°C, the nitrate removal rates of magnolia leaves and loofah reached 89.0% and 96.8% respectively, rather higher than degradable meal box (56.3%). The TN removal rates of magnolia leaves (91.7%) and loofah (77.7%) were both higher than degradable meal box (53.9%), and the effluent TN concentration of loofah and degradable meal box reached 25.4 mg/L and 21.1 mg/L respectively, which couldn’t be discharged according to the primary effluent concentration standard of GB18918-2002. The released concentration of ammonia nitrogen and phosphate: loofah> magnolia> degradable meal box. The high solid-liquid ratio of magnolia leaves helped to improve the TN removal rate, which reached 75.0% (1:200) and 91.7% (1:100), but it caused higher released concentration of carbon, ammonia nitrogen and phosphate to effect system heavily. Under the integrated analysis, the low solid-liquid ratio (1:200) of magnolia leaves was more suitable to be the denitrification external carbon source.
Radioactive materials released from nuclear power plants. Annual report, 1980
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Benkovitz, C.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1980 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1980 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Norden, K.; Congemi, J.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1987 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1987 release data are summarized in tabular form. Data covering specific radionuclides are summarized. 16 tabs.
Radioactive materials released from nuclear power plants: Annual report, 1984
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Norden, K.; Congemi, J.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1984 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1984 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants: Annual report, 1985
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Norden, K.; Congemi, J.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1985 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1985 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Norden, K.; Congemi, J.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1988 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1988 release data are summarized in tabular form. Data covering specific radionuclides are summarized. 16 tabs.
Radioactive materials released from nuclear power plants. Annual report 1991, Volume 12
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Doty, K.; Congemi, J.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1991 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1991 release data are summarized in tabular form. Data Covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants. Annual report, 1982. Volume 3
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Norden, K.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1982 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1982 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants. Volume 11: Annual report, 1990
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Doty, K.; Congemi, J.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1990 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1990 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants. Annual report 1981. Vol. 2
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Benkovitz, C.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1981 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1981 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants. Annual report, 1983. Volume 4
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Norden, K.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1983 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1983 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants. Volume 13, Annual report 1992
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Doty, K.; Lucadamo, K.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1992 have been compiled and reported. The summary data for the years 1973 through 1991 are included for comparison. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1992 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants. Annual report 1989: Volume 10
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Norden, K.; Congemi, J.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1989 have been compiled and reported. The summary data for the years 1970 through 1988 are included for comparison. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1989 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Radioactive materials released from nuclear power plants: Annual report, 1993. Volume 14
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.; Doty, K.; Lucadamo, K.
Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1993 have been compiled and reported. The summary data for the years 1974 through 1992 are included for comparison. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1993 release data are summarized in tabular form. Data covering specific radionuclides are summarized.
Pollution characterization of liquid waste of the factory complex Fertial (Arzew, Algeria).
Redouane, Fares; Mourad, Lounis
2016-03-01
The industrial development in Algeria has made a worrying situation for all socioeconomic stakeholders. Indeed, this economic growth is marked in recent years by the establishment of factories and industrial plants that discharge liquid waste in marine shorelines. These releases could destabilize the environmental balance in the coming years, hence the need to support the processing of all sources of pollution. Remediation of such discharges requires several steps of identifying the various pollutants to their treatments. Therefore, the authors conducted this first work of characterization of industrial effluents generated by the mineral fertilizer factory complex Fertial (Arzew), and discussed the pollution load generated by this type of industry. This monitoring would establish a tool for reflection and decision support developed by a management system capable of ensuring effective and sustainable management of effluents from industrial activities of Fertial. The authors conducted this first work of characterization of industrial effluents generated by the mineral fertilizer factory complex Fertial (Arzew), and discussed the pollution load generated by this type of industry. This monitoring would establish a tool for reflection and decision support developed by a management system capable of ensuring effective and sustainable management of effluents from industrial activities of Fertial.
Code of Federal Regulations, 2011 CFR
2011-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.32 Effluent limitations guidelines representing the degree of effluent... application of the best practicable control technology currently available (BPT): (a) Any liquid cane sugar...
Code of Federal Regulations, 2010 CFR
2010-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.32 Effluent limitations guidelines representing the degree of effluent... application of the best practicable control technology currently available (BPT): (a) Any liquid cane sugar...
Code of Federal Regulations, 2013 CFR
2013-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.32 Effluent limitations guidelines representing the degree of effluent... application of the best practicable control technology currently available (BPT): (a) Any liquid cane sugar...
Code of Federal Regulations, 2014 CFR
2014-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.32 Effluent limitations guidelines representing the degree of effluent... application of the best practicable control technology currently available (BPT): (a) Any liquid cane sugar...
Code of Federal Regulations, 2012 CFR
2012-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.32 Effluent limitations guidelines representing the degree of effluent... application of the best practicable control technology currently available (BPT): (a) Any liquid cane sugar...
Analysis of effluent after anaerobic digestion of liquid phase separated from liquidized garbage.
Inoue, Seiichi; Tsukahara, Kenichiro; Sawayama, Shigeki
2002-01-01
The organic compositions of the liquid phase separated from liquidized garbage as the influent and its effluent after anaerobic digestion at an overloading rate were analyzed. A large amount of organic acids was found in the effluent. The accumulation of organic acids suggests that the rate of methanogenesis is lower than that of acidogenesis.
Radiological effluents released from US continental tests, 1961 through 1992. Revision 1
DOE Office of Scientific and Technical Information (OSTI.GOV)
Schoengold, C.R.; DeMarre, M.E.; Kirkwood, E.M.
1996-08-01
This report documents all continental tests from September 15, 1961, through September 23, 1992, from which radioactive effluents were released. The report includes both updated information previously published in the publicly available May, 1990 report, DOE/NV-317, ``Radiological Effluents Released from Announced US Continental Tests 1961 through 1988``, and effluent release information on formerly unannounced tests. General information provided for each test includes the date, time, location, type of test, sponsoring laboratory and/or agency or other sponsor, depth of burial, purpose, yield or yield range, extent of release (onsite only or offsite), and category of release (detonation-time versus post-test operations). Wheremore » a test with simultaneous detonations is listed, location, depth of burial and yield information are given for each detonation if applicable, as well as the specific source of the release. A summary of each release incident by type of release is included. For a detonation-time release, the effluent curies are expressed at R+12 hours. For a controlled releases from tunnel-tests, the effluent curies are expressed at both time of release and at R+12 hours. All other types are listed at the time of the release. In addition, a qualitative statement of the isotopes in the effluent is included for detonation-time and controlled releases and a quantitative listing is included for all other types. Offsite release information includes the cloud direction, the maximum activity detected in the air offsite, the maximum gamma exposure rate detected offsite, the maximum iodine level detected offsite, and the maximum distance radiation was detected offsite. A release summary incudes whatever other pertinent information is available for each release incident. This document includes effluent release information for 433 tests, some of which have simultaneous detonations. However, only 52 of these are designated as having offsite releases.« less
WASTE TREATMENT PLANT (WTP) LIQUID EFFLUENT TREATABILITY EVALUATION
DOE Office of Scientific and Technical Information (OSTI.GOV)
LUECK, K.J.
2004-10-18
A forecast of the radioactive, dangerous liquid effluents expected to be produced by the Waste Treatment Plant (WTP) was provided by Bechtel National, Inc. (BNI 2004). The forecast represents the liquid effluents generated from the processing of Tank Farm waste through the end-of-mission for the WTP. The WTP forecast is provided in the Appendices. The WTP liquid effluents will be stored, treated, and disposed of in the Liquid Effluent Retention Facility (LERF) and the Effluent Treatment Facility (ETF). Both facilities are located in the 200 East Area and are operated by Fluor Hanford, Inc. (FH) for the US. Department ofmore » Energy (DOE). The treatability of the WTP liquid effluents in the LERF/ETF was evaluated. The evaluation was conducted by comparing the forecast to the LERF/ETF treatability envelope (Aromi 1997), which provides information on the items which determine if a liquid effluent is acceptable for receipt and treatment at the LERF/ETF. The format of the evaluation corresponds directly to the outline of the treatability envelope document. Except where noted, the maximum annual average concentrations over the range of the 27 year forecast was evaluated against the treatability envelope. This is an acceptable approach because the volume capacity in the LERF Basin will equalize the minimum and maximum peaks. Background information on the LERF/ETF design basis is provided in the treatability envelope document.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
Cantrell, Kirk J.; Westsik, Joseph H.; Serne, R Jeffrey
A review of the most up-to-date and relevant data currently available was conducted to develop a set of recommended values for use in the Integrated Disposal Facility (IDF) performance assessment (PA) to model contaminant release from a cementitious waste form for aqueous wastes treated at the Hanford Effluent Treatment Facility (ETF). This data package relies primarily upon recent data collected on Cast Stone formulations fabricated with simulants of low-activity waste (LAW) and liquid secondary wastes expected to be produced at Hanford. These data were supplemented, when necessary, with data developed for saltstone (a similar grout waste form used at themore » Savannah River Site). Work is currently underway to collect data on cementitious waste forms that are similar to Cast Stone and saltstone but are tailored to the characteristics of ETF-treated liquid secondary wastes. Recommended values for key parameters to conduct PA modeling of contaminant release from ETF-treated liquid waste are provided.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
Tichler, J.L.
Information on release of radioactive materials in airborne and liquid effluents, solid waste shipments and selected operating information from commercial nuclear power plants in the United States is maintained in a computer data base at Brookhaven National Laboratory (BNL) for the United States Nuclear Regulatory Commission (USNRC). The information entered into the data base is obtained from semiannual reports submitted by the operators of the plants to the USNRC in compliance with the USNRC Regulatory Guide 1.21, ''Measuring, Evaluating, and Reporting Radioactivity in Solid Wastes and Releases of Radioactive Materials in Liquid and Gaseous Effluents from Light-Water-Cooled Nuclear Power Plants.''more » The data on releases in the calendar year 1986 include information from 69 plants representing 87 reactors and contain approximately 19,000 entries. Since all the information is contained in a computer data base management system, entry and rapidly respond to inquiries about the data set and to generate computer readable subsets of the data. Such a subset is used as input to the computer program which generates the annual report, ''Population Dose Commitments Due to Radioactive Releases from Nuclear Power Plant Sites,'' prepared by Pacific Northwest Laboratory for the USNRC. BNL began maintaining this data base for the USNRC with the 1978 information and has added information to the data base for each succeeding year. An annual report summarizing the information for each year, prepared by BNL, and published by the USNRC, is available to the general public. Prior to 1978, annual reports were prepared by the USNRC and are available for the years 1972--1977; however, the information for these years is not in a computer accessible data base.« less
Fluorochemical Mass Flows in a Municipal Wastewater Treatment Facility
Schultz, Melissa M.; Higgins, Christopher P.; Huset, Carin A.; Luthy, Richard G.; Barofsky, Douglas F.; Field, Jennifer A.
2008-01-01
Fluorochemicals have widespread applications and are released into municipal wastewater treatment plants via domestic wastewater. A field study was conducted at a full-scale municipal wastewater treatment plant to determine the mass flows of selected fluorochemicals. Flow-proportional, 24-h samples of raw influent, primary effluent, trickling filter effluent, secondary effluent, and final effluent and grab samples of primary, thickened, activated, and anaerobically-digested sludge were collected over ten days and analyzed by liquid chromatography electrospray-ionization tandem mass spectrometry. Significant decreases in the mass flows of perfluorohexane sulfonate and perfluorodecanoate occurred during trickling filtration and primary clarification, while activated sludge treatment decreased the mass flow of perfluorohexanoate. Mass flows of the 6:2 fluorotelomer sulfonate and perfluorooctanoate were unchanged as a result of wastewater treatment, which indicates that conventional wastewater treatment is not effective for removal of these compounds. A net increase in the mass flows for perfluorooctane and perfluorodecane sulfonates occurred from trickling filtration and activated sludge treatment. Mass flows for perfluoroalkylsulfonamides and perfluorononanoate also increased during activated sludge treatment and are attributed to degradation of precursor molecules. PMID:17180988
Liquid secondary waste: Waste form formulation and qualification
DOE Office of Scientific and Technical Information (OSTI.GOV)
Cozzi, A. D.; Dixon, K. L.; Hill, K. A.
The Hanford Site Effluent Treatment Facility (ETF) currently treats aqueous waste streams generated during site cleanup activities. When the Hanford Tank Waste Treatment and Immobilization Plant (WTP) begins operations, including Direct Feed Low Activity Waste (DFLAW) vitrification, a liquid secondary waste (LSW) stream from the WTP will need to be treated. The volume of effluent for treatment at the ETF will increase significantly. The powdered salt waste form produced by the ETF will be replaced by a stabilized solidified waste form for disposal in Hanford’s Integrated Disposal Facility (IDF). Washington River Protection Solutions is implementing a Secondary Liquid Waste Immobilizationmore » Technology Development Plan to address the technology needs for a waste form and solidification process to treat the increased volume of waste planned for disposal at the IDF. Waste form testing to support this plan is composed of work in the near term to provide data as input to a performance assessment (PA) for Hanford’s IDF. In 2015, three Hanford Liquid Secondary Waste simulants were developed based on existing and projected waste streams. Using these waste simulants, fourteen mixes of Hanford Liquid Secondary Waste were prepared and tested varying the waste simulant, the water-to-dry materials ratio, and the dry materials blend composition.1 In FY16, testing was performed using a simulant of the EMF process condensate blended with the caustic scrubber—from the Low Activity Waste (LAW) melter—, processed through the ETF. The initial EMF-16 simulant will be based on modeling efforts performed to determine the mass balance of the ETF for the DFLAW.2 The compressive strength of all of the mixes exceeded the target of 3.4 MPa (500 psi) to meet the requirements identified as potential IDF Waste Acceptance Criteria in Table 1 of the Secondary Liquid Waste Immobilization Technology Development Plan.3 The hydraulic properties of the waste forms tested (hydraulic conductivity and water characteristic curves) were comparable to the properties measured on the Savannah River Site (SRS) Saltstone waste form. Future testing should include efforts to first; 1) determine the rate and amount of ammonia released during each unit operation of the treatment process to determine if additional ammonia management is required, then; 2) reduce the ammonia content of the ETF concentrated brine prior to solidification, making the waste more amenable to grouting, or 3) manage the release of ammonia during production and ongoing release during storage of the waste form, or 4) develop a lower pH process/waste form thereby precluding ammonia release.« less
Coal hydrogenation and deashing in ebullated bed catalytic reactor
Huibers, Derk T. A.; Johanson, Edwin S.
1983-01-01
An improved process for hydrogenation of coal containing ash with agglomeration and removal of ash from an ebullated bed catalytic reactor to produce deashed hydrocarbon liquid and gas products. In the process, a flowable coal-oil slurry is reacted with hydrogen in an ebullated catalyst bed reaction zone at elevated temperature and pressure conditions. The upward velocity and viscosity of the reactor liquid are controlled so that a substantial portion of the ash released from the coal is agglomerated to form larger particles in the upper portion of the reactor above the catalyst bed, from which the agglomerated ash is separately withdrawn along with adhering reaction zone liquid. The resulting hydrogenated hydrocarbon effluent material product is phase separated to remove vapor fractions, after which any ash remaining in the liquid fraction can be removed to produce substantially ash-free coal-derived liquid products.
Assessment of uranium release to the environment from a disabled uranium mine in Brazil.
Pereira, Wagner de Souza; Kelecom, Alphonse Germaine Albert Charles; da Silva, Ademir Xavier; do Carmo, Alessander Sá; Py Júnior, Delcy de Azavedo
2018-08-01
The Ore Treatment Unit (in Portuguese Unidade de Tratamento de Minérios - UTM) located in Caldas, MG, Brazil is a disabled uranium mine. Environmental conditions generate acid drainage leaching metals and radionuclides from the waste rock pile. This drainage is treated to remove the heavy metals and radionuclides, before allowing the release of the effluent to the environment. To validate the treatment, samples of the released effluents were collected at the interface of the installation with the environment. Sampling was carried out from 2010 to 2015, and the activity concentration (AC, in Bq·l -1 ) of uranium in the liquid effluent was analyzed by arzenazo UV-Vis spectrophotometry of the soluble and particulate fractions, and of the sum of both fractions. Descriptive statistics, Z test and Pearson R 2 correlation among the fractions were performed. Then, the data were organized by year and both ANOVA and Tukey test were carried out to group the means by magnitude of AC. The annual mean ranged from 0.02 Bq·l -1 in 2015 to 0.11 Bq·l -1 in 2010. The soluble fraction showed a higher AC mean when compared to the mean of the particulate fraction and no correlation of the data could be observed. Concerning the magnitude of the release, the ANOVA associated with the Tukey test, identified three groups of annual means (AC 2010 > AC 2011 = AC 2012 = AC 2013 = AC 2014 > AC 2015 ). The mean values of uranium release at the interface installation-environment checking point (point 014) were within the Authorized Annual Limit (AAL) set by the regulator (0.2 Bq·l -1 ) indicating compliance of treatment with the licensing established for the unit. Finally, the data showed a decreasing tendency of U release. Copyright © 2017 Elsevier Ltd. All rights reserved.
Method of recovering adsorbed liquid compounds from molecular sieve columns
Burkholder, H.R.; Fanslow, G.E.
1983-12-20
Molecularly adsorbed volatile liquid compounds are recovered from molecular sieve adsorbent columns by directionally applying microwave energy to the bed of the adsorbent to produce a mixed liquid-gas effluent. The gas portion of the effluent generates pressure within the bed to promote the discharge of the effluent from the column bottoms. Preferably the discharged liquid-gas effluent is collected in two to three separate fractions, the second or intermediate fraction having a substantially higher concentration of the desorbed compound than the first or third fractions. The desorption does not need to be assisted by passing a carrier gas through the bed or by applying reduced pressure to the outlet from the bed. 8 figs.
Method of recovering adsorbed liquid compounds from molecular sieve columns
Burkholder, Harvey R.; Fanslow, Glenn E.
1983-01-01
Molecularly adsorbed volatile liquid compounds are recovered from molecular sieve adsorbent columns by directionally applying microwave energy to the bed of the adsorbent to produce a mixed liquid-gas effluent. The gas portion of the effluent generates pressure within the bed to promote the discharge of the effluent from the column bottoms. Preferably the discharged liquid-gas effluent is collected in two to three separate fractions, the second or intermediate fraction having a substantially higher concentration of the desorbed compound than the first or third fractions. The desorption does not need to be assisted by passing a carrier gas through the bed or by applying reduced pressure to the outlet from the bed.
Oak Ridge Reservation annual site environmental report for 1996
DOE Office of Scientific and Technical Information (OSTI.GOV)
NONE
1997-10-01
The US Department of Energy currently oversees activities on the Oak Ridge Reservation (ORR), a government-owned, contractor-operated facility. Three sites compose the reservation: the Oak Ridge Y-12 Plant, Oak Ridge National Laboratory, and East Tennessee Technology Park (formerly the K-25 Site). The ORR was established in the early 1940s as part of the Manhattan Project, a secret undertaking that produced the materials for the first atomic bombs. The reservation`s role has evolved over the years, and it continues to adapt to meet the changing defense, energy, and research needs of the US. Both the work carried out for the warmore » effort and subsequent research, development, and production activities have produced (and continue to produce) radiological and hazardous wastes. This document contains a summary of environmental monitoring activities on the ORR and its surroundings. Environmental monitoring on the ORR consists of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents prior to release into the environment; these measurements allow the quantification and official reporting of contaminants, assessment of radiation exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of the collection and analysis of environmental samples from the site and its environs; this provides direct measurement of contaminants in air, water, groundwater, soil, foods, biota, and other media subsequent to effluent release into the environment. Environmental surveillance data verify ORR`s compliance status and, combined with data from effluent monitoring, allow the determination of chemical and radiation dose/exposure assessment of ORR operations and effects, if any, on the local environment.« less
Encapsulated liquid sorbents for carbon dioxide capture
NASA Astrophysics Data System (ADS)
Vericella, John J.; Baker, Sarah E.; Stolaroff, Joshuah K.; Duoss, Eric B.; Hardin, James O.; Lewicki, James; Glogowski, Elizabeth; Floyd, William C.; Valdez, Carlos A.; Smith, William L.; Satcher, Joe H.; Bourcier, William L.; Spadaccini, Christopher M.; Lewis, Jennifer A.; Aines, Roger D.
2015-02-01
Drawbacks of current carbon dioxide capture methods include corrosivity, evaporative losses and fouling. Separating the capture solvent from infrastructure and effluent gases via microencapsulation provides possible solutions to these issues. Here we report carbon capture materials that may enable low-cost and energy-efficient capture of carbon dioxide from flue gas. Polymer microcapsules composed of liquid carbonate cores and highly permeable silicone shells are produced by microfluidic assembly. This motif couples the capacity and selectivity of liquid sorbents with high surface area to facilitate rapid and controlled carbon dioxide uptake and release over repeated cycles. While mass transport across the capsule shell is slightly lower relative to neat liquid sorbents, the surface area enhancement gained via encapsulation provides an order-of-magnitude increase in carbon dioxide absorption rates for a given sorbent mass. The microcapsules are stable under typical industrial operating conditions and may be used in supported packing and fluidized beds for large-scale carbon capture.
Xu, Fuqing; Shi, Jian; Lv, Wen; Yu, Zhongtang; Li, Yebo
2013-01-01
Effluents from three liquid anaerobic digesters, fed with municipal sewage sludge, food waste, or dairy waste, were evaluated as inocula and nitrogen sources for solid-state batch anaerobic digestion of corn stover in mesophilic reactors. Three feedstock-to-effluent (F/E) ratios (i.e., 2, 4, and 6) were tested for each effluent. At an F/E ratio of 2, the reactor inoculated by dairy waste effluent achieved the highest methane yield of 238.5L/kg VS(feed), while at an F/E ratio of 4, the reactor inoculated by food waste effluent achieved the highest methane yield of 199.6L/kg VS(feed). The microbial population and chemical composition of the three effluents were substantially different. Food waste effluent had the largest population of acetoclastic methanogens, while dairy waste effluent had the largest populations of cellulolytic and xylanolytic bacteria. Dairy waste also had the highest C/N ratio of 8.5 and the highest alkalinity of 19.3g CaCO(3)/kg. The performance of solid-state batch anaerobic digestion reactors was closely related to the microbial status in the liquid anaerobic digestion effluents. Copyright © 2012 Elsevier Ltd. All rights reserved.
Case, F.N.; Ketchen, E.E.
1975-10-14
A method is provided for treating organic waste material dissolved or dispersed in an aqueous effluent, which comprises contacting the effluent with an inert particulate carbonaceous sorbent at an oxygen pressure up to 2000 psi, irradiating the resultant mixture with high energy radiation until a decolorized liquid is produced, and then separating the decolorized liquid.
Liedl, B E; Bombardiere, J; Chaffield, J M
2006-01-01
Thermophilic anaerobic treatment of poultry litter produces an effluent stream of digested materials that can be separated into solid and liquid fractions for use as a crop fertilizer. The majority of the phosphorus is partitioned into the solid fraction while the majority of the nitrogen is present in the liquid fraction in the form of ammonium. These materials were tested over six years as an alternative fertilizer for the production of vegetable, fruit, and grassland crops. Application of the solids as a field crop fertilizer for vegetables and blueberries resulted in lower yields than the other fertilizer treatments, but an increase in soil phosphorus over a four-year period. Application of the digested liquids on grass and vegetable plots resulted in similar or superior yields to plots treated with commercially available nitrogen fertilizers. Hydroponic production of lettuce using liquid effluent was comparable to a commercial hydroponic fertilizer regime; however, the effluent treatment for hydroponic tomato production required supplementation and conversion of ammonium to nitrate. While not a total fertilizer solution, our research shows the effectiveness of digested effluent as part of a nutrient management program which could turn a livestock residuals problem into a crop nutrient resource.
Code of Federal Regulations, 2012 CFR
2012-07-01
... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.83 Effluent limitations guidelines representing the degree of...
Code of Federal Regulations, 2011 CFR
2011-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.82 Effluent limitations guidelines representing the...
Code of Federal Regulations, 2010 CFR
2010-07-01
... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.83 Effluent limitations guidelines representing the degree of...
Code of Federal Regulations, 2012 CFR
2012-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.82 Effluent limitations guidelines representing the...
Code of Federal Regulations, 2013 CFR
2013-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.82 Effluent limitations guidelines representing the...
Code of Federal Regulations, 2014 CFR
2014-07-01
... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.83 Effluent limitations guidelines representing the degree of...
Code of Federal Regulations, 2014 CFR
2014-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.82 Effluent limitations guidelines representing the...
Code of Federal Regulations, 2011 CFR
2011-07-01
... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.83 Effluent limitations guidelines representing the degree of...
Code of Federal Regulations, 2010 CFR
2010-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.82 Effluent limitations guidelines representing the...
Code of Federal Regulations, 2013 CFR
2013-07-01
... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.83 Effluent limitations guidelines representing the degree of...
Method of purifying a gas stream using 1,2,3-triazolium ionic liquids
Luebke, David; Nulwala, Hunald; Tang, Chau
2014-12-09
A method for separating a target gas from a gaseous mixture using 1,2,3-triazolium ionic liquids is presented. Industrial effluent streams may be cleaned by removing carbon dioxide from the stream by contacting the effluent stream with a 1,2,3-triazolium ionic liquid compound.
Zhang, Chunhui; Ning, Ke; Zhang, Wenwen; Guo, Yuanjie; Chen, Jun; Liang, Chen
2013-04-01
Increased attention is currently being directed towards the potential negative effects of antibiotics and other PPCPs discharged into the aquatic environment via municipal WWTP secondary effluents. A number of analytical methods, such as high performance liquid chromatography technologies, including a high performance liquid chromatography-fluorescence method (HPLC-FLD), high performance liquid chromatography-UV detection method (HPLC-UV) and high performance liquid chromatography-mass spectrometry method (HPLC-MS), have been suggested as determination technologies for antibiotic residues in water. In this study, we implement a HPLC-MS/MS combined method to detect and analyze antibiotics in WWTP secondary effluent and apply a horizontal subsurface flow constructed wetland (CW) as an advanced wastewater treatment for removing antibiotics in the WWTP secondary effluent. The results show that there were 2 macrolides, 2 quinolones and 5 sulfas in WWTP secondary effluent among all the 22 antibiotics considered. After the CW advanced treatment, the concentration removal efficiencies and removal loads of 9 antibiotics were 53-100% and 0.004-0.7307 μg m(-2) per day, respectively.
Producing Newborn Synchronous Mammalian Cells
NASA Technical Reports Server (NTRS)
Gonda, Steve R.; Helmstetter, Charles E.; Thornton, Maureen
2008-01-01
A method and bioreactor for the continuous production of synchronous (same age) population of mammalian cells have been invented. The invention involves the attachment and growth of cells on an adhesive-coated porous membrane immersed in a perfused liquid culture medium in a microgravity analog bioreactor. When cells attach to the surface divide, newborn cells are released into the flowing culture medium. The released cells, consisting of a uniform population of synchronous cells are then collected from the effluent culture medium. This invention could be of interest to researchers investigating the effects of the geneotoxic effects of the space environment (microgravity, radiation, chemicals, gases) and to pharmaceutical and biotechnology companies involved in research on aging and cancer, and in new drug development and testing.
Oak Ridge Reservation Annual Site Environmental Report, 2003
DOE Office of Scientific and Technical Information (OSTI.GOV)
Hughes, JF
2004-08-24
This document is prepared annually to summarize environmental activities, primarily environmental-monitoring activities, on the ORR and within the ORR surroundings. The document fulfills the requirement of U.S. Department of Energy (DOE) Order 231.1, ''Environment, Safety and Health Reporting,'' for an annual summary of environmental data to characterize environmental performance. The environmental monitoring criteria are described in DOE Order 450.1, ''Environmental Protection Program''. The results summarized in this report are based on data collected prior to and through 2003. This report is not intended to provide the results of all sampling on the ORR. Additional data collected for other site andmore » regulatory purposes, such as environmental restoration remedial investigation reports, waste management characterization sampling data, and environmental permit compliance data, are presented in other documents that have been prepared in accordance with applicable DOE guidance and/or laws. Corrections to the report for the previous year are found in Appendix A. Environmental monitoring on the ORR consists primarily of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents at the point of release to the environment; these measurements allow the quantification and official reporting of contaminants, assessment of radiation and chemical exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of the collection and analysis of environmental samples from the site and its environs; these activities provide direct measurement of contaminants in air, water, groundwater, soil, foods, biota, and other media subsequent to effluent release into the environment. Environmental surveillance data provide information regarding conformity with applicable DOE orders and, combined with data from effluent monitoring, allow the determination of chemical and radiation dose/exposure assessments of ORR operations and effects, if any, on the local environment.« less
Oak Ridge Reservation Annual Site Environmental Report for 2003
DOE Office of Scientific and Technical Information (OSTI.GOV)
None
2004-09-30
This document is prepared annually to summarize environmental activities, primarily environmental-monitoring activities, on the ORR and within the ORR surroundings. The document fulfills the requirement of U.S. Department of Energy (DOE) Order 231.1, “Environment, Safety and Health Reporting,” for an annual summary of environmental data to characterize environmental performance. The environmental monitoring criteria are described in DOE Order 450.1, “Environmental Protection Program.” The results summarized in this report are based on data collected prior to and through 2003. This report is not intended to provide the results of all sampling on the ORR. Additional data collected for other site andmore » regulatory purposes, such as environmental restoration remedial investigation reports, waste management characterization sampling data, and environmental permit compliance data, are presented in other documents that have been prepared in accordance with applicable DOE guidance and/or laws. Corrections to the report for the previous year are found in Appendix A. Environmental monitoring on the ORR consists primarily of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents at the point of release to the environment; these measurements allow the quantification and official reporting of contaminants, assessment of radiation and chemical exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of the collection and analysis of environmental samples from the site and its environs; these activities provide direct measurement of contaminants in air, water, groundwater, soil, foods, biota, and other media subsequent to effluent release into the environment. Environmental surveillance data provide information regarding conformity with applicable DOE orders and, combined with data from effluent monitoring, allow the determination of chemical and radiation dose/exposure assessments of ORR operations and effects, if any, on the local environment.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
Xu Fuqing; Shi Jian; Lv Wen
2013-01-15
Highlights: Black-Right-Pointing-Pointer Compared methane production of solid AD inoculated with different effluents. Black-Right-Pointing-Pointer Food waste effluent (FWE) had the largest population of acetoclastic methanogens. Black-Right-Pointing-Pointer Solid AD inoculated with FWE produced the highest methane yield at F/E ratio of 4. Black-Right-Pointing-Pointer Dairy waste effluent (DWE) was rich of cellulolytic and xylanolytic bacteria. Black-Right-Pointing-Pointer Solid AD inoculated with DWE produced the highest methane yield at F/E ratio of 2. - Abstract: Effluents from three liquid anaerobic digesters, fed with municipal sewage sludge, food waste, or dairy waste, were evaluated as inocula and nitrogen sources for solid-state batch anaerobic digestion of cornmore » stover in mesophilic reactors. Three feedstock-to-effluent (F/E) ratios (i.e., 2, 4, and 6) were tested for each effluent. At an F/E ratio of 2, the reactor inoculated by dairy waste effluent achieved the highest methane yield of 238.5 L/kgVS{sub feed}, while at an F/E ratio of 4, the reactor inoculated by food waste effluent achieved the highest methane yield of 199.6 L/kgVS{sub feed}. The microbial population and chemical composition of the three effluents were substantially different. Food waste effluent had the largest population of acetoclastic methanogens, while dairy waste effluent had the largest populations of cellulolytic and xylanolytic bacteria. Dairy waste also had the highest C/N ratio of 8.5 and the highest alkalinity of 19.3 g CaCO{sub 3}/kg. The performance of solid-state batch anaerobic digestion reactors was closely related to the microbial status in the liquid anaerobic digestion effluents.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
Coenenberg, J.G.
1997-08-15
The Hanford Facility Dangerous Waste Permit Application is considered to 10 be a single application organized into a General Information Portion (document 11 number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the 12 Unit-Specific Portion is limited to Part B permit application documentation 13 submitted for individual, `operating` treatment, storage, and/or disposal 14 units, such as the Liquid Effluent Retention Facility and 200 Area Effluent 15 Treatment Facility (this document, DOE/RL-97-03). 16 17 Both the General Information and Unit-Specific portions of the Hanford 18 Facility Dangerous Waste Permit Application address the content of the Part B 19 permit applicationmore » guidance prepared by the Washington State Department of 20 Ecology (Ecology 1987 and 1996) and the U.S. Environmental Protection Agency 21 (40 Code of Federal Regulations 270), with additional information needs 22 defined by the Hazardous and Solid Waste Amendments and revisions of 23 Washington Administrative Code 173-303. For ease of reference, the Washington 24 State Department of Ecology alpha-numeric section identifiers from the permit 25 application guidance documentation (Ecology 1996) follow, in brackets, the 26 chapter headings and subheadings. A checklist indicating where information is 27 contained in the Liquid Effluent Retention Facility and 200 Area Effluent 28 Treatment Facility permit application documentation, in relation to the 29 Washington State Department of Ecology guidance, is located in the Contents 30 Section. 31 32 Documentation contained in the General Information Portion is broader in 33 nature and could be used by multiple treatment, storage, and/or disposal units 34 (e.g., the glossary provided in the General Information Portion). Wherever 35 appropriate, the Liquid Effluent Retention Facility and 200 Area Effluent 36 Treatment Facility permit application documentation makes cross-reference to 37 the General Information Portion, rather than duplicating text. 38 39 Information provided in this Liquid Effluent Retention Facility and 40 200 Area Effluent Treatment Facility permit application documentation is 41 current as of June 1, 1997.« less
Jones-Lepp, T. L.; Alvarez, D.A.; Petty, J.D.; Huckins, J.N.
2004-01-01
The purpose of the research presented in this paper was twofold: (1) to demonstrate the coupling of two state-of-the-art techniques: a time-weighted polar organic chemical integrative sampler (POCIS) and microliquid chromatography–electrospray/ion-trap mass spectrometry and (2) to assess the ability of these methodologies to detect six drugs (azithromycin, fluoxetine, omeprazole, levothyroxine, methamphetamine, methylenedioxymethamphetamine [MDMA]) in a real-world environment, e.g., waste water effluent. In the effluent from three wastewater treatment plants (WWTPs), azithromycin was detected at concentrations ranging from 15 to 66 ng/L, which is equivalent to a total annual release of 1 to 4 kg into receiving waters. Detected and confirmed in the effluent from two WWTPs were two illicit drugs, methamphetamine and MDMA, at 2 and 0.5 ng/L, respectively. Although the ecotoxicologic significance of drugs in environmental matrices, particularly water, has not been closely examined, it can only be surmised that these substances have the potential to adversely affect biota that are continuously exposed to them even at very low levels. The potential for chronic effects on human health is also unknown but of increasing concern because of the multiuse character of water, particularly in densely populated, arid areas.
Schlereth, Tanja; Birklein, Frank; Haack, Katrin an; Schiffmann, Susanne; Kilbinger, Heinz; Kirkpatrick, Charles James; Wessler, Ignaz
2005-01-01
Acetylcholine is synthesized in the majority of non-neuronal cells, for example in human skin. In the present experiments, the in vivo release of acetylcholine was measured by dermal microdialysis. Two microdialysis membranes were inserted intradermally at the medial shank of volunteers. Physiological saline containing 1 μM neostigmine was perfused at a constant rate of 4 μl min−1 and the effluent was collected in six subsequent 20 min periods. Acetylcholine was measured by high-pressure liquid chromatography (HPLC) combined with bioreactors and electrochemical detection. Analysis of the effluent by HPLC showed an acetylcholine peak that disappeared, when the analytical column was packed with acetylcholine-specific esterase, confirming the presence of acetylcholine. In the absence of neostigmine, 71±51 pmol acetylcholine (n=4) was found during a 120 min period. The amount increased to 183±43 pmol (n=34), when the perfusion medium contained 1 μM neostigmine. Injection of 100 MU botulinum toxin subcutaneously blocked sweating completely, but the release of acetylcholine was not affected (botulinum toxin treated skin: 116±70 pmol acetylcholine/120 min; untreated skin: 50±20 pmol; n=4). Quinine (1 mM), inhibitor of organic cation transporters, and carnitine (0.1 mM), substrate of the Na+-dependent carnitine transporter OCTN2, tended to reduce acetylcholine release (by 40%, not significant). Our experiments demonstrate, for the first time, the in vivo release of non-neuronal acetylcholine in human skin. Organic cation transporters are not predominantly involved in the release of non-neuronal acetylcholine from the human skin. PMID:16273117
Makoś, Patrycja; Fernandes, André; Boczkaj, Grzegorz
2018-06-01
We present a new method for simultaneous determination of 22 monoaromatic and polycyclic aromatic hydrocarbons in postoxidative effluents from the production of petroleum bitumen using dispersive liquid-liquid microextraction coupled to gas chromatography and mass spectrometry. The eight extraction parameters including the type and volume of extraction and disperser solvent, pH, salting out effect, extraction, and centrifugation time were optimized. The low detection limit ranging from 0.36 to 28 μg/L, limit of quantitation (1.1-84 μg/L), good reproducibility, and wide linear ranges, as well as the recoveries ranging from 71.74 to 114.67% revealed that the new method allows the determination of aromatic hydrocarbons at low concentration levels in industrial effluents having a very complex composition. The developed method was applied to the determination of content of mono- and polycyclic aromatic hydrocarbons in samples of raw postoxidative effluents in which 15 compounds were identified at concentrations ranging from 1.21 to 1017.0 μg/L as well as in effluents after chemical treatment. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Process for treating effluent from a supercritical water oxidation reactor
Barnes, Charles M.; Shapiro, Carolyn
1997-01-01
A method for treating a gaseous effluent from a supercritical water oxidation reactor containing entrained solids is provided comprising the steps of expanding the gas/solids effluent from a first to a second lower pressure at a temperature at which no liquid condenses; separating the solids from the gas effluent; neutralizing the effluent to remove any acid gases; condensing the effluent; and retaining the purified effluent to the supercritical water oxidation reactor.
Abd-Elfattah, Anwar Saad; Tuchy, Gert E.; Jessen, Michael E.; Salter, David R.; Goldstein, Jacques P.; Brunsting, Louis A.; Wechsler, Andrew S.
2013-01-01
Objective Simultaneous inhibition of the cardiac equilibrative-p-nitrobenzylthioinosine (NBMPR)–sensitive (es) type of the equilibrative nucleoside transport 1 (ENT1) nucleoside transporter, with NBMPR, and adenosine deaminase, with erythro-9-[2-hydroxy-3-nonyl]adenine (EHNA), prevents release of myocardial purines and attenuates myocardial stunning and fibrillation in canine models of warm ischemia and reperfusion. It is not known whether prolonged administration of hypothermic cardioplegia influences purine release and EHNA/NBMPR-mediated cardioprotection in acutely ischemic hearts. Methods Anesthetized dogs (n = 46), which underwent normothermic aortic crossclamping for 20 minutes on-pump, were divided to determine (1) purine release with induction of intermittent antegrade or continuous retrograde hypothermic cardioplegia and reperfusion, (2) the effects of postischemic treatment with 100 µM EHNA and 25 µM NBMPR on purine release and global functional recovery, and (3) whether a hot shot and reperfusion with EHNA/NBMPR inhibits purine release and attenuates ventricular dysfunction of ischemic hearts. Myocardial biopsies and coronary sinus effluents were obtained and analyzed using high-performance liquid chromatography. Results Warm ischemia depleted myocardial adenosine triphosphate and elevated purines (ie, inosine > adenosine) as markers of ischemia. Induction of intermittent antegrade or continuous retrograde hypothermic (4°C) cardioplegia releases purines until the heart becomes cold (<20°C). During reperfusion, the levels of hypoxanthine and xanthine (free radical substrates) were >90% of purines in coronary sinus effluent. Reperfusion with EHNA/NBMPR abolished ventricular dysfunction in acutely ischemic hearts with and without a hot shot and hypothermic cardioplegic arrest. Conclusions Induction of hypothermic cardioplegia releases purines from ischemic hearts until they become cold, whereas reperfusion induces massive purine release and myocardial stunning. Inhibition of cardiac es-ENT1 nucleoside transporter abolishes postischemic reperfusion injury in warm and cold cardiac surgery. PMID:23422047
Updated Liquid Secondary Waste Grout Formulation and Preliminary Waste Form Qualification
DOE Office of Scientific and Technical Information (OSTI.GOV)
Saslow, Sarah A.; Um, Wooyong; Russell, Renee L.
This report describes the results from liquid secondary waste grout (LSWG) formulation and cementitious waste form qualification tests performed by Pacific Northwest National Laboratory (PNNL) for Washington River Protection Solutions, LLC (WRPS). New formulations for preparing a cementitious waste form from a high-sulfate liquid secondary waste stream simulant, developed for Effluent Management Facility (EMF) process condensates merged with low activity waste (LAW) caustic scrubber, and the release of key constituents (e.g. 99Tc and 129I) from these monoliths were evaluated. This work supports a technology development program to address the technology needs for Hanford Site Effluent Treatment Facility (ETF) liquid secondarymore » waste (LSW) solidification and supports future Direct Feed Low-Activity Waste (DFLAW) operations. High-priority activities included simulant development, LSWG formulation, and waste form qualification. The work contained within this report relates to waste form development and testing and does not directly support the 2017 integrated disposal facility (IDF) performance assessment (PA). However, this work contains valuable information for use in PA maintenance past FY17, and for future waste form development efforts. The provided data should be used by (i) cementitious waste form scientists to further understanding of cementitious dissolution behavior, (ii) IDF PA modelers who use quantified constituent leachability, effective diffusivity, and partitioning coefficients to advance PA modeling efforts, and (iii) the U.S. Department of Energy (DOE) contractors and decision makers as they assess the IDF PA program. The results obtained help fill existing data gaps, support final selection of a LSWG waste form, and improve the technical defensibility of long-term waste form performance estimates.« less
Process for treating effluent from a supercritical water oxidation reactor
Barnes, C.M.; Shapiro, C.
1997-11-25
A method for treating a gaseous effluent from a supercritical water oxidation reactor containing entrained solids is provided comprising the steps of expanding the gas/solids effluent from a first to a second lower pressure at a temperature at which no liquid condenses; separating the solids from the gas effluent; neutralizing the effluent to remove any acid gases; condensing the effluent; and retaining the purified effluent to the supercritical water oxidation reactor. 6 figs.
Measurement of 14C emission rates from a pressurised heavy water reactor.
Joshi, M L; Ramamirtham, B; Soman, S D
1987-06-01
Carbon-14 is produced in pressurised heavy water reactors (PHWR), mainly as an activation product in the fuel. It is also produced in the heavy water used as the primary coolant and moderator, and is produced in the air in the annular space between the pressure tube and calandria tubes as well as in the free space in the calandria vault. The production rates in different systems of a PHWR are calculated on the basis of design parameters. During a period of 3 y, 14C released through the gaseous route has been measured at Rajasthan Atomic Power Station, Kota, India, a PHWR unit. These releases have been found to be mainly 14CO2. This reduced form of 14C is less than 5% of the releases. The normalised releases of 14C have a geometric mean of 5.17 TBq GWe-1 y-1 and a geometric standard deviation of 1.52. The 14C present in the form of carbonates in liquid effluents has also been measured and is 0.14% of the gaseous releases.
Effluent Charts Help | ECHO | US EPA
Effluent Charts present dynamic charts and tables of permitted effluent limits, releases, and violations over time for Clean Water Act (CWA) wastewater discharge permits issued under the National Pollutant Discharge Elimination System (NPDES).
Filtration device for active effluents
DOE Office of Scientific and Technical Information (OSTI.GOV)
Guerin, M.; Meunier, G.
1994-12-31
Among the various techniques relating to solid/liquid separations, filtration is currently utilized for treating radioactive effluents. After testing different equipments on various simulated effluents, the Valduc Center has decided to substitute a monoplate filter for a rotative diatomite precoated filter.
Dickinson, Michelle; Scott, Thomas B
2010-06-15
Zero-valent iron nanoparticles (INP) were investigated as a remediation strategy for a uranium-contaminated waste effluent from AWE, Aldermaston. Nanoparticles were introduced to the effluent, under both oxic and anoxic conditions, and allowed to react for a 28-d period during which the liquid and nanoparticle solids were periodically sampled. Analysis of the solution indicated that under both conditions U was removed to <1.5% of its initial concentration within 1h of introduction and remained at similar concentrations until approximately 48 h. A rapid release of Fe into solution was also recorded during this initial period; attributed to the limited partial dissolution of the INP. XPS analyses of the reacted nanoparticulate solids between 1 and 48 h showed an increased Fe(III):Fe(II) ratio, consistent with the detection of iron oxidation products (akaganeite and magnetite) by XRD and FIB. XPS analysis also recorded uranium on the recovered particulates indicating the chemical reduction of U(VI) to U(IV) within 1h. Following the initial retention period U-dissolution of U was recorded from 48 h, and attributed to reoxidation. The efficient uptake and retention of U on the INP for periods up to 48 h provide proof that INP may be effectively used for the remediation of complex U-contaminated effluents. Copyright 2010 Elsevier B.V. All rights reserved.
Aschenbroich, Adélaïde; Marchand, Cyril; Molnar, Nathalie; Deborde, Jonathan; Hubas, Cédric; Rybarczyk, Hervé; Meziane, Tarik
2015-04-15
In order to investigate spatio-temporal variations in the composition and origin of the benthic organic matter (OM) at the sediment surface in mangrove receiving shrimp farm effluents, fatty acid (FA) biomarkers, natural stable isotopes (δ(13)C and δ(15)N), C:N ratios and chlorophyll-a (chl-a) concentrations were determined during the active and the non-active period of the farm. Fatty acid compositions in surface sediments within the mangrove forest indicated that organic matter inputs varied along the year as a result of farm activity. Effluents were the source of fresh particulate organic matter for the mangrove, as evidenced by the unsaturated fatty acid (UFA) distribution. The anthropogenic MUFA 18:1ω9 was not only accumulated at the sediment surface in some parts of the mangrove, but was also exported to the seafront. Direct release of bacteria and enhanced in situ production of fungi, as revealed by specific FAs, stimulated mangrove litter decomposition under effluent runoff condition. Also, microalgae released from ponds contributed to maintain high benthic chl-a concentrations in mangrove sediments in winter and to a shift in microphytobenthic community assemblage. Primary production was high whether the farm released effluent or not which questioned the temporary effect of shrimp farm effluent on benthic microalgae dynamic. This study outlined that mangrove benthic organic matter was qualitatively and quantitatively affected by shrimp farm effluent release and that responses to environmental condition changes likely depended on mangrove stand characteristics. Copyright © 2015 Elsevier B.V. All rights reserved.
W-007H B Plant Process Condensate Treatment Facility. Revision 3
DOE Office of Scientific and Technical Information (OSTI.GOV)
Rippy, G.L.
1995-01-20
B Plant Process Condensate (BCP) liquid effluent stream is the condensed vapors originating from the operation of the B Plant low-level liquid waste concentration system. In the past, the BCP stream was discharged into the soil column under a compliance plan which expired January 1, 1987. Currently, the BCP stream is inactive, awaiting restart of the E-23-3 Concentrator. B Plant Steam Condensate (BCS) liquid effluent stream is the spent steam condensate used to supply heat to the E-23-3 Concentrator. The tube bundles in the E-23-3 Concentrator discharge to the BCS. In the past, the BCS stream was discharged into themore » soil column. Currently, the BCS stream is inactive. This project shall provide liquid effluent systems (BCP/BCS/BCE) capable of operating for a minimum of 20 years, which does not include the anticipated decontamination and decommissioning (D and D) period.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
None
2014-06-30
This Annual Site Environmental Report (ASER) for 2013 describes the environmental conditions related to work performed for the Department of Energy (DOE) at Area IV of the Santa Susana Field Laboratory (SSFL). The Energy Technology Engineering Center (ETEC), a government-owned, company-operated test facility, was located in Area IV. The operations in Area IV included development, fabrication, operation and disassembly of nuclear reactors, reactor fuel, and other radioactive materials. Other activities in the area involved the operation of large-scale liquid metal facilities that were used for testing non-nuclear liquid metal fast breeder reactor components. All nuclear work was terminated in 1988,more » and all subsequent radiological work has been directed toward environmental restoration and decontamination and decommissioning (D&D) of the former nuclear facilities and their associated sites. Liquid metal research and development ended in 2002. Since May 2007, the D&D operations in Area IV have been suspended by the DOE, but the environmental monitoring and characterization programs have continued. Results of the radiological monitoring program for the calendar year 2013 continue to indicate that there are no significant releases of radioactive material from Area IV of SSFL. All potential exposure pathways are sampled and/or monitored, including air, soil, surface water, groundwater, direct radiation, transfer of property (land, structures, waste), and recycling. Due to the suspension of D&D activities in Area IV, no effluents were released into the atmosphere during 2013. Therefore, the potential radiation dose to the general public through airborne release was zero. Similarly, the radiation dose to an offsite member of the public (maximally exposed individual) due to direct radiation from SSFL is indistinguishable from background. All radioactive wastes are processed for disposal at DOE disposal sites and/or other licensed sites approved by DOE for radioactive waste disposal. No liquid radioactive wastes were released into the environment in 2013.« less
Federal Register 2010, 2011, 2012, 2013, 2014
2011-01-06
... significantly increase the probability or consequences of accidents. No changes are being made in the types of effluents that may be released offsite. There is no significant increase in the amount of any effluent released offsite. There is no significant increase in occupational or public radiation exposure. Therefore...
75 FR 61226 - Exemption; Entergy Operations, Inc.; Arkansas Nuclear One, Units 1 and 2
Federal Register 2010, 2011, 2012, 2013, 2014
2010-10-04
... maximum potential annual radiation doses to the public resulting from effluent releases. The report must... radiation doses to the public resulting from effluent releases. This exemption does not affect the... submitted. Based on the above, no new accident precursors are created by extending the submittal date for...
Makoś, Patrycja; Fernandes, Andre; Boczkaj, Grzegorz
2017-09-29
The paper presents a new method for the determination of 15 carboxylic acids in samples of postoxidative effluents from the production of petroleum bitumens using ion-pair dispersive liquid-liquid microextraction and gas chromatography coupled to mass spectrometry with injection port derivatization. Several parameters related to the extraction and derivatization efficiency were optimized. Under optimized experimental conditions, the obtained limit of detection and quantification ranged from 0.0069 to 1.12μg/mL and 0.014 to 2.24μg/mL, respectively. The precision (RSD ranged 1.29-6.42%) and recovery (69.43-125.79%) were satisfactory. Nine carboxylic acids at concentrations ranging from 0.10μg/mL to 15.06μg/mL were determined in the raw wastewater and in samples of effluents treated by various oxidation methods. The studies revealed a substantial increase of concentration of benzoic acids, in samples of wastewater after treatment, which confirms the need of carboxylic acids monitoring during industrial effluent treatment processes. Copyright © 2017 Elsevier B.V. All rights reserved.
Measurement of /sup 14/C emission rates from a pressurized heavy water reactor
DOE Office of Scientific and Technical Information (OSTI.GOV)
Joshi, M.L.; Ramamirtham, B.; Soman, S.D.
Carbon-14 is produced in pressurized heavy water reactors (PHWR), mainly as an activation product in the fuel. It is also produced in the heavy water used as the primary coolant and moderator, and is produced in the air in the annular space between the pressure tube and calandria tubes as well as in the free space in the calandria vault. The production rates in different systems of a PHWR are calculated on the basis of design parameters. During a period of 3 y, /sup 14/C released through the gaseous route has been measured at Rajasthan Atomic Power Station, Kota, India,more » a PHWR unit. These releases have been found to be mainly /sup 14/CO/sub 2/. This reduced form of /sup 14/C is less than 5% of the releases. The normalized releases of /sup 14/C have a geometric mean of 5.17 TBq GWe-1 y-1 and a geometric standard deviation of 1.52. The /sup 14/C present in the form of carbonates in liquid effluents has also been measured and is 0.14% of the gaseous releases.« less
Soares, Eduardo V; Soares, Helena M V M
2012-05-01
The release of heavy metals into the environment, mainly as a consequence of anthropogenic activities, constitutes a worldwide environmental pollution problem. Unlike organic pollutants, heavy metals are not degraded and remain indefinitely in the ecosystem, which poses a different kind of challenge for remediation. It seems that the "best treatment technologies" available may not be completely effective for metal removal or can be expensive; therefore, new methodologies have been proposed for the detoxification of metal-bearing wastewaters. The present work reviews and discusses the advantages of using brewing yeast cells of Saccharomyces cerevisiae in the detoxification of effluents containing heavy metals. The current knowledge of the mechanisms of metal removal by yeast biomass is presented. The use of live or dead biomass and the influence of biomass inactivation on the metal accumulation characteristics are outlined. The role of chemical speciation for predicting and optimising the efficiency of metal removal is highlighted. The problem of biomass separation, after treatment of the effluents, and the use of flocculent characteristics, as an alternative process of cell-liquid separation, are also discussed. The use of yeast cells in the treatment of real effluents to bridge the gap between fundamental and applied studies is presented and updated. The convenient management of the contaminated biomass and the advantages of the selective recovery of heavy metals in the development of a closed cycle without residues (green technology) are critically reviewed.
[Impact of liquid volume of recycled methanogenic effluent on anaerobic hydrolysis].
Hao, Li-ping; Lü, Fan; He, Pin-jing; Shao, Li-ming
2008-09-01
Methanogenic effluent was recycled to regulate hydrolysis during two-phase anaerobic digestion of organic solid wastes. In order to study the impact of recycled effluent's volume on hydrolysis, four hydrolysis reactors filled with vegetable and flower wastes were constructed, with different liquid volumes of recycled methanogenic effluent, i.e., 0.1, 0.5, 1.0, 2.0 m3/(m3 x d), respectively. The parameters related to hydrolytic environment (pH, alkalinity, ORP, concentrations of ammonia and reducing sugar), microbial biomass and hydrolysis efficiency (accumulated SCOD, accumulated reducing sugar, and hydrolysis rate constants) were monitored. This research shows that recycling methanogenic effluent into the hydrolysis reactor can enhance its buffer capability and operation stability; higher recycled volume is favorable for microbial anabolism and further promotes hydrolysis. After 9 days of reaction, the accumulated SCOD in the hydrolytic effluent reach 334, 407, 413, 581 mg/g at recycled volumes of 0.1, 0.5, 1.0, 2.0 m3/(m3 x d) and their first-order hydrolysis rate kinetic constants are 0.065, 0.083, 0.089, 0.105 d(-1), respectively.
NASA Astrophysics Data System (ADS)
Takashima, Keisuke; Kaneko, Toshiro
2016-09-01
The control of hydroxyl radical and the other gas phase species generation in the ejected gas through air plasma (air plasma effluent) has been experimentally studied, which is a key to extend the range of plasma treatment. Nanosecond pulse discharge is known to produce high reduced electric field (E/N) discharge that leads to efficient generation of the reactive species than conventional low frequency discharge, while the charge-voltage cycle in the low frequency discharge is known to be well-controlled. In this study, the nanosecond pulse discharge biased with AC low frequency high voltage is used to take advantages of these discharges, which allows us to modulate the reactive species composition in the air plasma effluent. The utilization of the gas-liquid interface and the liquid phase chemical reactions between the modulated long-lived reactive species delivered from the air plasma effluent could realize efficient liquid phase chemical reactions leading to short-lived reactive species production far from the air plasma, which is crucial for some plasma agricultural applications.
Martins, Ayrton F; Frank, Carla da S; Altissimo, Joseline; de Oliveira, Júlia A; da Silva, Daiane S; Reichert, Jaqueline F; Souza, Darliana M
2017-08-24
Statins are classified as being amongst the most prescribed agents for treating hypercholesterolaemia and preventing vascular diseases. In this study, a rapid and effective liquid chromatography method, assisted by diode array detection, was designed and validated for the simultaneous quantification of atorvastatin (ATO) and simvastatin (SIM) in hospital effluent samples. The solid phase extraction (SPE) of the analytes was optimized regarding sorbent material and pH, and the dispersive liquid-liquid microextraction (DLLME), in terms of pH, ionic strength, type and volume of extractor/dispersor solvents. The performance of both extraction procedures was evaluated in terms of linearity, quantification limits, accuracy (recovery %), precision and matrix effects for each analyte. The methods proved to be linear in the concentration range considered; the quantification limits were 0.45 µg L -1 for ATO and 0.75 µg L -1 for SIM; the matrix effect was almost absent in both methods and the average recoveries remained between 81.5-90.0%; and the RSD values were <20%. The validated methods were applied to the quantification of the statins in real samples of hospital effluent; the concentrations ranged from 18.8 µg L -1 to 35.3 µg L -1 for ATO, and from 30.3 µg L -1 to 38.5 µg L -1 for SIM. Since the calculated risk quotient was ≤192, the occurrence of ATO and SIM in hospital effluent poses a potential serious risk to human health and the aquatic ecosystem.
Occurrence and fate of most prescribed antibiotics in different water environments of Tehran, Iran.
Mirzaei, Roya; Yunesian, Masud; Nasseri, Simin; Gholami, Mitra; Jalilzadeh, Esfandiyar; Shoeibi, Shahram; Mesdaghinia, Alireza
2018-04-01
The presence of most prescribed antibiotic compounds from four therapeutic classes (β-lactam, cephalosporins, macrolides, fluoroquinolones) were studied at two full-scale WWTPs, two rivers, thirteen groundwater resources, and five water treatment plants in Tehran. Analytical methodology was based on high performance liquid chromatography/tandem mass spectrometry after solid-phase extraction. Samples were collected at 33 sample locations on three sampling periods over four months from June to August 2016. None of the target antibiotics were detected in groundwater resources and water treatment plants, while seven out of nine target antibiotics were analyzed in two studied river waters as well as the influent and effluent of wastewater treatment plants at concentrations ranging from
Yang, Chuang; Wang, Wen-guo; Ma, Dan-wei; Tang, Xiao-yu; Hu, Qi-chun
2015-07-01
A Chlorella strain tolerant to high-strength anaerobic digestion effluent was isolated from the anaerobic digestion effluent with a long-term exposure to air. The strain was identified as a Chlorella by morphological and molecular biological methods, and named Chlorella sp. BWY-1, The anaerobic digestion effluent used in this study was from a biogas plant with the raw materials of swine wastewater after solid-liquid separation. The Chlorella regularis (FACHB-729) was used as the control strain. The comparative study showed that Chlorella sp, BWY-Ihad relatively higher growth rate, biomass accumulation capacity and pollutants removal rate in BG11. and different concentrations of anaerobic digestion effluent. Chlorella sp. BWY-1 had the highest growth rate and biomass productivity (324.40 mg.L-1) in BG11, but its lipid productivity and lipid content increased with the increase of anaerobic digestion effluent concentration, In undiluted anaerobic digestion effluent, the lipid productivity and lipid content of Chlorella sp. BWY-1 were up to 44. 43% and 108. 70 mg.L-1, respectively. Those results showed that the isolated algal strain bad some potential applications in livestock wastewater treatment and bioenergy production, it could be combined with a solid-liquid separation, anaerobic fermentation and other techniques for processing livestock wastewater and producing biodiesel.
Carbon dioxide degassing and thermal energy release at Vesuvio (Italy)
NASA Astrophysics Data System (ADS)
Frondini, F.; Chiodini, G.; Caliro, S.; Cardellini, C.; Granieri, D.
2003-04-01
At Vesuvio, basing on the data of the CO2 flux surveys carried out in April and May 2000, are discharged about 130 t d-1 of CO2 through soil diffuse degassing. In the crater area the distribution of the soil temperatures show a general correspondence between the CO2 flux anomalies and the high temperatures, suggesting that the heating of the soil is mainly due to the condensation of the rising volcanic-hydrothermal fluids. Considering that the original H2O/CO2 ratio of hydrothermal fluids is recorded by fumarolic effluents, the steam associated to the CO2 output has been computed and amount to is 475 t d-1. The energy produced by the steam condensation and cooling of the liquid phase is 1.26 1012 J d-1 (14.6 MW). The amounts of gas and energy released by Vesuvio are comparable to those released by other volcanic degassing areas of the world and their estimates, through periodical CO2 flux surveys, can constitute a powerful tool to monitor the activity of the volcano.
Harris, Suvi; Morris, Carol; Morris, Dearbhaile; Cormican, Martin; Cummins, Enda
2014-01-15
The prevalence of antimicrobial resistant (AMR) bacteria is increasing worldwide and remains a significant medical challenge which may lead to antimicrobial redundancy. The contribution of hospital effluent to the prevalence of resistance in wastewater treatment plant (WWTP) effluents is not fully understood. AMR bacteria contained in hospital effluent may be released into the aquatic and soil environments after WWTP processing. Hence, the objective of this study is to identify the extent hospital effluent contributes to contamination of these environments by comparing two WWTPs, one which receives hospital effluent and one which does not. AMR Escherichia coli were monitored in the two WWTPs. A model was developed using these monitored values to predict the effect of hospital effluent within a WWTP. The model predicted levels of AMR E. coli in the aquatic environment and potential bather exposure to AMR E. coli. The model results were highly variable. WWTP influent containing hospital effluent had a higher mean percentage of AMR E. coli; although, there appeared to be no within treatment plant effect on the prevalence of AMR E. coli. Examination of WWTP sludge showed a similar variation. There appeared to be no consistent effect from the presence of hospital effluent. The human exposure assessment model predicted swimmer intake of AMR E. coli between 6 and 193CFU/100ml sea water. It appears that hospital effluent is not the main contributing factor behind the development and persistence of AMR E. coli within WWTPs, although resistance may be too well-developed to identify an influence from hospital effluent. Mitigation needs to focus on the removal of already present resistant bacteria but for new or hospital specific antimicrobials focus needs to be on their limited release within effluents or separate treatment. © 2013.
Naidoo, V; du Preez, M; Rakgotho, T; Odhav, B; Buckley, C A
2002-01-01
Industrial effluents and leachates from hazardous landfill sites were tested for toxicity using the anaerobic toxicity assay. This test was done on several industrial effluents (brewery spent grain effluent, a chemical industry effluent, size effluent), and several hazardous landfill leachates giving vastly different toxicity results. The brewery effluent, spent grain effluent and size effluent were found to be less toxic than the chemical effluent and hazardous landfill leachate samples. The chemical industry effluent was found to be most toxic. Leachate samples from the H:h classified hazardous landfill site were found to be less toxic at high concentrations (40% (v/v)) while the H:H hazardous landfill leachate samples were found to be more toxic even at low concentrations of 4% (v/v). The 30 d biochemical methane potential tests revealed that the brewery effluent, organic spent grain effluent and size effluent were 89%, 63%, and 68% biodegradable, respectively. The leachate from Holfontein hazardous landfill site was least biodegradable (19%) while the chemical effluent and Aloes leachate were 29% and 32% biodegradable under anaerobic conditions.
POLAR ORGANIC CHEMICAL INTEGRATIVE SAMPLING ...
The purpose of the research presented in this paper is two-fold: (1) to demonstrate the 4 coupling of two state-of-the-art techniques: a time-weighted polar organic integrative sampler (POCIS) and micro-liquid chromatography-electrospray/ion trap mass spectrometry (u-LC-6 ES/ITMS); and (2) the assessment of these methodologies in a real-world environment -wastewater effluent - for detecting six drugs (four prescription and two illicit). In the effluent from three wastewater treatment plants (WWTP), azithromycin was detected at concentrations ranging from 15ng/L to 66ng/L, equivalent to the total annual release of 0.4 -4 kg into the receiving waters. Detected and confirmed in the effluent from two WWTPs were two illicit drugs methamphetamine and methylenedioxymethamphetamine (MDMA), at 2ng/L and 0.5ng/L, respectively. While the ecotoxicological significance of drugs in environmental matrices, particularly water, has not been closely examined, it can only be surmised that these substances have the potential to adversely affect biota that are continuously exposed to them even at very low levels. The potential for chronic affects on human health is also unknown, but of increasing concern due to the multi use character of water, particularly in densely populated arid areas. The research focused on in the subtasks is the development and application of state-of the-art technologies to meet the needs of the public, Office of Water, and ORD in the area of Water Quality
40 CFR 409.30 - Applicability; description of the liquid cane sugar refining subcategory.
Code of Federal Regulations, 2011 CFR
2011-07-01
... liquid cane sugar refining subcategory. 409.30 Section 409.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.30 Applicability; description of the liquid cane sugar refining...
40 CFR 409.30 - Applicability; description of the liquid cane sugar refining subcategory.
Code of Federal Regulations, 2010 CFR
2010-07-01
... liquid cane sugar refining subcategory. 409.30 Section 409.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.30 Applicability; description of the liquid cane sugar refining...
40 CFR 409.30 - Applicability; description of the liquid cane sugar refining subcategory.
Code of Federal Regulations, 2014 CFR
2014-07-01
... liquid cane sugar refining subcategory. 409.30 Section 409.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.30 Applicability; description of the liquid cane sugar refining...
40 CFR 409.30 - Applicability; description of the liquid cane sugar refining subcategory.
Code of Federal Regulations, 2013 CFR
2013-07-01
... liquid cane sugar refining subcategory. 409.30 Section 409.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.30 Applicability; description of the liquid cane sugar refining...
40 CFR 409.30 - Applicability; description of the liquid cane sugar refining subcategory.
Code of Federal Regulations, 2012 CFR
2012-07-01
... liquid cane sugar refining subcategory. 409.30 Section 409.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.30 Applicability; description of the liquid cane sugar refining...
Hydroponic system for the treatment of anaerobic liquid.
Krishnasamy, K; Nair, J; Bäuml, B
2012-01-01
The effluent from anaerobic digestion process has high concentrations of nutrients, particularly nitrogen, essential for plant growth but is not suitable for direct disposal or application due to high chemical oxygen demand (COD), low dissolved oxygen (DO), odour issues and is potentially phytotoxic. This research explored the optimum conditions of anaerobic effluent for application and dilutions of the effluent required to obtain better plant growth. A small-scale hydroponic system was constructed in a glasshouse to test different concentrations of anaerobic effluent against a commercial hydroponic medium as the control for the growth of silverbeet. It was found that the survival of silverbeet was negatively affected at 50% concentration due to low DO and NH(4) toxicity. The concentration of 20% anaerobic liquid was found to be the most efficient with highest foliage yield and plant growth. The hydroponic system with 20% concentrated effluent had better utilisation of nutrients for plant growth and a COD reduction of 95% was achieved during the 50-day growth period. This preliminary evaluation revealed that the growth and development of silverbeet was significantly lower in anaerobic effluent compared with a commercial hydroponic plant growth solution. The nutrient quality of anaerobic effluent could be highly variable with the process and the waste material used and dilution may depend on the nutrient content of the effluent. It is recommended that, a pre-treatment of the effluent to increase DO and reduce ammonium content is required before plant application, and simple dilution by itself is not suitable for optimum plant growth in a hydroponic system.
Sheets, Johnathon P; Yang, Liangcheng; Ge, Xumeng; Wang, Zhiwu; Li, Yebo
2015-10-01
Effective treatment and reuse of the massive quantities of agricultural and food wastes generated daily has the potential to improve the sustainability of food production systems. Anaerobic digestion (AD) is used throughout the world as a waste treatment process to convert organic waste into two main products: biogas and nutrient-rich digestate, called AD effluent. Biogas can be used as a source of renewable energy or transportation fuels, while AD effluent is traditionally applied to land as a soil amendment. However, there are economic and environmental concerns that limit widespread land application, which may lead to underutilization of AD for the treatment of agricultural and food wastes. To combat these constraints, existing and novel methods have emerged to treat or reuse AD effluent. The objective of this review is to analyze several emerging methods used for efficient treatment and reuse of AD effluent. Overall, the application of emerging technologies is limited by AD effluent composition, especially the total solid content. Some technologies, such as composting, use the solid fraction of AD effluent, while most other technologies, such as algae culture and struvite crystallization, use the liquid fraction. Therefore, dewatering of AD effluent, reuse of the liquid and solid fractions, and land application could all be combined to sustainably manage the large quantities of AD effluent produced. Issues such as pathogen regrowth and prevalence of emerging organic micro-pollutants are also discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.
Tracking the Key Constituents of Concern of the WTP LAW Stream
DOE Office of Scientific and Technical Information (OSTI.GOV)
Mabrouki, Ridha B.; Matlack, Keith S.; Abramowitz, Howard
The testing results presented in the present report were also obtained on a DM10 melter system operated with the primary WTP LAW offgas system components with recycle, as specified in the statement of work (SOW) [6] and detailed in the Test Plan for this work [7]. The primary offgas system components include the SBS, the WESP, and a recycle system that allows recycle of liquid effluents back to the melter, as in the present baseline for the WTP LAW vitrification. The partitioning of technetium and other key constituents between the glass waste form, the offgas system liquid effluents, the offgasmore » stream that exits the WESP, and the liquid condensate from the vacuum evaporator were quantified in this work. The tests employed three different LAW streams spanning a range of waste compositions anticipated for WTP. Modifications to the offgas system and operational strategy were made to expedite the approach to steady state concentrations of key constituents in the glass and offgas effluent solutions during each test.« less
Fernández-Ramos, C; Ballesteros, O; Zafra-Gómez, A; Camino-Sánchez, F J; Blanc, R; Navalón, A; Pérez-Trujillo, J P; Vílchez, J L
2014-02-15
Alcohol sulfates (AS) and alcohol ethoxysulfates (AES) are all High Production Volume and 'down-the-drain' chemicals used globally in detergent and personal care products, resulting in low levels ultimately released to the environment via wastewater treatment plant effluents. They have a strong affinity for sorption to sediments. Almost 50% of Tenerife Island surface area is environmentally protected. Therefore, determination of concentration levels of AS/AES in marine sediments near wastewater discharge points along the coast of the Island is of interest. These data were obtained after pressurized liquid extraction and liquid chromatography-tandem mass spectrometry analysis. Short chains of AES and especially of AS dominated the homologue distribution for AES. The Principal Components Analysis was used. The results showed that the sources of AS and AES were the same and that both compounds exhibit similar behavior. Three different patterns in the distribution for homologues and ethoxymers were found. Copyright © 2013 Elsevier Ltd. All rights reserved.
Migration through soil of organic solutes in an oil-shale process water
Leenheer, J.A.; Stuber, H.A.
1981-01-01
The migration through soil of organic solutes in an oil-shale process water (retort water) was studied by using soil columns and analyzing leachates for various organic constituents. Retort water extracted significant quantities of organic anions leached from ammonium-saturated-soil organic matter, and a distilled-water rinse, which followed retort-water leaching, released additional organic acids from the soil. After being corrected for organic constitutents extracted from soil by retort water, dissolved-organic-carbon fractionation analyses of effluent fractions showed that the order of increasing affinity of six organic compound classes for the soil was as follows: hydrophilic neutrals nearly equal to hydrophilic acids, followed by the sequence of hydrophobic acids, hydrophilic bases, hydrophobic bases, and hydrophobic neutrals. Liquid-chromatographic analysis of the aromatic amines in the hydrophobic- and hydrophilic-base fractions showed that the relative order of the rates of migration through the soil column was the same as the order of migration on a reversed-phase, octadecylsilica liquid-chromatographic column.
Ali, Aasim M; Rønning, Helene Thorsen; Alarif, Walied; Kallenborn, Roland; Al-Lihaibi, Sultan S
2017-05-01
The occurrence of selected pharmaceuticals and personal care products (PPCPs) and the pesticide atrazine were investigated in seawater samples collected from stations located at effluent dominated sites in the Saudi Arabian coastal waters of the Red Sea. PPCPs were analysed using solid phase extraction (SPE) followed by high performance liquid chromatography - tandem mass spectrometry (HPLC-MS/MS). A multi component method for the ultra-trace level quantification of 13 target PPCPs in Seawater was developed and validated for the here performed study. The method procedure is described in detail in the supplementary material section. 26 samples from 7 distinct locations (2 directly influenced by continuous sewage release) were chosen for the sampling of surface seawater. Based upon local sales information, 25 target substances (20 PPCPs, 4 pesticides and 1 stimulant) were chosen for the here reported method development. Thirteen PPCPs were detected and quantified in a total of 26 seawater samples. Metformin, diclofenac, acetaminophen, and caffeine were identified as the most abundant PPCPs, detected in maximum concentration higher than 3 μg/L (upper quantification limit for the here developed method). Concentrations were in the range of 7- >3000 (metformin),
Gusmaroli, Lucia; Insa, Sara; Petrovic, Mira
2018-04-24
During the last decades, the quality of aquatic ecosystems has been threatened by increasing levels of pollutions, caused by the discharge of man-made chemicals, both via accidental release of pollutants as well as a consequence of the constant outflow of inadequately treated wastewater effluents. For this reason, the European Union is updating its legislations with the aim of limiting the release of emerging contaminants. The Commission Implementing Decision (EU) 2015/495 published in March 2015 drafts a "Watch list" of compounds to be monitored Europe-wide. In this study, a methodology based on online solid-phase extraction (SPE) ultra-high-performance liquid chromatography coupled to a triple-quadrupole mass spectrometer (UHPLC-MS/MS) was developed for the simultaneous determination of the 17 compounds listed therein. The proposed method offers advantages over already available methods, such as versatility (all 17 compounds can be analyzed simultaneously), shorter time required for analysis, robustness, and sensitivity. The employment of online sample preparation minimized sample manipulation and reduced dramatically the sample volume needed and time required, dramatically the sample volume needed and time required, thus making the analysis fast and reliable. The method was successfully validated in surface water and influent and effluent wastewater. Limits of detection ranged from sub- to low-nanogram per liter levels, in compliance with the EU limits, with the only exception of EE2. Graphical abstract Schematic of the workflow for the analysis of the Watch list compounds.
Lourenço, J; Marques, S; Carvalho, F P; Oliveira, J; Malta, M; Santos, M; Gonçalves, F; Pereira, R; Mendo, S
2017-12-15
Active and abandoned uranium mining sites often create environmentally problematic situations, since they cause the contamination of all environmental matrices (air, soil and water) with stable metals and radionuclides. Due to their cytotoxic, genotoxic and teratogenic properties, the exposure to these contaminants may cause several harmful effects in living organisms. The Fish Embryo Acute Toxicity Test (FET) test was employed to evaluate the genotoxic and teratogenic potential of mine liquid effluents and sludge elutriates from a deactivated uranium mine. The aims were: a) to determine the risk of discharge of such wastes in the environment; b) the effectiveness of the chemical treatment applied to the uranium mine water, which is a standard procedure generally applied to liquid effluents from uranium mines and mills, to reduce its toxicological potential; c) the suitability of the FET test for the evaluation the toxicity of such wastes and the added value of including the evaluation of genotoxicity. Results showed that through the FET test it was possible to determine that both elutriates and effluents are genotoxic and also that the mine effluent is teratogenic at low concentrations. Additionally, liquid effluents and sludge elutriates affect other parameters namely, growth and hatching and that water pH alone played an important role in the hatching process. The inclusion of genotoxicity evaluation in the FET test was crucial to prevent the underestimation of the risks posed by some of the tested effluents/elutriates. Finally, it was possible to conclude that care should be taken when using benchmark values calculated for specific stressors to evaluate the risk posed by uranium mining wastes to freshwater ecosystems, due to their chemical complexity. Copyright © 2017 Elsevier B.V. All rights reserved.
IDENTIFICATION OF COMPONENTS OF ENERGY-RELATED WASTES AND EFFLUENTS
A state-of-the-art review on the characterization of organic and elemental substances in energy-related liquid and solid effluents was conducted. Previous and on-going research programs and reports were reviewed to summarize the existing and probable future data on chemical eleme...
METHOD FOR THE RECOVERY OF CESIUM VALUES
Rimshaw, S.J.
1960-02-16
A method is given for recovering Cs/sup 137/ from radioactive waste solutions together with extraneous impurities. Ammonium alum is precipitated in the waste solution. The alum, which carries the cesium, is separated from the supernatant liquid and then dissolved in water. The resulting aqueous solution is then provided with a source of hydroxyl ions, which precipitates aluminum as the hydroxide, and the aluminum hydroxide is separated from the resulting liquid. This liquid, which contains anionic impurities together with ammonium and cesium, is passed through an anion exchange resin bed which removes the anionic impurities. The ammonium in the effluent is removed by destructive distiilation, leaving a substantiaily pure cesium salt in the effluent.
Role of gastrin-releasing peptide in pepsinogen secretion from the isolated perfused rat stomach.
Skak-Nielsen, T; Holst, J J; Christensen, J D; Fjalland, B
1988-10-01
We studied the effects of the neuropeptide gastrin-releasing peptide on pepsinogen secretion using an isolated perfused rat stomach with intact vagal innervation. Following electrical stimulation of the vagus nerves, the pepsin output to the luminal effluent increased from 94 +/- 7 to 182 +/- 24 units pepsin/min and the release of immunoreactive gastrin-releasing peptide to the venous effluent increased from 0.059 +/- 0.014 to 0.138 +/- 0.028 pmol/min. Infusion of gastrin-releasing peptide at 10(-8) M significantly increased pepsin output (from 87 +/- 17 to 129 +/- 22 units pepsin/min) and simultaneous infusion of gastrin-releasing peptide and carbachol at 10(-8) and 10(-6) M, respectively, resulted in an increase to almost 4 times the basal values. Atropine reduced but did not abolish the pepsin response to vagal stimulation and to infusion of gastrin-releasing peptide. Our results suggest that gastrin-releasing peptide participates in the vagal control of pepsinogen secretion.
Ma, Dehua; Chen, Lujun; Liu, Rui
2017-10-01
Environmental antiandrogenic (AA) contaminants in effluents from wastewater treatment plants have the potential for negative impacts on wildlife and human health. The aim of our study was to identify chemical contaminants with likely AA activity in the biological effluents and evaluate the removal of these antiandrogens (AAs) during advanced treatment comprising adsorption onto granular activated carbon (GAC). In this study, profiling of AA contaminants in biological effluents and tertiary effluents was conducted using effect-directed analysis (EDA) including high performance liquid chromatography (HPLC) fractionation, a recombinant yeast screen containing androgen receptor (YAS), in combination with mass spectrometry analyses. Analysis of a wastewater secondary effluent from a membrane bioreactor revealed complex profiles of AA activity comprising 14 HPLC fractions and simpler profiles of GAC effluents with only 2 to 4 moderately polar HPLC fractions depending on GAC treatment conditions. Gas chromatography-mass spectrometry and ultra-high performance liquid chromatography-nanospray mass spectrometry analyses of AA fractions in the secondary effluent resulted in detection of over 10 chemical contaminants, which showed inhibition of YAS activity and were potential AAs. The putative AAs included biocides, food additives, flame retardants, pharmaceuticals and industrial contaminants. To our knowledge, it is the first time that the AA properties of N-ethyl-2-isopropyl-5-methylcyclohexanecarboxamide (WS3), cetirizine, and oxcarbazepine are reported. The EDA used in this study was proven to be a powerful tool to identify novel chemical structures with AA activity in the complex aquatic environment. The adsorption process to GAC of all the identified antiandrogens, except WS3 and triclosan, fit well with the pseudo-second order kinetics models. Adsorption to GAC could further remove most of the AAs identified in the biological effluents with high efficiencies. Copyright © 2017 Elsevier B.V. All rights reserved.
Wastewater treatment plant effluents as source of cosmetic polyethylene microbeads to freshwater.
Kalčíková, G; Alič, B; Skalar, T; Bundschuh, M; Gotvajn, A Žgajnar
2017-12-01
Microplastics in the environment are either a product of the fractionation of larger plastic items or a consequence of the release of microbeads, which are ingredients of cosmetics, through wastewater treatment plant (WWTP) effluents. The aim of this study was to estimate the amount of microbeads that may be released by the latter pathways to surface waters using Ljubljana, Slovenia as a case study. For this purpose, microbeads contained in cosmetics were in a first step characterized for their physical properties and particle size distribution. Subsequently, daily emission of microbeads from consumers to the sewerage system, their fate in biological WWTPs and finally their release into surface waters were estimated for Ljubljana. Most of the particles found in cosmetic products were <100 μm. After application, microbeads are released into sewerage system at an average rate of 15.2 mg per person per day. Experiments using a lab-scale sequencing batch biological WWTP confirmed that on average 52% of microbeads are captured in activated sludge. Particle size analyses of the influent and effluent confirmed that smaller particles (up to 60-70 μm) are captured within activated sludge while bigger particles were detected in the effluent. Applying these data to the situation in Ljubljana indicates that about 112,500,000 particles may daily be released into the receiving river, resulting in a microbeads concentration of 21 particles/m 3 . Since polyethylene particles cannot be degraded and thus likely accumulate, the data raise concerns about potential effects in aquatic ecosystems in future. Copyright © 2017 Elsevier Ltd. All rights reserved.
Schultz, M.M.; Furlong, E.T.; Kolpin, D.W.; Werner, S.L.; Schoenfuss, H.L.; Barber, L.B.; Blazer, V.S.; Norris, D.O.; Vajda, A.M.
2010-01-01
Antidepressant pharmaceuticals are widely prescribed in the United States; release of municipal wastewater effluent is a primary route introducing them to aquatic environments, where little is known about their distribution and fate. Water, bed sediment, and brain tissue from native white suckers (Catostomus commersoni)were collected upstream and atpoints progressively downstream from outfalls discharging to two effluentimpacted streams, Boulder Creek (Colorado) and Fourmile Creek (Iowa). A liquid chromatography/tandem mass spectrometry method was used to quantify antidepressants, including fluoxetine, norfluoxetine (degradate), sertraline, norsertraline (degradate), paroxetine, Citalopram, fluvoxamine, duloxetine, venlafaxine, and bupropion in all three sample matrices. Antidepressants were not present above the limit of quantitation in water samples upstream from the effluent outfalls but were present at points downstream at ng/L concentrations, even at the farthest downstream sampling site 8.4 km downstream from the outfall. The antidepressants with the highest measured concentrations in both streams were venlafaxine, bupropion, and Citalopram and typically were observed at concentrations of at least an order of magnitude greater than the more commonly investigated antidepressants fluoxetine and sertraline. Concentrations of antidepressants in bed sediment were measured at ng/g levels; venlafaxine and fluoxetine were the predominant chemicals observed. Fluoxetine, sertraline, and their degradates were the principal antidepressants observed in fish brain tissue, typically at low ng/g concentrations. Aqualitatively different antidepressant profile was observed in brain tissue compared to streamwater samples. This study documents that wastewater effluent can be a point source of antidepressants to stream ecosystems and that the qualitative composition of antidepressants in brain tissue from exposed fish differs substantially from the compositions observed in streamwater and sediment, suggesting selective uptake. ?? 2010 American Chemical Society.
Oak Ridge Reservation: Annual Site Environmental Report for 2015
DOE Office of Scientific and Technical Information (OSTI.GOV)
Rochelle, James; Rogers, Ben; Roche, Paula R.
The Oak Ridge Reservation Annual Site Environmental Report is prepared annually and presents summary environmental data to (1) characterize environmental performance, (2) summarize environmental occurrences reported during the year, (3) confirm compliance with environmental standards and requirements, and (4) highlight significant program activities. The report fulfills the requirement contained in DOE Order 231.1A, Environment, Safety and Health Reporting (DOE 2004) that an integrated annual site environmental report be prepared. The results summarized in this report are based on data collected prior to and through 2015. This report is not intended to nor does it present the results of all environmentalmore » monitoring associated with the ORR. Data collected for other site and regulatory purposes, such as environmental restoration/remedial investigation reports, waste management characterization sampling data, and environmental permit compliance data, are presented in other documents that have been prepared in accordance with applicable DOE guidance and/or laws and are referenced herein as appropriate. Environmental monitoring on the ORR consists primarily of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents at the points of release to the environment; these measurements allow the quantification and official reporting of contaminant levels, assessment of radiation and chemical exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of direct measurements and collection and analysis of samples taken from the site and its environs exclusive of effluents; these activities provide information on contaminant concentrations in air, water, groundwater, soil, foods, biota, and other media. Environmental surveillance data support determinations regarding environmental compliance and, when combined with data from effluent monitoring, support chemical and radiation dose and exposure assessments of the potential effects of ORR operations, if any, on the local environment.« less
Analytical methods in environmental effects-directed investigations of effluents.
Hewitt, L Mark; Marvin, Chris H
2005-05-01
Effluent discharges are released into aquatic environments as complex mixtures for which there is commonly either no knowledge of the toxic components or a lack of understanding of how known toxicants interact with other effluent components. Effects-directed investigations consist of chemical extraction and iterative fractionation steps directed by a biological endpoint that is designed to permit the identification or characterization of the chemical classes or compounds in a complex mixture responsible for the observed biological activity. Our review of the literature on effects-directed analyses of effluents for non-mutagenic as well as mutagenic endpoints showed that common extraction and concentration methods have been used. Since the mid-1980s, the methods have evolved from the use of XAD resins to C18 solid-phase extraction (SPE). Blue cotton, blue rayon, and blue chitin have been used specifically for investigations of mutagenic activity where polycyclic compounds were involved or suspected. After isolation, subsequent fractionations have been accomplished using SPE or a high-pressure liquid chromatography (HPLC) system commonly fitted with a C18 reverse-phase column. Substances in active fractions are characterized by gas chromatography/mass spectrometry (GC-MS) and/or other spectrometric techniques for identification. LC-MS methods have been developed for difficult-to-analyze polar substances identified from effects-directed studies, but the potential for LC-MS to identify unknown polar compounds has yet to be fully realized. Salmonella-based assays (some miniaturized) have been coupled with fractionation methods for most studies aimed at identifying mutagenic fractions and chemical classes in mixtures. Effects-directed investigations of mutagens have focused mostly on drinking water and sewage, whereas extensive investigations of non-mutagenic effects have also included runoff, pesticides, and pulp mill effluents. The success of effects-directed investigations should be based on a realistic initial objective of each project. Identification of chemical classes associated with the measured biological endpoint is frequently achievable; however, confirmation of individual compounds is much more difficult and not always a necessary goal of effects-directed chemical analysis.
Recovery of ammonia and production of high-grade phosphates from digester effluents
USDA-ARS?s Scientific Manuscript database
Conservation and recovery of nitrogen and phosphorus from animal wastes and municipal effluents is important because of economic and environmental reasons. In this paper we present a novel technology for separation and recovery of ammonia and phosphorus from liquid swine manure. Phosphorus recovery ...
40 CFR 417.80 - Applicability; description of the manufacture of liquid soaps subcategory.
Code of Federal Regulations, 2014 CFR
2014-07-01
... manufacture of liquid soaps subcategory. 417.80 Section 417.80 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.80 Applicability; description of the manufacture of...
40 CFR 417.80 - Applicability; description of the manufacture of liquid soaps subcategory.
Code of Federal Regulations, 2013 CFR
2013-07-01
... manufacture of liquid soaps subcategory. 417.80 Section 417.80 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.80 Applicability; description of the manufacture of...
40 CFR 417.80 - Applicability; description of the manufacture of liquid soaps subcategory.
Code of Federal Regulations, 2012 CFR
2012-07-01
... manufacture of liquid soaps subcategory. 417.80 Section 417.80 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.80 Applicability; description of the manufacture of...
Verplanck, Philip L; Furlong, Edward T; Gray, James L; Phillips, Patrick J; Wolf, Ruth E; Esposito, Kathleen
2010-05-15
A primary pathway for emerging contaminants (pharmaceuticals, personal care products, steroids, and hormones) to enter aquatic ecosystems is effluent from sewage treatment plants (STP), and identifying technologies to minimize the amount of these contaminants released is important. Quantifying the flux of these contaminants through STPs is difficult. This study evaluates the behavior of gadolinium, a rare earth element (REE) utilized as a contrasting agent in magnetic resonance imaging (MRI), through four full-scale metropolitan STPs that utilize several biosolids thickening, conditioning, stabilization, and dewatering processing technologies. The organically complexed Gd from MRIs has been shown to be stable in aquatic systems and has the potential to be utilized as a conservative tracer in STP operations to compare to an emerging contaminant of interest. Influent and effluent waters display large enrichments in Gd compared to other REEs. In contrast, most sludge samples from the STPs do not display Gd enrichments, including primary sludges and end-product sludges. The excess Gd appears to remain in the liquid phase throughout the STP operations, but detailed quantification of the input Gd load and residence times of various STP operations is needed to utilize Gd as a conservative tracer.
Diffuse CO2 degassing at Vesuvio, Italy
NASA Astrophysics Data System (ADS)
Frondini, Francesco; Chiodini, Giovanni; Caliro, Stefano; Cardellini, Carlo; Granieri, Domenico; Ventura, Guido
2004-10-01
At Vesuvio, a significant fraction of the rising hydrothermal-volcanic fluids is subjected to a condensation and separation process producing a CO2-rich gas phase, mainly expulsed through soil diffuse degassing from well defined areas called diffuse degassing structures (DDS), and a liquid phase that flows towards the outer part of the volcanic cone. A large amount of thermal energy is associated with the steam condensation process and subsequent cooling of the liquid phase. The total amount of volcanic-hydrothermal CO2 discharged through diffuse degassing has been computed through a sequential Gaussian simulation (sGs) approach based on several hundred accumulation chamber measurements and, at the time of the survey, amounted to 151 t d-1. The steam associated with the CO2 output, computed assuming that the original H2O/CO2 ratio of hydrothermal fluids is preserved in fumarolic effluents, is 553 t d-1, and the energy produced by the steam condensation and cooling of the liquid phase is 1.47×1012 J d-1 (17 MW). The location of the CO2 and temperature anomalies show that most of the gas is discharged from the inner part of the crater and suggests that crater morphology and local stratigraphy exert strong control on CO2 degassing and subsurface steam condensation. The amounts of gas and energy released by Vesuvio are comparable to those released by other volcanic degassing areas of the world and their estimates, through periodic surveys of soil CO2 flux, can constitute a useful tool to monitor volcanic activity.
26 CFR 1.613A-7 - Definitions.
Code of Federal Regulations, 2010 CFR
2010-04-01
... reservoirs but which are liquid at atmospheric pressure after being recovered from oil well (casinghead) gas in lease separators, and (3) Natural gas liquid recovered from gas well effluent in lease separators... applied for the recovery of hydrocarbons in which liquids, gases, or other matter is injected into the...
de Carvalho Gomes, Franciane; Godoy, José Marcus; de Carvalho, Zenildo Lara; de Souza, Elder Magalhães; Rodrigues Silva, José Ivan; Tadeu Lopes, Ricardo
2014-10-01
Presently, two nuclear power plants operate in Brazil. Both are located at Itaorna beach, Angra dos Reis, approximately 133 km from Rio de Janeiro city. The reactor cooling circuits require the input of seawater, which is later discharged through a pipeline into the adjacent Piraquara de Fora Cove. The radioactive effluents undergo ion-exchange treatment prior to their release in batches, causing the enrichment of (3)H relative to other radionuclides in the discharged waters. Under steady state conditions, the (3)H gradient in the Piraquara de Fora waters can be used to determine the dependence of the dilution factor on the distance from the discharge point. The present work describes experiments carried out at the reactor site during batch release episodes, including time series sampling at the discharge point and surface seawater sampling every 250 m to a distance of 1250 m, after a double distillation, the (3)H concentration was measured by liquid scintillation counting applying a Quantulus liquid scintillation spectrometer. The obtained results showed a linear relationship between the (3)H concentration and distance from the discharge point. At 1250 m from the discharge point a dilution index of 1:15 was measured which fits the expected value based on modeling. Copyright © 2014 Elsevier Ltd. All rights reserved.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Not Available
This symposium included five sessions. Session I dealt with the technology for contending with harmful effluents primarily from coal conversion processes. Session II was designed to address the need for the systematic application of existing capabilities to the collection and characterization of materials of importance to the life scientists. Session III had the underlying theme of the health effects research - biologists, chemists, and technologists working together to confront the problems of the emerging industries. Session IV provided the most recent data in the areas of atmospheric, solid, and liquid releases. Session V dealt with effects on humans and onmore » those people who may potentially be affected by the toxic material that they produce. In summary, the sessions were: technology, chemical, characterization, biological effects, environmental and ecological effects and occupational health effects. 29 pages were included.« less
40 CFR 61.24 - Annual reporting requirements.
Code of Federal Regulations, 2010 CFR
2010-07-01
..., including their location, diameter, flow rate, effluent temperature and release height. (5) A description of...) Distances from the points of release to the nearest residence, school, business or office and the nearest...
Dhumal, V.R.; Gulati, O.D.; Raghunath, P.R.; Sivaramakrishna, N.
1974-01-01
1 The cerebral ventricles of dogs under intravenous pentobarbitone sodium anaesthesia, were perfused with artificial cerebro-spinal fluid (CSF) at a rate of 0.4-0.5 ml/min from the ventricular to the aqueductal cannulae. The effluent was collected from the aqueductal cannula in 20 min samples. The animals' temperatures were recorded from the rectum. 2 γ-Aminobutyric acid (GABA) 0.1-5 mg when injected into the ventricles produced variable temperature effects. Doses of 0.1 and 0.5 mg always produced hyperthermia and 1 and 5 mg doses sometimes produced hyperthermia and sometimes hypothermia. 3 Intraventricular perfusion with 2-bromolysergic acid diethylamide (BOL) and hyoscine did not block hyperthermia. Tests on the rat isolated stomach strip or the guinea-pig isolated superfused ileum for the possible release, respectively, of 5-hydroxytryptamine or acetylcholine by GABA were negative. 4 When tested for the presence of prostaglandin E(PGE)-like substances on the isolated rat stomach strip, both the control effluent and the GABA effluent showed activity, the latter being much more potent. There was a temporal correlation between this effect and hyperthermia. Intraventricularly administered sodium salicylate converted the GABA-induced hyperthermia to hypothermia and blocked the release of PGE-like substances. 5 Hypothermia induced by GABA alone or in the presence of sodium salicylate was associated with the release of noradrenaline into the effluent. 6 Intraventricular administration of GABA in reserpinized dogs produced hyperthermia and not hypothermia. Similar results were obtained with phentolamine perfusion in normal dogs. 7 Perfusion with calcium-free solution blocked both the noradrenaline-releasing and hypothermic actions of GABA. 8 It is concluded that hyperthermia associated with intraventricular injections of GABA is due to the release of PGE-like substance and hypothermia is due to the release of noradrenaline. PMID:4155652
There is a major effort to characterize the potential adverse effects of effluents released from sewage treatment plants in North America. At many locations pharmaceuticals, endocrine disruptors, and other chemicals of emerging concerns are present in the environment at concentra...
40 CFR 417.80 - Applicability; description of the manufacture of liquid soaps subcategory.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true Applicability; description of the manufacture of liquid soaps subcategory. 417.80 Section 417.80 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
40 CFR 417.80 - Applicability; description of the manufacture of liquid soaps subcategory.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the manufacture of liquid soaps subcategory. 417.80 Section 417.80 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
Loos, Robert; Carvalho, Raquel; António, Diana C; Comero, Sara; Locoro, Giovanni; Tavazzi, Simona; Paracchini, Bruno; Ghiani, Michela; Lettieri, Teresa; Blaha, Ludek; Jarosova, Barbora; Voorspoels, Stefan; Servaes, Kelly; Haglund, Peter; Fick, Jerker; Lindberg, Richard H; Schwesig, David; Gawlik, Bernd M
2013-11-01
In the year 2010, effluents from 90 European wastewater treatment plants (WWTPs) were analyzed for 156 polar organic chemical contaminants. The analyses were complemented by effect-based monitoring approaches aiming at estrogenicity and dioxin-like toxicity analyzed by in vitro reporter gene bioassays, and yeast and diatom culture acute toxicity optical bioassays. Analyses of organic substances were performed by solid-phase extraction (SPE) or liquid-liquid extraction (LLE) followed by liquid chromatography tandem mass spectrometry (LC-MS-MS) or gas chromatography high-resolution mass spectrometry (GC-HRMS). Target microcontaminants were pharmaceuticals and personal care products (PPCPs), veterinary (antibiotic) drugs, perfluoroalkyl substances (PFASs), organophosphate ester flame retardants, pesticides (and some metabolites), industrial chemicals such as benzotriazoles (corrosion inhibitors), iodinated x-ray contrast agents, and gadolinium magnetic resonance imaging agents; in addition biological endpoints were measured. The obtained results show the presence of 125 substances (80% of the target compounds) in European wastewater effluents, in concentrations ranging from low nanograms to milligrams per liter. These results allow for an estimation to be made of a European median level for the chemicals investigated in WWTP effluents. The most relevant compounds in the effluent waters with the highest median concentration levels were the artificial sweeteners acesulfame and sucralose, benzotriazoles (corrosion inhibitors), several organophosphate ester flame retardants and plasticizers (e.g. tris(2-chloroisopropyl)phosphate; TCPP), pharmaceutical compounds such as carbamazepine, tramadol, telmisartan, venlafaxine, irbesartan, fluconazole, oxazepam, fexofenadine, diclofenac, citalopram, codeine, bisoprolol, eprosartan, the antibiotics trimethoprim, ciprofloxacine, sulfamethoxazole, and clindamycine, the insect repellent N,N'-diethyltoluamide (DEET), the pesticides MCPA and mecoprop, perfluoroalkyl substances (such as PFOS and PFOA), caffeine, and gadolinium. Copyright © 2013 Elsevier Ltd. All rights reserved.
Nyhan, J W; White, G C; Trujillo, G
1982-10-01
Stream channel sediments and adjacent bank soils found in three intermittent streams used for treated liquid effluent disposal at Los Alamos, New Mexico were sampled to determine the distribution of 238Pu, 239,240Pu and 137Cs. Radionuclide concentrations and inventories were determined as functions of distance downstream from the waste outfall and from the center of the stream channel, soil sampling depth, stream channel-bank physiography, and the waste use history of each disposal area. Radionuclide concentrations in channel sediments were inversely related to distances up to 10 km downstream from the outfalls. For sites receiving appreciable waste effluent additions, contaminant concentrations in bank soils decreased with perpendicular distances greater than 0.38 m from the stream channel, and with stream bank sampling depths greater than 20-40 cm. Concentrations and total inventories of radionuclides in stream bank soils generally decreased as stream bank height increased. Inventory estimates of radionuclides in channel sediments exhibited coefficients of variation that ranged 0.41-2.6, reflecting the large variation in radionuclide concentrations at each site. Several interesting temporal relationships of these radionuclides in intermittent streams were gleaned from the varying waste use histories of the three effluent-receiving areas. Eleven yr after liquid wastes were added to one canyon, the major radionuclide inventories were found in the stream bank soils, unlike most of the other currently-used receiving areas. A period of time greater than 6 yr seems to be required before the plutonium in liquid wastes currently added to the canyon is approximately equilibrated with the plutonium in the bank soils. These observations are discussed relative to waste management practices in these southwestern intermittent streams.
NASA Astrophysics Data System (ADS)
LaBrie, H. M.; Brusseau, M. L.; Huth, H.
2015-12-01
As water resources become limited in Arizona due to drought and excessive use of ground water, treated wastewater effluent is becoming essential in creating natural ecosystems and recharging the decreasing groundwater supplies. Therefore, future water supplies are heavily dependent of the flow (quantity) and quality of the treated effluent. The Nogales International Wastewater Treatment Plant (NIWTP) releases treated wastewater from both Nogales, Arizona and Nogales, Sonora, Mexico into the Santa Cruz River. This released effluent not only has the potential to impact surface water, but also groundwater supplies in Southern Arizona. In the recent past, the NIWTP has had reoccurring issues with elevated levels of cadmium, in addition to other, more infrequent, releases of high amounts of other metals. The industrial demographic of the region, as well as limited water quality regulations in Mexico makes the NIWTP and its treated effluent an important area of study. In addition, outdated infrastructure can potentially lead to damaging environmental impacts, as well as human health concerns. The Santa Cruz River has been monitored and studied in the past, but in recent years, there has been a halt in research regarding the state of the river. Data from existing water quality databases and recent sampling reports are used to address research questions regarding the state of the Santa Cruz River. These questions include: 1) How will change in flow eventually impact surface water and future groundwater supplies 2) What factors influence this flow (such as extreme flooding and drought) 3) What is the impact of effluent on surface water quality 4) Can changes in surface water quality impact groundwater quality 5) How do soil characteristics and surface flow impact the transport of released contaminants Although outreach to stakeholders across the border and updated infrastructure has improved the quality of water in the river, there are many areas to improve upon as the demand for treated wastewater increases.
Wu, Yong-li; Shi, Bao-you; Sun, Hui-fang; Zhang, Zhi-huan; Gu, Jun-nong; Wang, Dong-sheng
2013-09-01
To understand the processes of corrosion by-product release and the consequent "red water" problems caused by the variation of water chemical composition in drinking water distribution system, the effect of sulphate and dissolved oxygen (DO) concentration on total iron release in corroded old iron pipe sections historically transporting groundwater was investigated in laboratory using small-scale pipe section reactors. The release behaviors of some low-level metals, such as Mn, As, Cr, Cu, Zn and Ni, in the process of iron release were also monitored. The results showed that the total iron and Mn release increased significantly with the increase of sulphate concentration, and apparent red water occurred when sulphate concentration was above 400 mg x L(-1). With the increase of sulfate concentration, the effluent concentrations of As, Cr, Cu, Zn and Ni also increased obviously, however, the effluent concentrations of these metals were lower than the influent concentrations under most circumstances, which indicated that adsorption of these metals by pipe corrosion scales occurred. Increasing DO within a certain range could significantly inhibit the iron release.
78 FR 4170 - License Amendment Request for Analytical Bio-Chemistry Laboratories, Inc., Columbia, MO
Federal Register 2010, 2011, 2012, 2013, 2014
2013-01-18
... clay layer. Since the mean concentration of the effluent discharge area of the sanitary lagoon is well... authorize the release of the licensee's sanitary lagoon and the surrounding effluent discharge area for... the west side of the site and comprised approximately 28 acres. The licensee's sanitary lagoon was...
Treatment of silica effluents: ultrafiltration or coagulation-decantation.
Ndiaye, P I; Moulin, P; Dominguez, L; Millet, J C; Charbit, F
2004-12-10
In the electronics industry, the preparation of silicon plates generates effluents that contain a great amount of colloidal silica. Two processes--decantation and ultrafiltration--are studied with in view the treatment of the effluents released by the firm Rockwood Electronic Materials. The feasibility of each of the two processes is studied separately and their operating parameters optimized. Both processes allow the recovery of a great proportion of the initial effluent (over 89%) as transparent and colorless water that can be reused at the start of a line. In view of the results and of the compared advantages and disadvantages of the two processes, ultrafiltration will be selected for the industrial unit.
Alumina Refinery Wastewater Management: When Zero Discharge Just Isn't Feasible….
NASA Astrophysics Data System (ADS)
Martin, Lucy; Howard, Steven
Management and treatment of liquid effluents are determinant considerations in the design of alumina refineries. Rainfall, evaporation rate, proximity to the coast, process design and layout, ore mineralogy, the local environment, and potential impact on contiguous communities are all integral to the development of an appropriate refinery water management strategy. The goal is to achieve zero discharge of liquid effluent to the environment. However this is not always the most feasible solution under the extreme rainfall conditions in tropical and subtropical locations. This paper will explore the following issues for both inland and coastal refineries: • Methods to reduce and control refinery discharges
Furfural production by 'acidic steam stripping' of lignocellulose.
van Buijtenen, Jeroen; Lange, Jean-Paul; Espinosa Alonso, Leticia; Spiering, Wouter; Polmans, Rob F; Haan, Rene J
2013-11-01
Furfural and acetic acid are produced with approximately 60 and 90 mol % yield, respectively, upon stripping bagasse with a gaseous stream of HCl/steam and condensing the effluent to water/furfural/acetic acid. The reaction kinetics is 1(st) order in furfural and 0.5(th) order in HCl. A process concept with full recycling of the reaction effluents is proposed to reduce the energy demand to <10 tonsteam tonfurfural (-1) and facilitate the product recovery through a simple liquid/liquid separation of the condensate into a water-rich and a furfural-rich phase. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Cleanup Verification Package for the 116-K-2 Effluent Trench
DOE Office of Scientific and Technical Information (OSTI.GOV)
J. M. Capron
2006-04-04
This cleanup verification package documents completion of remedial action for the 116-K-2 effluent trench, also referred to as the 116-K-2 mile-long trench and the 116-K-2 site. During its period of operation, the 116-K-2 site was used to dispose of cooling water effluent from the 105-KE and 105-KW Reactors by percolation into the soil. This site also received mixed liquid wastes from the 105-KW and 105-KE fuel storage basins, reactor floor drains, and miscellaneous decontamination activities.
Processing of palm oil mill wastes based on zero waste technology
NASA Astrophysics Data System (ADS)
Irvan
2018-02-01
Indonesia is currently the main producer of palm oil in the world with a total production reached 33.5 million tons per year. In the processing of fresh fruit bunches (FFB) besides producing palm oil and kernel oil, palm oil mills also produce liquid and solid wastes. The increase of palm oil production will be followed by an increase in the production of waste generated. It will give rise to major environmental issues especially the discharge of liquid waste to the rivers, the emission of methane from digestion pond and the incineration of empty fruit bunches (EFB). This paper describes a zero waste technology in processing palm oil mill waste after the milling process. The technology involves fermentation of palm oil mill effluent (POME) to biogas by using continuous stirred tank reactor (CSTR) in the presence of thermophilic microbes, producing activated liquid organic fertilizer (ALOF) from discharge of treated waste effluent from biogas digester, composting EFB by spraying ALOF on the EFB in the composter, and producing pellet or biochar from EFB by pyrolysis process. This concept can be considered as a promising technology for palm oil mills with the main objective of eliminating the effluent from their mills.
Contribution of Hanford liquid effluents to strontium-90 levels in offsite soils
DOE Office of Scientific and Technical Information (OSTI.GOV)
Jaquish, R.E.
1993-08-01
Strontium-90 is a major constituent of liquid effluents entering the Columbia River at the 100-N Area. The Columbia River also contains {sup 90}Sr from world-wide fallout that enters the Columbia River upstream of Hanford. Irrigation water pumped from the Columbia River can deposit {sup 90}Sr on soil where it can be taken up by farm crops. Fallout has also deposited {sup 90}Sr directly on soil by atmospheric deposition. A review of the sources of {sup 90}Sr in soil in the vicinity of Hanford indicates that about 2% can be attributed to Hanford liquid effluents. PNL measurements of {sup 90}Sr inmore » soil at a background location agree with predicted levels of fallout made by the Federal Radiation Council in 1964. Alfalfa is routinely monitored for {sup 90}Sr and is of special interest since it has concentrations higher than other farm crops. The concentrations of {sup 90}Sr in alfalfa measured in the Hanford vicinity are in the range one would expect, based on measured soil concentrations and using uptake factors from an earlier {sup 90}Sr uptake study at Hanford.« less
Vanotti, Matias B; Szogi, Ariel A
2008-01-01
Current trends of animal production concentration and new regulations promote the need for environmentally safe alternatives to land application of liquid manure. These technologies must be able to substantially remove nutrients, heavy metals, and emissions of ammonia and odors and disinfect the effluent. A new treatment system was tested full-scale in a 4360-swine farm in North Carolina to demonstrate environmentally superior technology (EST) that could replace traditional anaerobic lagoon treatment. The system combined liquid-solids separation with nitrogen and phosphorus removal processes. Water quality was monitored at three sites: (i) the treatment plant as the raw manure liquid was depurated in the various processes, (ii) the converted lagoon as it was being cleaned up with the treated effluent, and (iii) an adjacent traditional anaerobic lagoon. The treatment plant removed 98% of total suspended solids (TSS), 76% of total solids (TS), 100% of 5-d biochemical oxygen demand (BOD(5)), 98% of total Kjeldahl nitrogen (TKN) and NH(4)-N, 95% of total phosphorus (TP), 99% of Zn, and 99% of Cu. The quality of the liquid in the converted lagoon improved rapidly as cleaner effluent from the plant replaced anaerobic lagoon liquid. The converted lagoon liquid became aerobic (dissolved oxygen, 6.95 mg L(-1); Eh, 342 mv) with the following mean reductions in the second year of the conversion: 73% of TSS, 40% of TS, 77% of BOD(5), 85% of TKN, 92% of NH(4)-N, 38% of TP, 37% of Zn, and 39% of Cu. These findings overall showed that EST can have significant positive impacts on the environment and on the livestock industries.
Liquid secondary waste. Waste form formulation and qualification
DOE Office of Scientific and Technical Information (OSTI.GOV)
Cozzi, A. D.; Dixon, K. L.; Hill, K. A.
The Hanford Site Effluent Treatment Facility (ETF) currently treats aqueous waste streams generated during Site cleanup activities. When the Hanford Tank Waste Treatment and Immobilization Plant (WTP) begins operations, a liquid secondary waste (LSW) stream from the WTP will need to be treated. The volume of effluent for treatment at the ETF will increase significantly. Washington River Protection Solutions is implementing a Secondary Liquid Waste Immobilization Technology Development Plan to address the technology needs for a waste form and solidification process to treat the increased volume of waste planned for disposal at the Integrated Disposal Facility IDF). Waste form testingmore » to support this plan is composed of work in the near term to demonstrate the waste form will provide data as input to a performance assessment (PA) for Hanford’s IDF.« less
Water reuse in the l-lysine fermentation process
DOE Office of Scientific and Technical Information (OSTI.GOV)
Hsiao, T.Y.; Glatz, C.E.
1996-02-05
L-Lysine is produced commercially by fermentation. As is typical for fermentation processes, a large amount of liquid waste is generated. To minimize the waste, which is mostly the broth effluent from the cation exchange column used for l-lysine recovery, the authors investigated a strategy of recycling a large fraction of this broth effluent to the subsequent fermentation. This was done on a lab-scale process with Corynebacterium glutamicum ATCC 21253 as the l-lysine-producing organisms. Broth effluent from a fermentation in a defined medium was able to replace 75% of the water for the subsequent batch; this recycle ratio was maintained formore » 3 sequential batches without affecting cell mass and l-lysine production. Broth effluent was recycled at 50% recycle ratio in a fermentation in a complex medium containing beet molasses. The first recycle batch had an 8% lower final l-lysine level, but 8% higher maximum cell mass. In addition to reducing the volume of liquid waste, this recycle strategy has the additional advantage of utilizing the ammonium desorbed from the ion-exchange column as a nitrogen source in the recycle fermentation. The major problem of recycling the effluent from the complex medium was in the cation-exchange operation, where column capacity was 17% lower for the recycle batch. The loss of column capacity probably results from the buildup of cations competing with l-lysine for binding.« less
Code of Federal Regulations, 2012 CFR
2012-07-01
... from nitric acid production in which all the raw material ammonia is in the gaseous form: [Metric units... limitations Maximum for any 1 day Average of daily values for 30 consecutive days shall not exceed— Ammonia... all the raw material ammonia is in the shipped liquid form: [Metric units, kg/kkg of product; English...
Code of Federal Regulations, 2011 CFR
2011-07-01
... from nitric acid production in which all the raw material ammonia is in the gaseous form: [Metric units... limitations Maximum for any 1 day Average of daily values for 30 consecutive days shall not exceed— Ammonia... all the raw material ammonia is in the shipped liquid form: [Metric units, kg/kkg of product; English...
Code of Federal Regulations, 2014 CFR
2014-07-01
... from nitric acid production in which all the raw material ammonia is in the gaseous form: [Metric units... limitations Maximum for any 1 day Average of daily values for 30 consecutive days shall not exceed— Ammonia... all the raw material ammonia is in the shipped liquid form: [Metric units, kg/kkg of product; English...
Code of Federal Regulations, 2013 CFR
2013-07-01
... from nitric acid production in which all the raw material ammonia is in the gaseous form: [Metric units... limitations Maximum for any 1 day Average of daily values for 30 consecutive days shall not exceed— Ammonia... all the raw material ammonia is in the shipped liquid form: [Metric units, kg/kkg of product; English...
Code of Federal Regulations, 2010 CFR
2010-07-01
... from nitric acid production in which all the raw material ammonia is in the gaseous form: [Metric units... limitations Maximum for any 1 day Average of daily values for 30 consecutive days shall not exceed— Ammonia... all the raw material ammonia is in the shipped liquid form: [Metric units, kg/kkg of product; English...
Fuel cell system with combustor-heated reformer
Pettit, William Henry
2000-01-01
A fuel cell system including a fuel reformer heated by a catalytic combustor fired by anode effluent and/or fuel from a liquid fuel supply providing fuel for the fuel cell. The combustor includes a vaporizer section heated by the combustor exhaust gases for vaporizing the fuel before feeding it into the combustor. Cathode effluent is used as the principle oxidant for the combustor.
300 Area treated effluent disposal facility sampling schedule
DOE Office of Scientific and Technical Information (OSTI.GOV)
Loll, C.M.
1994-10-11
This document is the interface between the 300 Area Liquid Effluent Process Engineering (LEPE) group and the Waste Sampling and Characterization Facility (WSCF), concerning process control samples. It contains a schedule for process control samples at the 300 Area TEDF which describes the parameters to be measured, the frequency of sampling and analysis, the sampling point, and the purpose for each parameter.
Oak Ridge Reservation Annual Site Environmental Report for 2009
DOE Office of Scientific and Technical Information (OSTI.GOV)
Bechtel Jacobs
2010-09-01
The Oak Ridge Reservation Annual Site Environmental Report is prepared animally and presents summary environmental data to (1) characterize environmental performance, (2) summarize environmental occurrences reported during the year, (3) confirm compliance with environmental standards and requirements, and (4) highlight significant program activities. The report fulfills the requirement contained in DOE Order 231.1 A, Environment, Safety and Health Reporting (DOE 2004) that an integrated annual site environmental report be prepared. The results summarized in this report are based on data collected prior to and through 2009. This report is not intended to nor does it present the results of allmore » environmental monitoring associated with the ORR. Data collected for other site and regulatory purposes, such as environmental restoration/remedial investigation reports, waste management characterization sampling data, and environmental permit compliance data, are presented in other documents that have been prepared in accordance with applicable DOE guidance and/or laws and are referenced herein as appropriate. Appendix A to this report identifies corrections to the 2008 report. Appendix B contains a glossary of technical terms that may be useful for understanding the terminology used in this document. Environmental monitoring on the ORR consists primarily of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents at the points of release to the environment; these measurements allow the quantification and official reporting of contaminant levels, assessment of radiation and chemical exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of direct measurements and collection and analysis of samples taken from the site and its environs exclusive of effluents; these activities provide information on contaminant concentrations in air, water, groundwater, soil, foods, biota, and other media. Environmental surveillance data support determinations regarding environmental compliance and, when combined with data from effluent monitoring, support chemical and radiation dose and exposure assessments regarding the potential effects of ORR operations, if any, on the local environment.« less
Oak Ridge Reservation Annual Site Environmental Report for 2010
DOE Office of Scientific and Technical Information (OSTI.GOV)
Thompson, Sharon D
2011-10-01
The Oak Ridge Reservation Annual Site Environmental Report is prepared annually and presents summary environmental data to (1) characterize environmental performance, (2) summarize environmental occurrences reported during the year, (3) confirm compliance with environmental standards and requirements, and (4) highlight significant program activities. The report fulfills the requirement contained in DOE Order 231.1A, Environment, Safety and Health Reporting (DOE 2004) that an integrated annual site environmental report be prepared. The results summarized in this report are based on data collected prior to and through 2010. This report is not intended to nor does it present the results of all environmentalmore » monitoring associated with the ORR. Data collected for other site and regulatory purposes, such as environmental restoration/remedial investigation reports, waste management characterization sampling data, and environmental permit compliance data, are presented in other documents that have been prepared in accordance with applicable DOE guidance and/or laws and are referenced herein as appropriate. Appendix A to this report identifies corrections to the 2009 report. Appendix B contains a glossary of technical terms that may be useful for understanding the terminology used in this document. Environmental monitoring on the ORR consists primarily of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents at the points of release to the environment; these measurements allow the quantification and official reporting of contaminant levels, assessment of radiation and chemical exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of direct measurements and collection and analysis of samples taken from the site and its environs exclusive of effluents; these activities provide information on contaminant concentrations in air, water, groundwater, soil, foods, biota, and other media. Environmental surveillance data support determinations regarding environmental compliance and, when combined with data from effluent monitoring, support chemical and radiation dose and exposure assessments of the potential effects of ORR operations, if any, on the local environment.« less
Oak Ridge Reservation Annual Site Environmental Report for 2009
DOE Office of Scientific and Technical Information (OSTI.GOV)
Thompson, Sharon D; Loffman, Regis S
2010-10-01
The Oak Ridge Reservation Annual Site Environmental Report is prepared annually and presents summary environmental data to (1) characterize environmental performance, (2) summarize environmental occurrences reported during the year, (3) confirm compliance with environmental standards and requirements, and (4) highlight significant program activities. The report fulfills the requirement contained in DOE Order 231.1A, Environment, Safety and Health Reporting (DOE 2004) that an integrated annual site environmental report be prepared. The results summarized in this report are based on data collected prior to and through 2009. This report is not intended to nor does it present the results of all environmentalmore » monitoring associated with the ORR. Data collected for other site and regulatory purposes, such as environmental restoration/remedial investigation reports, waste management characterization sampling data, and environmental permit compliance data, are presented in other documents that have been prepared in accordance with applicable DOE guidance and/or laws and are referenced herein as appropriate. Appendix A to this report identifies corrections for the 2008 report. Appendix B contains a glossary of technical terms that may be useful for understanding the terminology used in this document. Environmental monitoring on the ORR consists primarily of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents at the points of release to the environment; these measurements allow the quantification and official reporting of contaminant levels, assessment of radiation and chemical exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of direct measurements and collection and analysis of samples taken from the site and its environs exclusive of effluents; these activities provide information on contaminant concentrations in air, water, groundwater, soil, foods, biota, and other media. Environmental surveillance data support determinations regarding environmental compliance and, when combined with data from effluent monitoring, support chemical and radiation dose and exposure assessments regarding the potential effects of ORR operations, if any, on the local environment.« less
Performance of Azolla caroliniana Willd. and Salvinia auriculata Aubl. on fish farming effluent.
Toledo, J J; Penha, J
2011-02-01
The increasing release of untreated fish farming effluents into water courses that flow to the Pantanal wetlands in Mato Grosso (Brazil) may drive this ecosystem to eutrophication. Therefore, the growth of Azolla caroliniana Willd. and Salvinia auriculata Aubl. in fish farming effluent and their effect on its quality were evaluated for 48 days in a greenhouse. The results were compared to those obtained in a nutrient rich solution (Hoagland ½ medium). Azolla caroliniana showed lower relative growth rate in fish farming effluent (0.020 d-1) than in Hoagland ½ medium (0.029 d-1). However, S. auriculata grew slightly better in fish farming effluent (0.030 d-1) than in Hoagland ½ medium (0.025 d-1). The species apparently contributed to reduce nitrate and phosphate concentration in Hoagland ½ medium. However, in fish farming effluent, only electrical conductivity and pH were reduced by plants compared to the control without plants. Thus, A. caroliniana and S. auriculata show low potential for improving effluent quality.
The feasibility of effluent trading in the oil and gas industry
DOE Office of Scientific and Technical Information (OSTI.GOV)
Veil, J.A.
1997-09-01
In January 1996, the U.S. Environmental Protection Agency (EPA) released a policy statement endorsing wastewater effluent trading in watersheds, hoping to promote additional interest in the subject. The policy describes five types of effluent trades - point source/point source, point source/nonpoint source, pretreatment, intraplant, and nonpoint source/nonpoint source. This paper evaluates the feasibility of effluent trading for facilities in the oil and gas industry. The evaluation leads to the conclusion that potential for effluent trading is very low in the exploration and production and distribution and marketing sectors; trading potential is moderate for the refining sector except for intraplant trades,more » for which the potential is high. Good potential also exists for other types of water-related trades that do not directly involve effluents (e.g., wetlands mitigation banking). The potential for effluent trading in the energy industries and in other sectors would be enhanced if Congress amended the Clean Water Act (CWA) to formally authorize such trading.« less
The potential for effluent trading in the energy industries.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Veil, J. A.; Environmental Assessment
1998-01-01
In January 1996, the US Environmental Protection Agency (EPA) released a policy statement endorsing wastewater effluent trading in watersheds, hoping to promote additional interest in the subject. The policy describes five types of effluent trades: point source/point source, point source/nonpoint source, pretreatment, intraplant and nonpoint source/nonpoint source. This paper evaluates the feasibility of implementing these types of effluent trading for facilities in the oil and gas, electric power and coal industries. This paper finds that the potential for effluent trading in these industries is limited because trades would generally need to involve toxic pollutants, which can only be traded undermore » a narrow range of circumstances. However, good potential exists for other types of water-related trades that do not directly involve effluents (e.g. wetlands mitigation banking and voluntary environmental projects). The potential for effluent trading in the energy industries and in other sectors would be enhanced if Congress amended the Clean Water Act (CWA) to formally authorize such trading.« less
Here we utilize in vivo and in vitro approaches to study whether real world effluents released in the Maumee River (Toledo, OH) Area of Concern (AOC) contain neuroactive substances that may impair fish reproduction and behavior. Our approaches help extend the concept of endocrine...
Zhang, Caixiang; Eganhouse, Robert P; Pontolillo, James; Cozzarelli, Isabelle M; Wang, Yanxin
2012-03-23
4-Nonylphenols (4-NPs) are known endocrine disruptors and by-products of the microbial degradation of nonylphenol polyethoxylate surfactants. One of the challenges to understanding the toxic effects of nonylphenols is the large number of isomers that may exist in environmental samples. In order to attribute toxic effects to specific compounds, a method is needed for the separation and quantitation of individual nonylphenol isomers. The pre-concentration methods of solvent sublimation, solid-phase extraction or liquid-liquid extraction prior to chromatographic analysis can be problematic because of co-extraction of thousands of compounds typically found in complex matrices such as municipal wastewater or landfill leachate. In the present study, steam distillation extraction (SDE) was found to be an effective pre-concentration method for extraction of 4-NPs from leachate and wastewater, and comprehensive two-dimensional gas chromatography (GC×GC) coupled with fast mass spectral data acquisition by time-of-flight mass spectrometry (ToFMS) enhanced the resolution and identification of 4-NP isomers. Concentrations of eight 4-NP isomers were determined in leachate from landfill cells of different age and wastewater influent and effluent samples. 4-NP isomers were about 3 times more abundant in leachate from the younger cell than the older one, whereas concentrations in wastewater effluent were either below detection limits or <1% of influent concentrations. 4-NP isomer distribution patterns were found to have been altered following release to the environment. This is believed to reflect isomer-specific degradation and accumulation of 4-NPs in the aquatic environment. Copyright © 2012 Elsevier B.V. All rights reserved.
Nevada Test Site annual site environmental report for calendar year 1996
DOE Office of Scientific and Technical Information (OSTI.GOV)
Black, S.C.; Townsend, Y.E.
1997-10-01
Monitoring and surveillance on and around the Nevada Test Site (NTS) by US Department of Energy (DOE) contractors and NTS user organizations during 1996 indicated that operations on the NTS were conducted in compliance with applicable DOE, state, and federal regulations and guidelines. All discharges of radioactive liquids remained onsite in containment ponds, and there was no indication of potential migration of radioactivity to the offsite area through groundwater. Surveillance around the NTS indicated that airborne radioactivity from diffusion, evaporation of liquid effluents, or resuspension of soil was not detectable offsite, and exposure above background to members of the offsitemore » population was not measured by the offsite monitoring program. Using the US Environmental Protection Agency`s (EPA) Clean Air Package 1988 (CAP88)PC model and NTS radionuclide emissions and environmental monitoring data, the calculated effective dose equivalent (EDE) to the maximally exposed individual offsite would have been 0.11 mrem. This value is less than 2 percent of the federal dose limit prescribed for radionuclide air emissions. Any person receiving this dose would also have received 144 mrem from natural background radiation. There were no nonradiological releases to the offsite area. Hazardous wastes were shipped offsite to approved disposal facilities. Compliance with the various regulations stemming from the National Environmental Policy Act (NEPA) is being achieved and, where mandated, permits for air and water effluents and waste management have been obtained from the appropriate agencies. Cooperation with other agencies has resulted in seven different consent orders and agreements. Support facilities at off-NTS locations have complied with the requirements of air quality permits and state or local wastewater discharge and hazardous waste permits as mandated for each location.« less
Wen, Aiping; Li, Zhe; Yu, Junxian; Li, Ren; Cheng, Sheng; Duan, Meili; Bai, Jing
2016-01-01
The primary objective of this pilot study was to investigate whether the therapeutic drug monitoring of imipenem could be performed with spent effluent instead of blood sampling collected from critically ill patients under continuous renal replacement therapy. A prospective open-label study was conducted in a real clinical setting. Both blood and effluent samples were collected pairwise before imipenem administration and 0.5, 1, 1.5, 2, 3, 4, 6, and 8 h after imipenem administration. Plasma and effluent imipenem concentrations were determined by reversed-phase high-performance liquid chromatography with ultraviolet detection. Pharmacokinetic and pharmacodynamic parameters of blood and effluent samples were calculated. Eighty-three paired plasma and effluent samples were obtained from 10 patients. The Pearson correlation coefficient of the imipenem concentrations in plasma and effluent was 0.950 (P<0.0001). The average plasma-to-effluent imipenem concentration ratio was 1.044 (95% confidence interval, 0.975 to 1.114) with Bland-Altman analysis. No statistically significant difference was found in the pharmacokinetic and pharmacodynamic parameters tested in paired plasma and effluent samples with Wilcoxon test. Spent effluent of continuous renal replacement therapy could be used for therapeutic drug monitoring of imipenem instead of blood sampling in critically ill patients.
Oak Ridge Reservation Annual Site Environmental Report for 2006
DOE Office of Scientific and Technical Information (OSTI.GOV)
McMahon, Wayne; Hughes, Joan; Coffey, Mike
2007-09-01
This document is prepared annually to summarize environmental activities, primarily environmental-monitoring activities, on the Oak Ridge Reservation (ORR) and within the ORR surroundings. The document fulfills the requirement of Department of Energy (DOE) Order 23l.IA, 'Environment, Safety and Health Reporting,' for an annual summary of environmental data to characterize environmental performance. The environmental-monitoring criteria are described in DOE Order 450.1, 'Environmental Protection Program.' The results summarized in this report are based on data collected prior to and through 2006. This report is not intended to provide the results of all sampling on the ORR. Additional data collected for other sitemore » and regulatory purposes, such as environmental restoration remedial investigation reports, waste management characterization sampling data, and environmental permit compliance data, are presented in other documents that have been prepared in accordance with applicable DOE guidance and/or laws and are referenced herein as appropriate. Corrections to the report for the previous year are found in Appendix A. Environmental monitoring on the ORR consists primarily of two major activities: effluent monitoring and environmental surveillance. Effluent monitoring involves the collection and analysis of samples or measurements of liquid and gaseous effluents at the point of release to the environment; these measurements allow the quantification and official reporting of contaminants, assessment of radiation and chemical exposures to the public, and demonstration of compliance with applicable standards and permit requirements. Environmental surveillance consists of the collection and analysis of environmental samples from the site and its environs; these activities provide direct measurement of contaminant concentrations in air, water, groundwater, soil, foods, biota, and other media. Environmental surveillance data provide information regarding conformity with applicable DOE orders and, combined with data from effluent monitoring, allow the determination of chemical and radiation dose/exposure assess ments of ORR operations and effects, if any, on the local environment.« less
Response of spinach and komatsuna to biogas effluent made from source-separated kitchen garbage.
Furukawa, Yuichiro; Hasegawa, Hiroshi
2006-01-01
Recycling of kitchen garbage is an urgent task for reducing public spending and environmental burdens by incineration and/or landfill. There is an interesting regional effort in Ogawa, Saitama prefecture, Japan, in which source-separated kitchen garbage is anaerobically fermented with a biogas plant and the resultant effluent is used as a quick-release organic fertilizer by surrounding farmers. However, scientific assessments of fertilizer values and risks in the use of the effluent were lacking. Thus, a field experiment was conducted from 2003 to 2004 in Tohoku National Agricultural Research Center to grow spinach (Spinacia oleracea L.) and komatsuna (Brassica rapa var. perviridis L. H. Bailey) for evaluating the fertilizer value of the kitchen garbage effluent (KGE), nitrate, coliform group (CG), Escherichia coli, fecal streptococci (FS), and Vibrio parahaemolyticus concentrations of KGE and in the soil and the plant leaves. A cattle manure effluent (CME) and chemical fertilizers (NPK) were used as controls. Total nitrogen (N) and ammonium N concentrations of the KGE were 1.47 and 1.46 g kg(-1), respectively. The bacteria tested were detected in both biogas effluents in the order of 2 to 3 log CFU g(-1), but there was little evidence that the biogas effluents increased these bacteria in the soil and the plant leaves. At the rate of 22 g N m(-2), yield, total N uptake, apparent N recovery rate, and leaf nitrate ion concentration at harvest of spinach and komatsuna in the KGE plot were mostly comparable to those in the NPK and CME plots. We conclude that the KGE is a quick-release N fertilizer comparable to chemical fertilizers and does not cause contamination of CG, E. coli, FS, or V. parahaemolyticus in the soil and spinach and komatsuna leaves.
Position sensitive radioactivity detection for gas and liquid chromatography
Cochran, Joseph L.; McCarthy, John F.; Palumbo, Anthony V.; Phelps, Tommy J.
2001-01-01
A method and apparatus are provided for the position sensitive detection of radioactivity in a fluid stream, particularly in the effluent fluid stream from a gas or liquid chromatographic instrument. The invention represents a significant advance in efficiency and cost reduction compared with current efforts.
Echeverría, S; Borrull, F; Fontanals, N; Pocurull, E
2013-11-15
A method for the quantitative determination of five iodinated X-ray contrast media (ICMs) in sewage was developed by solid-phase extraction and high-performance liquid chromatography-tandem mass spectrometry. A fused-core analytical column was successfully applied for the first time for the separation of ICMs. Oasis HLB was selected from the sorbents tested because of its higher recoveries. The optimized method allowed the determination of the ICMs at low ng/L levels in both influent and effluent sewage, with detection limits of 40 ng/L and 10 ng/L for most compounds in influent and effluent sewage, respectively. The five ICMs studied were determined in all samples analysed, with iopromide being the analyte found at the highest concentration (8.9 µg/L), while iopamidol was the analyte found at lowest concentration (1.3 µg/L) in influent sewage. Effluent sewage did not show a significant decrease in ICM concentrations. © 2013 Elsevier B.V. All rights reserved.
LIQUID EFFLUENT RETENTION FACILITY (LERF) BASIN 42 STUDIES
DOE Office of Scientific and Technical Information (OSTI.GOV)
DUNCAN JB
2004-10-29
This report documents laboratory results obtained under test plan RPP-21533 for samples submitted by the Effluent Treatment Facility (ETF) from the Liquid Effluent Retention Facility (LERF) Basin 42 (Reference 1). The LERF Basin 42 contains process condensate (PC) from the 242-A Evaporator and landfill leachate. The ETF processes one PC campaign approximately every 12 to 18 months. A typical PC campaign volume can range from 1.5 to 2.5 million gallons. During the September 2003 ETF Basin 42 processing campaign, a recurring problem with 'gelatinous buildup' on the outlet filters from 60A-TK-I (surge tank) was observed (Figure 1). This buildup appearedmore » on the filters after the contents of the surge tank were adjusted to a pH of between 5 and 6 using sulfuric acid. Biological activity in the PC feed was suspected to be the cause of the gelatinous material. Due to this buildup, the filters (10 {micro}m CUNO) required daily change out to maintain process throughput.« less
Code of Federal Regulations, 2014 CFR
2014-07-01
... material ammonia is in the gaseous form: [Metric units, kg/kkg of product; English units, lb/1,000 lb of... consecutive days shall not exceed— Ammonia (as N) 0.0045 0.00045 Nitrate (as N) 0.17 0.023 (b) The following... from nitric acid production in which all the raw material ammonia is in the shipped liquid form...
Code of Federal Regulations, 2011 CFR
2011-07-01
... material ammonia is in the gaseous form: [Metric units, kg/kkg of product; English units, lb/1,000 lb of... consecutive days shall not exceed— Ammonia (as N) 0.0045 0.00045 Nitrate (as N) 0.17 0.023 (b) The following... from nitric acid production in which all the raw material ammonia is in the shipped liquid form...
Code of Federal Regulations, 2012 CFR
2012-07-01
... material ammonia is in the gaseous form: [Metric units, kg/kkg of product; English units, lb/1,000 lb of... consecutive days shall not exceed— Ammonia (as N) 0.0045 0.00045 Nitrate (as N) 0.17 0.023 (b) The following... from nitric acid production in which all the raw material ammonia is in the shipped liquid form...
Code of Federal Regulations, 2010 CFR
2010-07-01
... material ammonia is in the gaseous form: [Metric units, kg/kkg of product; English units, lb/1,000 lb of... consecutive days shall not exceed— Ammonia (as N) 0.0045 0.00045 Nitrate (as N) 0.17 0.023 (b) The following... from nitric acid production in which all the raw material ammonia is in the shipped liquid form...
Code of Federal Regulations, 2013 CFR
2013-07-01
... material ammonia is in the gaseous form: [Metric units, kg/kkg of product; English units, lb/1,000 lb of... consecutive days shall not exceed— Ammonia (as N) 0.0045 0.00045 Nitrate (as N) 0.17 0.023 (b) The following... from nitric acid production in which all the raw material ammonia is in the shipped liquid form...
300 Area treated effluent disposal facility sampling schedule. Revision 1
DOE Office of Scientific and Technical Information (OSTI.GOV)
Loll, C.M.
1995-03-28
This document is the interface between the 300 Area liquid effluent process engineering (LEPE) group and the waste sampling and characterization facility (WSCF), concerning process control samples. It contains a schedule for process control samples at the 300 Area TEDF which describes the parameters to be measured, the frequency of sampling and analysis, the sampling point, and the purpose for each parameter.
Eyrolle, Frédérique; Claval, David; Gontier, Gilles; Antonelli, Christelle
2008-07-01
Since the beginning of the 1990 s, liquid releases of gamma-emitting radionuclides from French nuclear facilities have generally fallen by almost 85%. Almost 65% of gamma-emitting liquid effluents released into freshwater rivers concerned the River Rhône (Southeast France), with around 85% of this originating from the Marcoule spent fuel reprocessing plant. Upstream of French nuclear plants, artificial radionuclides still detected by gamma spectrometry in 2006, include (137)Cs, (131)I as well as (60)Co, (58)Co and (54)Mn in the case of the Rhine (Switzerland nuclear industries). In the wake of the fallout from the Chernobyl accident, (103)Ru, (106)Rh-Ru, (110 m)Ag, (141)Ce and (129)Te were detected in rivers in the east of France. Some of these radionuclides were found in aquatic plants until 1989. In eastern France, (137)Cs activity in river sediments and mosses is still today two to three times greater than that observed in similar environments in western France. No (134)Cs has been detected upstream of nuclear plants in French rivers since 2001. Downstream of nuclear plants, the gamma emitters still detected regularly in rivers in 2006 are (137)Cs, (134)Cs, (60)Co, (58)Co, (110 m)Ag, (54)Mn, (131)I, together with (241)Am downstream of the Marcoule spent fuel reprocessing plant. Alpha and beta emitters such as plutonium isotopes and (90)Sr first entered freshwaters at the early 1950s due to the leaching of soils contaminated by atmospheric fallout from nuclear testing. These elements were also introduced, in the case of the Rhône River, via effluent from the Marcoule reprocessing plant. Until the mid 1990 s, plutonium isotope levels observed in the lower reaches of the Rhône were 10 to 1000 times higher than those observed in other French freshwaters. Data gathered over a period of almost thirty years of radioecological studies reveal that the only radionuclides detected in fish muscles are (137)Cs, (90)Sr, plutonium isotopes and (241)Am. At the scale of the French territory, there is no significant difference since the mid 1990 s between (137)Cs activity observed downstream of nuclear facilities and that observed upstream, whether in sediments, mosses and fish. Finally, this study highlights that the natural radioactivity of surface freshwaters are around 25 times greater than artificial radioactivity from gamma emitters. However, non gamma emitters released by nuclear industries, such as (3)H, may lead to artificial activity levels 2 to 20 times higher than natural levels.
Complete physico-chemical treatment for coke plant effluents.
Ghose, M K
2002-03-01
Naturally found coal is converted to coke which is suitable for metallurgical industries. Large quantities of liquid effluents produced contain a large amount of suspended solids, high COD, BOD, phenols, ammonia and other toxic substances which are causing serious pollution problem in the receiving water to which they are discharged. There are a large number of coke plants in the vicinity of Jharia Coal Field (JCF). Characteristics of the effluents have been evaluated. The present effluent treatment systems were found to be inadequate. Physico-chemical treatment has been considered as a suitable option for the treatment of coke plant effluents. Ammonia removal by synthetic zeolite, activated carbon for the removal of bacteria, viruses, refractory organics, etc. were utilized and the results are discussed. A scheme has been proposed for the complete physico-chemical treatment, which can be suitably adopted for the recycling, reuse and safe disposal of the treated effluent. Various unit process and unit operations involved in the treatment system have been discussed. The process may be useful on industrial scale at various sites.
Li, Wentao; Xu, Zixiao; Wu, Qian; Li, Yan; Shuang, Chendong; Li, Aimin
2015-03-01
This study focused on the characterization of fluorescent-dissolved organic matter and identification of specific fluorophores in textile effluents. Samples from different textile wastewater treatment plants were characterized by high-performance liquid chromatography and size exclusion chromatography as well as fluorescence excitation-emission matrix spectra. Despite the highly heterogeneous textile effluents, the fluorescent components and their physicochemical properties were found relatively invariable, which is beneficial for the combination of biological and physicochemical treatment processes. The humic-like substance with triple-excitation peaks (excitation (Ex) 250, 310, 365/emission (Em) 460 nm) presented as the specific fluorescence indicator in textile effluents. It was also the major contributor to UV absorbance at 254 nm and resulted in the brown color of biologically treated textile effluents. By spectral comparison, the specific fluorophore in textile effluents could be attributed to the intermediate structure of azo dyes 1-amino-2-naphthol, which was transferred into the special humic-like substances during biological treatment.
Li, Yueh-Fen; Shi, Jian; Nelson, Michael C; Chen, Po-Hsu; Graf, Joerg; Li, Yebo; Yu, Zhongtang
2016-01-01
The objective of this study was to understand how the non-microbial factors of L-AD effluent affected the microbiome composition and successions in the SS-AD digesters using both Illumina sequencing and qPCR quantification of major genera of methanogens. The SS-AD digesters started with a feedstock/total effluent (F/Et) ratio 2.2 (half of the effluent was autoclaved) performed stably, while the SS-AD digesters started with a 4.4 F/Et ratio (no autoclaved effluent) suffered from digester acidification, accumulation of volatile fatty acids, and ceased biogas production two weeks after startup. Some bacteria and methanogens were affected by non-microbial factors of the L-AD fluent. Alkalinity, the main difference between the two F/Et ratios, may be the crucial factor when SS-AD digesters were started using L-AD effluent. Copyright © 2015 Elsevier Ltd. All rights reserved.
Code of Federal Regulations, 2010 CFR
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Design objectives for equipment to control releases of..., Certifications, and Regulatory Approvals; Form; Contents; Ineligibility of Certain Applicants § 50.34a Design objectives for equipment to control releases of radioactive material in effluents—nuclear power reactors. (a...
Code of Federal Regulations, 2013 CFR
2013-01-01
... 10 Energy 1 2013-01-01 2013-01-01 false Design objectives for equipment to control releases of..., Certifications, and Regulatory Approvals; Form; Contents; Ineligibility of Certain Applicants § 50.34a Design objectives for equipment to control releases of radioactive material in effluents—nuclear power reactors. (a...
Code of Federal Regulations, 2011 CFR
2011-01-01
... 10 Energy 1 2011-01-01 2011-01-01 false Design objectives for equipment to control releases of..., Certifications, and Regulatory Approvals; Form; Contents; Ineligibility of Certain Applicants § 50.34a Design objectives for equipment to control releases of radioactive material in effluents—nuclear power reactors. (a...
Code of Federal Regulations, 2012 CFR
2012-01-01
... 10 Energy 1 2012-01-01 2012-01-01 false Design objectives for equipment to control releases of..., Certifications, and Regulatory Approvals; Form; Contents; Ineligibility of Certain Applicants § 50.34a Design objectives for equipment to control releases of radioactive material in effluents—nuclear power reactors. (a...
Code of Federal Regulations, 2014 CFR
2014-01-01
... 10 Energy 1 2014-01-01 2014-01-01 false Design objectives for equipment to control releases of..., Certifications, and Regulatory Approvals; Form; Contents; Ineligibility of Certain Applicants § 50.34a Design objectives for equipment to control releases of radioactive material in effluents—nuclear power reactors. (a...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pierce, Eric M.; Mattigod, Shas V.; Westsik, Joseph H.
2010-01-30
Pacific Northwest National Laboratory has initiated a waste form testing program to support the long-term durability evaluation of a waste form for secondary wastes generated from the treatment and immobilization of Hanford radioactive tank wastes. The purpose of the work discussed in this report is to identify candidate stabilization technologies and getters that have the potential to successfully treat the secondary waste stream liquid effluent, mainly from off-gas scrubbers and spent solids, produced by the Hanford Tank Waste Treatment and Immobilization Plant (WTP). Down-selection to the most promising stabilization processes/waste forms is needed to support the design of a solidificationmore » treatment unit (STU) to be added to the Effluent Treatment Facility (ETF). To support key decision processes, an initial screening of the secondary liquid waste forms must be completed by February 2010.« less
33 CFR 157.12d - Technical specifications.
Code of Federal Regulations, 2013 CFR
2013-07-01
... pipe runs full of liquid at all times during the discharge of the effluent. Sampling probes must... line as appropriate, so as to be always filled with the liquid being discharged. (2) A flow meter must... Design, Equipment, and Installation § 157.12d Technical specifications. (a) Oil discharge monitoring and...
33 CFR 157.12d - Technical specifications.
Code of Federal Regulations, 2012 CFR
2012-07-01
... pipe runs full of liquid at all times during the discharge of the effluent. Sampling probes must... line as appropriate, so as to be always filled with the liquid being discharged. (2) A flow meter must... Design, Equipment, and Installation § 157.12d Technical specifications. (a) Oil discharge monitoring and...
Temperature control system for a J-module heat exchanger
Basdekas, Demetrios L.; Macrae, George; Walsh, Joseph M.
1978-01-01
The level of primary fluid is controlled to change the effective heat transfer area of a heat exchanger utilized in a liquid metal nuclear power plant to eliminate the need for liquid metal control valves to regulate the flow of primary fluid and the temperature of the effluent secondary fluid.
40 CFR Table 2 to Subpart Nnnnn of... - Operating Limits
Code of Federal Regulations, 2011 CFR
2011-07-01
... vented to a control device. For each . . . You must . . . 1. Caustic scrubber or water scrubber/absorber a. Maintain the daily average scrubber inlet liquid or recirculating liquid flow rate, as appropriate, above the operating limit; andb. Maintain the daily average scrubber effluent pH within the...
40 CFR Table 2 to Subpart Nnnnn of... - Operating Limits
Code of Federal Regulations, 2010 CFR
2010-07-01
... vented to a control device. For each . . . You must . . . 1. Caustic scrubber or water scrubber/absorber a. Maintain the daily average scrubber inlet liquid or recirculating liquid flow rate, as appropriate, above the operating limit; andb. Maintain the daily average scrubber effluent pH within the...
Impact simulation of shrimp farm effluent on BOD-DO in Setiu River
NASA Astrophysics Data System (ADS)
Chong, Michael Sueng Lock; Teh, Su Yean; Koh, Hock Lye
2017-08-01
Release of effluent from intensive aquaculture farms into a river can pollute the receiving river and exert negative impacts on the aquatic ecosystem. In this paper, we simulate the effects of effluent released from a marine shrimp aquaculture farm into Sg Setiu, focusing on two critical water quality parameters i.e. DO (dissolved oxygen) and BOD (biochemical oxygen demand). DO is an important constituent in a river in sustaining water quality, with levels of DO below 5 mg/L deemed undesirable. DO levels can be depressed by the presence of BOD and other organics that consume DO. Water quality simulations in conjunction with management of effluent treatment can suggest mitigation measures for reducing the adverse environmental impact. For this purpose, an in-house two-dimensional water quality simulation model codenamed TUNA-WQ will be used for these simulations. TUNA-WQ has been undergoing regular updates and improvements to broaden the applicability and to improve the robustness. Here, the model is calibrated and verified for simulation of DO and BOD dynamics in Setiu River (Sg Setiu). TUNA-WQ simulated DO and BOD in Setiu River due to the discharge from a marine shrimp aquaculture farm will be presented.
Optimizing liquid effluent monitoring at a large nuclear complex.
Chou, Charissa J; Barnett, D Brent; Johnson, Vernon G; Olson, Phil M
2003-12-01
Effluent monitoring typically requires a large number of analytes and samples during the initial or startup phase of a facility. Once a baseline is established, the analyte list and sampling frequency may be reduced. Although there is a large body of literature relevant to the initial design, few, if any, published papers exist on updating established effluent monitoring programs. This paper statistically evaluates four years of baseline data to optimize the liquid effluent monitoring efficiency of a centralized waste treatment and disposal facility at a large defense nuclear complex. Specific objectives were to: (1) assess temporal variability in analyte concentrations, (2) determine operational factors contributing to waste stream variability, (3) assess the probability of exceeding permit limits, and (4) streamline the sampling and analysis regime. Results indicated that the probability of exceeding permit limits was one in a million under normal facility operating conditions, sampling frequency could be reduced, and several analytes could be eliminated. Furthermore, indicators such as gross alpha and gross beta measurements could be used in lieu of more expensive specific isotopic analyses (radium, cesium-137, and strontium-90) for routine monitoring. Study results were used by the state regulatory agency to modify monitoring requirements for a new discharge permit, resulting in an annual cost savings of US dollars 223,000. This case study demonstrates that statistical evaluation of effluent contaminant variability coupled with process knowledge can help plant managers and regulators streamline analyte lists and sampling frequencies based on detection history and environmental risk.
Chang, Hong; Shen, Xiaoyan; Shao, Bing; Wu, Fengchang
2018-04-01
An isotope-dilution ultra-performance liquid chromatography-electrospray tandem mass spectrometry method combined with dansylation was established to sensitively quantify four steroid estrogens (estrone, 17α-estradiol, 17β-estradiol and 17α-ethynylestradiol) and bisphenol A in sewage influent and effluent. A simple hexane extraction was performed from a small volume (10 mL), followed by dansyl chloride derivatization and purification with a silica cartridge. The method effectively reduced the matrix effects in sample extract and permitted the selective and sensitive determination of target compounds from complicated matrices. The detection limits of the method for steroid estrogens were 0.20-0.90 ng L -1 in influent and 0.10-0.20 ng L -1 in effluent samples. For bisphenol A, the limits detection of the method were 20 and 0.80 for influent and effluent samples, respectively. Recoveries of 85%-96% were observed in all matrices. The method was applied to analyze residual estrogens and bisphenol A in sewage influent and effluent samples from Beijing, China. The concentrations of bisphenol A (636-1200 ng L -1 ) were up to 250 times higher than those of steroid estrogens. Estrone was the dominant estrogen in influent and effluent samples, while similar concentrations of 17α-estradiol and 17β-estradiol were detected in all samples. Copyright © 2018 Elsevier Ltd. All rights reserved.
An overview of radioactive waste disposal procedures of a nuclear medicine department
Ravichandran, R.; Binukumar, J. P.; Sreeram, Rajan; Arunkumar, L. S.
2011-01-01
Radioactive wastes from hospitals form one of the various types of urban wastes, which are managed in developed countries in a safe and organized way. In countries where growth of nuclear medicine services are envisaged, implementations of existing regulatory policies and guidelines in hospitals in terms of handling of radioactive materials used in the treatment of patients need a good model. To address this issue, a brief description of the methods is presented. A designed prototype waste storage trolley is found to be of great help in decaying the I-131 solid wastes from wards before releasing to waste treatment plant of the city. Two delay tanks with collection time of about 2 months and delay time of 2 months alternately result in 6 releases of urine toilet effluents to the sewage treatment plant (STP) of the hospital annually. Samples of effluents collected at releasing time documented radioactive releases of I-131 much below recommended levels of bi-monthly release. External counting of samples showed good statistical correlation with calculated values. An overview of safe procedures for radioactive waste disposal is presented. PMID:21731225
An overview of radioactive waste disposal procedures of a nuclear medicine department.
Ravichandran, R; Binukumar, J P; Sreeram, Rajan; Arunkumar, L S
2011-04-01
Radioactive wastes from hospitals form one of the various types of urban wastes, which are managed in developed countries in a safe and organized way. In countries where growth of nuclear medicine services are envisaged, implementations of existing regulatory policies and guidelines in hospitals in terms of handling of radioactive materials used in the treatment of patients need a good model. To address this issue, a brief description of the methods is presented. A designed prototype waste storage trolley is found to be of great help in decaying the I-131 solid wastes from wards before releasing to waste treatment plant of the city. Two delay tanks with collection time of about 2 months and delay time of 2 months alternately result in 6 releases of urine toilet effluents to the sewage treatment plant (STP) of the hospital annually. Samples of effluents collected at releasing time documented radioactive releases of I-131 much below recommended levels of bi-monthly release. External counting of samples showed good statistical correlation with calculated values. An overview of safe procedures for radioactive waste disposal is presented.
Napper, Imogen E; Thompson, Richard C
2016-11-15
Washing clothes made from synthetic materials has been identified as a potentially important source of microscopic fibres to the environment. This study examined the release of fibres from polyester, polyester-cotton blend and acrylic fabrics. These fabrics were laundered under various conditions of temperature, detergent and conditioner. Fibres from waste effluent were examined and the mass, abundance and fibre size compared between treatments. Average fibre size ranged between 11.9 and 17.7μm in diameter, and 5.0 and 7.8mm in length. Polyester-cotton fabric consistently shed significantly fewer fibres than either polyester or acrylic. However, fibre release varied according to wash treatment with various complex interactions. We estimate over 700,000 fibres could be released from an average 6kg wash load of acrylic fabric. As fibres have been reported in effluent from sewage treatment plants, our data indicates fibres released by washing of clothing could be an important source of microplastics to aquatic habitats. Copyright © 2016 Elsevier Ltd. All rights reserved.
Wen, Aiping; Li, Zhe; Yu, Junxian; Li, Ren; Cheng, Sheng; Duan, Meili; Bai, Jing
2016-01-01
Objectives The primary objective of this pilot study was to investigate whether the therapeutic drug monitoring of imipenem could be performed with spent effluent instead of blood sampling collected from critically ill patients under continuous renal replacement therapy. Methods A prospective open-label study was conducted in a real clinical setting. Both blood and effluent samples were collected pairwise before imipenem administration and 0.5, 1, 1.5, 2, 3, 4, 6, and 8 h after imipenem administration. Plasma and effluent imipenem concentrations were determined by reversed-phase high-performance liquid chromatography with ultraviolet detection. Pharmacokinetic and pharmacodynamic parameters of blood and effluent samples were calculated. Results Eighty-three paired plasma and effluent samples were obtained from 10 patients. The Pearson correlation coefficient of the imipenem concentrations in plasma and effluent was 0.950 (P<0.0001). The average plasma-to-effluent imipenem concentration ratio was 1.044 (95% confidence interval, 0.975 to 1.114) with Bland-Altman analysis. No statistically significant difference was found in the pharmacokinetic and pharmacodynamic parameters tested in paired plasma and effluent samples with Wilcoxon test. Conclusion Spent effluent of continuous renal replacement therapy could be used for therapeutic drug monitoring of imipenem instead of blood sampling in critically ill patients. PMID:27093294
Radiological Impact of Tritium from Gaseous Effluent Releases at Cook Nuclear Power Plant
NASA Astrophysics Data System (ADS)
Young, Joshua Allan
The purpose of this study was to investigate the washout of tritiated water by snow and rain from gaseous effluent releases at Donald C. Cook Nuclear Power Plant. Primary concepts studied were determination of washout coefficients for rainfall and snowfall; correlations between rainfall and snow fall tritium concentrations with tritium concentrations in the spent fuel pool, reactor cooling systems, and tritium release rates; and calculations of received doses from the process of recapture. The dose calculations are under the assumption of a maximally exposed individual to get the most conservative estimate of the effect that washout of tritiated water has on individuals around the plant site. This study is in addition to previous work that has been conducted at Cook Nuclear Power Plant for several years. The calculated washout coefficients were typically within the range of 1x10-7s -1 to 1x10-5s-1. A strong correlation between tritium concentration within the spent fuel pool and the tritium release rates was determined.
Short residence time coal liquefaction process including catalytic hydrogenation
Anderson, R.P.; Schmalzer, D.K.; Wright, C.H.
1982-05-18
Normally solid dissolved coal product and a distillate liquid product are produced by continuously passing a feed slurry comprising raw feed coal and a recycle solvent oil and/or slurry together with hydrogen to a preheating-reaction zone, the hydrogen pressure in the preheating-reaction zone being at least 1,500 psig (105 kg/cm[sup 2]), reacting the slurry in the preheating-reaction zone at a temperature in the range of between about 455 and about 500 C to dissolve the coal to form normally liquid coal and normally solid dissolved coal. A total slurry residence time is maintained in the reaction zone ranging from a finite value from about 0 to about 0.2 hour, and reaction effluent is continuously and directly contacted with a quenching fluid to substantially immediately reduce the temperature of the reaction effluent to below 425 C to substantially inhibit polymerization so that the yield of insoluble organic matter comprises less than 9 weight percent of said feed coal on a moisture-free basis. The reaction is performed under conditions of temperature, hydrogen pressure and residence time such that the quantity of distillate liquid boiling within the range C[sub 5]-454 C is an amount at least equal to that obtainable by performing the process under the same condition except for a longer total slurry residence time, e.g., 0.3 hour. Solvent boiling range liquid is separated from the reaction effluent and recycled as process solvent. The amount of solvent boiling range liquid is sufficient to provide at least 80 weight percent of that required to maintain the process in overall solvent balance. 6 figs.
Short residence time coal liquefaction process including catalytic hydrogenation
Anderson, Raymond P.; Schmalzer, David K.; Wright, Charles H.
1982-05-18
Normally solid dissolved coal product and a distillate liquid product are produced by continuously passing a feed slurry comprising raw feed coal and a recycle solvent oil and/or slurry together with hydrogen to a preheating-reaction zone (26, alone, or 26 together with 42), the hydrogen pressure in the preheating-reaction zone being at least 1500 psig (105 kg/cm.sup.2), reacting the slurry in the preheating-reaction zone (26, or 26 with 42) at a temperature in the range of between about 455.degree. and about 500.degree. C. to dissolve the coal to form normally liquid coal and normally solid dissolved coal. A total slurry residence time is maintained in the reaction zone ranging from a finite value from about 0 to about 0.2 hour, and reaction effluent is continuously and directly contacted with a quenching fluid (40, 68) to substantially immediately reduce the temperature of the reaction effluent to below 425.degree. C. to substantially inhibit polymerization so that the yield of insoluble organic matter comprises less than 9 weight percent of said feed coal on a moisture-free basis. The reaction is performed under conditions of temperature, hydrogen pressure and residence time such that the quantity of distillate liquid boiling within the range C.sub.5 -454.degree. C. is an amount at least equal to that obtainable by performing the process under the same condition except for a longer total slurry residence time, e.g., 0.3 hour. Solvent boiling range liquid is separated from the reaction effluent (83) and recycled as process solvent (16). The amount of solvent boiling range liquid is sufficient to provide at least 80 weight percent of that required to maintain the process in overall solvent balance.
Method for treating wastewater using microorganisms and vascular aquatic plants
NASA Technical Reports Server (NTRS)
Wolverton, B. C. (Inventor)
1983-01-01
A method for treating wastewater compresses subjecting the wastewater to an anaerobic setting step for at least 6 hours and passing the liquid effluent from the anaerobic settling step through a filter cell in an upflow manner. There the effluent is subjected first to the action of anaerobic and facultative microorganisms, and then to the action of aerobic microorganisms and the roots of at least one vascular aquatic plant.
Tritium recapture behavior at a nuclear power reactor due to airborne releases.
Harris, Jason T; Miller, David W; Foster, Doug W
2008-08-01
This paper describes the initiatives taken by Cook Nuclear Plant to study the on-site behavior of recaptured tritium released in its airborne effluents. Recapture is the process where a released radioactive effluent, in this case tritium, is brought back on-site through some mechanism. Precipitation, shifts in wind direction, or anthropogenic structures that restrict or alter effluent movement can all lead to recapture. The investigation was started after tritium was detected in the north storm drain outfall. Recent inadvertent tritium releases by several other nuclear power plants, many of which entered the groundwater, have led to increased surveillance and scrutiny by regulatory authorities and the general public. To determine the source of tritium in the outfall, an on-site surface water, well water, rainwater and air-conditioning condensate monitoring program was begun. Washout coefficients were also determined to compare with results reported by other nuclear power plants. Program monitoring revealed detectable tritium concentrations in several precipitation sample locations downwind of the two monitored containment building release vents. Tritium was found in higher concentrations in air-conditioning condensate, with a mean value of 528 Bq L(-1) (14,300 pCi L(-1)). The condensate, and to a lesser extent rainwater, were contributing to the tritium found in the north storm drain outfall. Maximum concentration values for each sample type were used to estimate the most conservative dose. A maximum dose of 1.1 x 10(-10) mSv (1.1 x 10(-8) mrem) total body was calculated to determine the health impact of the tritium detected.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Specht, W.L.
1991-10-01
In anticipation of the fall 1988 start up of effluent discharges into Upper Three Creek by the F/H Area Effluent Treatment Facility of the Savannah River Site, Aiken, SC, a two and one half year biological study was initiated in June 1987. Upper Three Runs Creek is an intensively studied fourth order stream known for its high species richness. Designed to assess the potential impact of F?H area effluent on the creek, the study includes qualitative and quantitative macroinvertebrate stream surveys at five sites, chronic toxicity testing of the effluent, water chemistry and bioaccumulation analysis. This final report presents themore » results of both pre-operational and post-operational qualitative and quantitative (artificial substrate) macroinvertebrate studies. Six quantitative and three qualitative studies were conducted prior to the initial release of the F/H ETF effluent and five quantitative and two qualitative studies were conducted post-operationally.« less
Liquid by-products from fish canning industry as sustainable sources of ω3 lipids.
Monteiro, Ana; Paquincha, Diogo; Martins, Florinda; Queirós, Rui P; Saraiva, Jorge A; Švarc-Gajić, Jaroslava; Nastić, Nataša; Delerue-Matos, Cristina; Carvalho, Ana P
2018-08-01
Fish canning industry generates large amounts of liquid wastes, which are discarded, after proper treatment to remove the organic load. However, alternative treatment processes may also be designed in order to target the recovery of valuable compounds; with this procedure, these wastewaters are converted into liquid by-products, becoming an additional source of revenue for the company. This study evaluated green and economically sustainable methodologies for the extraction of ω3 lipids from fish canning liquid by-products. Lipids were extracted by processes combining physical and chemical parameters (conventional and pressurized extraction processes), as well as chemical and biological parameters. Furthermore, LCA was applied to evaluate the environmental performance and costs indicators for each process. Results indicated that extraction with high hydrostatic pressure provides the highest amounts of ω3 polyunsaturated fatty acids (3331,5 mg L -1 effluent), apart from presenting the lowest environmental impact and costs. The studied procedures allow to obtain alternative, sustainable and traceable sources of ω3 lipids for further applications in food, pharmaceutical and cosmetic industries. Additionally, such approach contributes towards the organic depuration of canning liquid effluents, therefore reducing the overall waste treatment costs. Copyright © 2018 Elsevier Ltd. All rights reserved.
Leifeld, Vanessa; Dos Santos, Tâmisa Pires Machado; Zelinski, Danielle Wisniewski; Igarashi-Mafra, Luciana
2018-09-15
Cassava is the most important tuberous root in tropical and subtropical regions of the world, being the third largest source of carbohydrates. The root processing is related to the production of starch, an important industrial input, which releases a highly toxic liquid wastewater due to its complex composition, which inhibits high performances of conventional effluent treatments. This study aims to evaluate Fenton-like and photo-Fenton-like reactions for treatment of cassava wastewater, reusing ferrous ions from the preliminary coagulation stage. Pre-treated cassava wastewater was submitted to oxidation in three variations of hydrogen peroxide concentrations, with more relevant analytical responses verified in color, turbidity, COD (Chemical Oxygen Demand), and acute toxicity in Artemia salina, besides the action of radicals during Fenton-like reactions. At higher peroxide concentrations, a decrease of 68% in turbidity and 70% in COD on the photo-Fenton-like system was observed, even at slow reaction rates (fastest rate constant k = 2 × 10 -4 min -1 ). Inclusion of UV increases the viability of the Fenton-like reactions by supplementing the reaction medium with hydroxyl radicals, verified by the tert-butanol tests. The oxidation process leads to high EC 50 values in 24 h of incubation in Fenton-like reactions and 48 h in photo-Fenton-like reactions. Final COD and turbidity suggests that the reuse of iron, which remains in the preliminary treatment step shows a great potential as a catalyst for Fenton-like advanced oxidation processes. Tertiary treatment can be less expensive and harmful to the environment, reducing production of residual sludge and metal content in the final effluent, which reduces polluting potential of the effluent regarding solid waste. Copyright © 2018 Elsevier Ltd. All rights reserved.
Controlled decomposition and oxidation: A treatment method for gaseous process effluents
NASA Technical Reports Server (NTRS)
Mckinley, Roger J. B., Sr.
1990-01-01
The safe disposal of effluent gases produced by the electronics industry deserves special attention. Due to the hazardous nature of many of the materials used, it is essential to control and treat the reactants and reactant by-products as they are exhausted from the process tool and prior to their release into the manufacturing facility's exhaust system and the atmosphere. Controlled decomposition and oxidation (CDO) is one method of treating effluent gases from thin film deposition processes. CDO equipment applications, field experience, and results of the use of CDO equipment and technological advances gained from the field experiences are discussed.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pedersen, G.C.; Bhattachararjee, P.K.
1997-11-01
The available methods for removing pollutants from a gas stream are numerous, to say the least. A popular method, scrubbers allow users to separate gases and solids by allowing the gas to come into contact with a liquid stream. In the end, the pollutants are washed away in the effluent, and the gas exits the system to be used in later processes or to be released into the atmosphere. For many years, counter-flow scrubber methods have been used for the lion`s share of the work in industries such as phosphate fertilizer and semiconductor chemicals manufacturing. Now these industries are exploringmore » the use of cross-flow scrubber design, which offers consistently high efficiency and low operating costs. In addition, the unit`s horizontal orientation makes maintenance easier than typical tower scrubbers. For certain classes of unit operations, cross-flow is now being recognized as a strong alternative to conventional counterflow technology.« less
Biological monitoring of Upper Three Runs Creek, Savannah River Plant, Aiken County, South Carolina
DOE Office of Scientific and Technical Information (OSTI.GOV)
Specht, W.L.
1991-10-01
In anticipation of the fall 1988 start up of effluent discharges into Upper Three Creek by the F/H Area Effluent Treatment Facility of the Savannah River Site, Aiken, SC, a two and one half year biological study was initiated in June 1987. Upper Three Runs Creek is an intensively studied fourth order stream known for its high species richness. Designed to assess the potential impact of F H area effluent on the creek, the study includes qualitative and quantitative macroinvertebrate stream surveys at five sites, chronic toxicity testing of the effluent, water chemistry and bioaccumulation analysis. This final report presentsmore » the results of both pre-operational and post-operational qualitative and quantitative (artificial substrate) macroinvertebrate studies. Six quantitative and three qualitative studies were conducted prior to the initial release of the F/H ETF effluent and five quantitative and two qualitative studies were conducted post-operationally.« less
ATMOSPHERIC RELEASES FROM STANDARDIZED NUCLEAR POWER PLANTS: A WIND TUNNEL STUDY
Laboratory experiments were conducted to simulate radiopollutant effluents released to the atmosphere from two standard design nuclear power plants. The main objective of the study was to compare the dispersion in the wake of the standardized nuclear power plants with that in a s...
Method for radioactivity monitoring
Umbarger, C. John; Cowder, Leo R.
1976-10-26
The disclosure relates to a method for analyzing uranium and/or thorium contents of liquid effluents preferably utilizing a sample containing counting chamber. Basically, 185.7-keV gamma rays following .sup.235 U alpha decay to .sup.231 Th which indicate .sup.235 U content and a 63-keV gamma ray doublet found in the nucleus of .sup.234 Pa, a granddaughter of .sup.238 U, are monitored and the ratio thereof taken to derive uranium content and isotopic enrichment .sup.235 U/.sup.235 U + .sup.238 U) in the liquid effluent. Thorium content is determined by monitoring the intensity of 238-keV gamma rays from the nucleus of .sup.212 Bi in the decay chain of .sup.232 Th.
Radiological impact of airborne effluents of coal and nuclear plants.
McBride, J P; Moore, R E; Witherspoon, J P; Blanco, R E
1978-12-08
Radiation doses from airborne effluents of model coal-fired and nuclear power plants (1000 megawatts electric) are compared. Assuming a 1 percent ash release to the atmosphere (Environmental Protection Agency regulation) and 1 part per million of uranium and 2 parts per million of thorium in the coal (approximately the U.S. average), population doses from the coal plant are typically higher than those from pressurized-water or boiling-water reactors that meet government regulations. Higher radionuclide contents and ash releases are common and would result in increased doses from the coal plant. The study does not assess the impact of non-radiological pollutants or the total radiological impacts of a coal versus a nuclear economy.
Impact of industrial effluent on growth and yield of rice (Oryza sativa L.) in silty clay loam soil.
Anwar Hossain, Mohammad; Rahman, Golum Kibria Muhammad Mustafizur; Rahman, Mohammad Mizanur; Molla, Abul Hossain; Mostafizur Rahman, Mohammad; Khabir Uddin, Mohammad
2015-04-01
Degradation of soil and water from discharge of untreated industrial effluent is alarming in Bangladesh. Therefore, buildup of heavy metals in soil from contaminated effluent, their entry into the food chain and effects on rice yield were quantified in a pot experiment. The treatments were comprised of 0, 25%, 50%, 75% and 100% industrial effluents applied as irrigation water. Effluents, initial soil, different parts of rice plants and post-harvest pot soil were analyzed for various elements, including heavy metals. Application of elevated levels of effluent contributed to increased heavy metals in pot soils and rice roots due to translocation effects, which were transferred to rice straw and grain. The results indicated that heavy metal toxicity may develop in soil because of contaminated effluent application. Heavy metals are not biodegradable, rather they accumulate in soils, and transfer of these metals from effluent to soil and plant cells was found to reduce the growth and development of rice plants and thereby contributed to lower yield. Moreover, a higher concentration of effluent caused heavy metal toxicity as well as reduction of growth and yield of rice, and in the long run a more aggravated situation may threaten human lives, which emphasizes the obligatory adoption of effluent treatment before its release to the environment, and regular monitoring by government agencies needs to be ensured. Copyright © 2015. Published by Elsevier B.V.
ENERGY EFFICIENT VAPOR PHASE OXIDATION OF METHANOL USING OZONE AND CATALYTIC REACTOR
The pulp and paper industry releases more than 144 million tons of Volatile Organic Compounds (VOCs) per year. A big portion of this effluent, 66+% is released to air making it the fourth highest contributor of VOC emissions to the atmosphere by industry sector [1]. The current...
Microplastic pollution is widely detected in US municipal wastewater treatment plant effluent.
Mason, Sherri A; Garneau, Danielle; Sutton, Rebecca; Chu, Yvonne; Ehmann, Karyn; Barnes, Jason; Fink, Parker; Papazissimos, Daniel; Rogers, Darrin L
2016-11-01
Municipal wastewater effluent has been proposed as one pathway for microplastics to enter the aquatic environment. Here we present a broad study of municipal wastewater treatment plant effluent as a pathway for microplastic pollution to enter receiving waters. A total of 90 samples were analyzed from 17 different facilities across the United States. Averaging all facilities and sampling dates, 0.05 ± 0.024 microparticles were found per liter of effluent. Though a small value on a per liter basis, even minor municipal wastewater treatment facilities process millions of liters of wastewater each day, yielding daily discharges that ranged from ∼50,000 up to nearly 15 million particles. Averaging across the 17 facilities tested, our results indicate that wastewater treatment facilities are releasing over 4 million microparticles per facility per day. Fibers and fragments were found to be the most common type of particle within the effluent; however, some fibers may be derived from non-plastic sources. Considerable inter- and intra-facility variation in discharge concentrations, as well as the relative proportions of particle types, was observed. Statistical analysis suggested facilities serving larger populations discharged more particles. Results did not suggest tertiary filtration treatments were an effective means of reducing discharge. Assuming that fragments and pellets found in the effluent arise from the 'microbeads' found in many cosmetics and personal care products, it is estimated that between 3 and 23 billion (with an average of 13 billion) of these microplastic particles are being released into US waterways every day via municipal wastewater. This estimate can be used to evaluate the contribution of microbeads to microplastic pollution relative to other sources (e.g., plastic litter and debris) and pathways (e.g., stormwater) of discharge. Published by Elsevier Ltd.
Controlled short residence time coal liquefaction process
Anderson, Raymond P.; Schmalzer, David K.; Wright, Charles H.
1982-05-04
Normally solid dissolved coal product and a distillate liquid product are produced by continuously passing a feed slurry comprising raw feed coal and a recycle solvent oil and/or slurry together with hydrogen to a preheating-reaction zone (26, alone, or 26 together with 42), the hydrogen pressure in the preheating-reaction zone being at least 1500 psig (105 kg/cm.sup.2), reacting the slurry in the preheating-reaction zone (26, or 26 with 42) at a temperature in the range of between about 455.degree. and about 500.degree. C. to dissolve the coal to form normally liquid coal and normally solid dissolved coal. A total slurry residence time is maintained in the reaction zone ranging from a finite value from about 0 to about 0.2 hour, and reaction effluent is continuously and directly contacted with a quenching fluid (40, 68) to substantially immediately reduce the temperature of the reaction effluent to below 425.degree. C. to substantially inhibit polymerization so that the yield of insoluble organic matter comprises less than 9 weight percent of said feed coal on a moisture-free basis. The reaction is performed under conditions of temperature, hydrogen pressure and residence time such that the quantity of distillate liquid boiling within the range C.sub.5 -455.degree. C. is an amount at least equal to that obtainable by performing the process under the same conditions except for a longer total slurry residence time, e.g., 0.3 hour. Solvent boiling range liquid is separated from the reaction effluent and recycled as process solvent.
Pedersen, C O; Masse, L; Hjorth, M
2014-01-01
Solid-liquid separation with flocculation can be used as pre-treatment for reverse osmosis (RO) filtration as it produces a liquid fraction (LF) low in suspended solids (SS). However, residual polymers in the LF may foul the membrane. Membrane fouling during RO filtration of swine wastewater containing polymers was investigated with respect to polymer charge density (CD), effluent SS concentration and membrane surface charge. Effluents with 765 mg/L SS and without SS were spiked with low and medium CD polymers (0-40 mg/L effluent) then processed with RO membranes having low and high negative surface charges. Fouling intensity was evaluated by comparing permeate flux and water flux recovery of fouled and cleaned membranes. For effluents containing SS, the presence of polymer reduced permeate flux by 4-16% and water flux recovery of the fouled membrane by 0-18%, relative to effluents without polymer. The extent of the fouling was higher with the low than the medium CD polymer. The fouling was mostly reversible as cleaning allowed for over 95% flux recovery, but the membrane with high negative surface charge was more susceptible to irreversible fouling. Adding the low CD polymer to feed without SS had no effect on permeate flux or flux recovery. Membrane fouling thus appeared to be caused by the polymer changing SS-membrane interaction. If flocculation is applied to pre-treat manure, a medium CD polymer should be used to optimize SS removal and a membrane with low surface charge should be selected to minimize fouling.
Cingolani, Diego; Eusebi, Anna Laura; Battistoni, Paolo
2017-12-01
The industrial processes require large quantities of water. The presence of discharges results not only in significant environmental impact but implies wastage of water resources. This problem could be solved treating and reusing the produced wastewaters and applying the new zero liquid discharge approach. This paper discusses the design and the performances of reverse osmosis membranes for the upgrading of full scale platform for industrial liquid wastes. The final effluent from the ultrafiltration unit of the full scale plant was monitored to design the reverse osmosis unit. Previous modelling phase was used to evaluate the specific ordinary and maintenance costs and the final effluent quality (2.7 €/m 3 ). The system was designed in triple stages at different operative pressures. The economic feasibility and the payback period of the technology at different percentages of produced permeate were determined. The recovery of 90% was identified as profitable for the reverse osmosis application. One experimental pilot plant applying the reverse osmosis was used to test the final effluent. Moreover, the same flow was treated with second pilot system based on the forward osmosis process. The final efficiencies were compared. Removals higher than 95% using the reverse system were obtained for the main macropollutants and ions. No sustainable applicability of the forward osmosis was determined. Copyright © 2016 Elsevier Ltd. All rights reserved.
Fragrance materials such as synthetic musks in aqueous samples, are normally determined by gas chromatography/mass spectrometry in the selected ion monitoring (SIM) mode to provide maximum sensitivity after liquid-liquid extraction of I -L samples. Full-scan mass spectra are requ...
USDA-ARS?s Scientific Manuscript database
Application of liquid manure to soil is commonly done by injecting the manure beneath the soil surface, to reduce emission of odors and greenhouse gases into the atmosphere and to avoid the spreading of liquid manure on leaves of crop plants. This manure injection is often done using knife-like inj...
Algae Bioreactor Using Submerged Enclosures with Semi-Permeable Membranes
NASA Technical Reports Server (NTRS)
Flynn, Michael T (Inventor); Baertsch, Robert (Inventor); Trent, Jonathan D (Inventor); Liggett, Travis A (Inventor); Gormly, Sherwin J (Inventor); Delzeit, Lance D (Inventor); Buckwalter, Patrick W (Inventor); Embaye, Tsegereda N (Inventor)
2013-01-01
Methods for producing hydrocarbons, including oil, by processing algae and/or other micro-organisms in an aquatic environment. Flexible bags (e.g., plastic) with CO.sub.2/O.sub.2 exchange membranes, suspended at a controllable depth in a first liquid (e.g., seawater), receive a second liquid (e.g., liquid effluent from a "dead zone") containing seeds for algae growth. The algae are cultivated and harvested in the bags, after most of the second liquid is removed by forward osmosis through liquid exchange membranes. The algae are removed and processed, and the bags are cleaned and reused.
Method and apparatus for destroying organic contaminants in aqueous liquids
Donaldson, T.L.; Wilson, J.H.
1993-09-21
A method and apparatus for destroying organic contaminants, such as trichloroethylene, in aqueous liquids, such as groundwater, utilizing steam stripping integrated with biodegradation. The contaminated aqueous liquid is fed into a steam stripper causing the volatilization of essentially all of the organic contaminants and a portion of the aqueous liquid. The majority of the aqueous liquid is discharged from the steam stripper. The volatilized vapors are then condensed to the liquid phase and introduced into a bioreactor. The bioreactor contains methanotrophic microorganisms which convert the organic contaminants into mainly carbon dioxide. The effluent from the bioreactor is then recycled back to the steam stripper for further processing. 2 figures.
Method and apparatus for destroying organic contaminants in aqueous liquids
Donaldson, Terrence L.; Wilson, James H.
1993-01-01
A method and apparatus for destroying organic contaminants, such as trichloroethylene, in aqueous liquids, such as groundwater, utilizing steam stripping integrated with biodegradation. The contaminated aqueous liquid is fed into a steam stripper causing the volatilization of essentially all of the organic contaminants and a portion of the aqueous liquid. The majority of the aqueous liquid is discharged from the steam stripper. The volatilized vapors are then condensed to the liquid phase and introduced into a bioreactor. The bioreactor contains methanotrophic microorganisms which convert the organic contaminants into mainly carbon dioxide. The effluent from the bioreactor is then recycled back to the steam stripper for further processing.
Evaluation of an anaerobic digestion system for processing CELSS crop residues for resource recovery
NASA Astrophysics Data System (ADS)
Strayer, R. F.; Finger, B. W.; Alazraki, M. P.
1997-01-01
Three bioreactors, connected in series, were used to process CELSS potato residues for recovery of resources. The first stage was an anaerobic digestor (8 L working volume; cow rumen contents inoculum; fed-batch; 8 day retention time; feed rate 25 gdw day^-1) that converted 33% of feed (dry weight loss) to CO_2 and ``volatile fatty acids'' (vfa, 83:8:8 mmolar ratio acetic:propionic:butyric). High nitrate-N in the potato residue feed was absent in the anaerobic effluent, with a high portion converted to NH_4^+-N and the remainder unaccounted and probably lost to denitrification and NH_4^+ volatilization. Liquid anaerobic effluent was fed to an aerobic, yeast biomass production vessel (2 L volume; Candida ingens inoculum; batch [pellicle] growth; 2 day retention time) where the VFAs and some NH_4^+-N were converted into yeast biomass. Yeast yields accounted for up to 8% of potato residue fed into the anaerobic bioreactor. The third bioreactor (0.5 L liquid working volume; commercial nitrifier inoculum; packed-bed biofilm; continuous yeast effluent feed; recirculating; constant volume; 2 day hydraulic retention time) was used to convert successfully the remaining NH_4^+-N into nitrate-N (preferred form of N for CELSS crop production) and to remove the remaining degradable soluble organic carbon. Effluents from the last two stages were used for partial replenishment of minerals for hydroponic potato production.
INVESTIGATION OF CE/LIF AS A TOOL IN THE ...
The investigation of emerging contaminant issues is a proactive effort in environmental analysis. As a part of this effort, sewage effluent is of current analytical interest because of the presence of pharmaceuticals and their metabolites and personal care products The environmental impact of these components is still under investigation but their constant perfusion into receiving waters and their potential effect on biota is of concern. This paper examines a tool for the characterization of sewage effluent using capillary electrophoresis/laser-induced fluorescence (CE/LIF) with a frequency-doubled laser operated in the ultraviolet (UV). Fluorescent acidic analytes are targeted because they present special problems for techniques such as gas chromatography/mass spectrometry (GC/MS) but are readily accessible to CE/LIF. As an example of the application of this tool, salicylic acid is determined near the 100 ng/L level in sewage effluent. Salicylic acid is a metabolite of various analgesics Relatively stable in the environment, it is a common contaminant of municipal sewage systems. Salicylic acid was recovered from freshly collected samples of the effluent by liquid-liquid extraction as part of a broad characterization effort. Confirmation of identity was by electron ionization GC/MS after conversion of the salicylic acid to the methyl ester by means of trimethylsilyidiazomethane CE/LIF in the UV has revealed more than 50 individual peaks in the extract and a bac
Evaluation of an Anaerobic Digestion System for Processing CELSS Crop Residues for Resource Recovery
NASA Technical Reports Server (NTRS)
Strayer, R. F.; Finger, B. W.; Alazraki, M. P.
1997-01-01
Three bioreactors, connected in series, were used to process CELSS potato residues for recovery of resources. The first stage was an anaerobic digestor (8 L working volume; cow rumen contents inoculum; fed-batch; 8 day retention time; feed rate 25 gdw/day) that converted 33% of feed (dry weight loss) to CO2 and "volatile fatty acids" (vfa, 83:8:8 mmolar ratio acetic:propionic:butyric). High nitrate-N in the potato residue feed was absent in the anaerobic effluent, with a high portion converted to NH4(+)-N and the remainder unaccounted and probably lost to denitrification and NH4(+) volatilization. Liquid anaerobic effluent was fed to an aerobic, yeast biomass production vessel (2 L volume; Candida ingens inoculum; batch [pellicle] growth; 2 day retention time) where the VFAs and some NH4(+)-N were converted into yeast biomass. Yeast yields accounted for up to 8% of potato residue fed into the anaerobic bioreactor. The third bioreactor (0.5 L liquid working volume; commercial nitrifier inoculum; packed-bed biofilm; continuous yeast effluent feed; recirculating; constant volume; 2 day hydraulic retention time) was used to convert successfully the remaining NH4(+)-N into nitrate-N (preferred form of N for CELSS crop production) and to remove the remaining degradable soluble organic carbon. Effluents from the last two stages were used for partial replenishment of minerals for hydroponic potato production.
40 CFR 417.84 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2010 CFR
2010-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.84 Pretreatment standards for existing sources. Any existing source...
40 CFR 417.84 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2011 CFR
2011-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.84 Pretreatment standards for existing sources. Any existing source...
40 CFR 417.84 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2012 CFR
2012-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.84 Pretreatment standards for existing sources. Any existing source...
40 CFR 417.84 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2014 CFR
2014-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.84 Pretreatment standards for existing sources. Any existing source...
40 CFR 417.84 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2013 CFR
2013-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.84 Pretreatment standards for existing sources. Any existing source...
Lü, F; He, P J; Hao, L P; Shao, L M
2008-01-01
Two trials were established to investigate the effect of recycled effluent on hydrolysis during anaerobic co-digestion of vegetable and flower waste. Trial I evaluated the effect by regulating the flow rate of recycled effluent, while Trial II regulated the ratio of hydrolytic effluent to methanogenic effluent, which were recycled to hydrolysis reactor. Results showed that the recirculation of methanogenic effluent could enhance the buffer capability and operation stability of hydrolysis reactor. Higher recycled flow rate was favourable for microbial anabolism and further promoted hydrolysis. After 9 days of hydrolysis, the cumulative SCOD in the hydrolytic effluent reached 334, 407, 413, 581 mg/g at recycled flow rates of 0.1, 0.5, 1.0, 2.0 m3/(m3 x d), respectively. It was feasible to recycling a mixture of hydrolytic and methanogenic effluent to the hydrolysis reactor. This research showed that partially introducing hydrolytic effluent into the recycled liquid could enhance hydrolysis, while excessive recirculation of hydrolytic effluent will inhibit the hydrolysis. The flow ratio 1:3 of hydrolytic to methanogenic effluent was found to provide the highest hydrolysis efficiency and degradation rate of lignocelluloses-type biomass, among four ratios of 0:1, 1:3, 1:1 and 3:1. Under this regime, after 9 days of hydrolysis, the cumulative TOC and TN in the hydrolytic effluent reached 162 mg/g and 15 mg/g, the removal efficiency of TS, VS, C and cellulose in the solid phase were 60.66%, 62.88%, 58.35% and 49.12%, respectively. The flow ratio affected fermentation pathways, i.e. lower ratio favoured propionic acid fermentation and the generation of lactic acid while higher ratio promoted butyric acid fermentation. IWA Publishing 2008.
Catalytic multi-stage process for hydroconversion and refining hydrocarbon feeds
Comolli, Alfred G.; Lee, Lap-Keung
2001-01-01
A multi-stage catalytic hydrogenation and hydroconversion process for heavy hydrocarbon feed materials such as coal, heavy petroleum fractions, and plastic waste materials. In the process, the feedstock is reacted in a first-stage, back-mixed catalytic reactor with a highly dispersed iron-based catalyst having a powder, gel or liquid form. The reactor effluent is pressure-reduced, vapors and light distillate fractions are removed overhead, and the heavier liquid fraction is fed to a second stage back-mixed catalytic reactor. The first and second stage catalytic reactors are operated at 700-850.degree. F. temperature, 1000-3500 psig hydrogen partial pressure and 20-80 lb./hr per ft.sup.3 reactor space velocity. The vapor and light distillates liquid fractions removed from both the first and second stage reactor effluent streams are combined and passed to an in-line, fixed-bed catalytic hydrotreater for heteroatom removal and for producing high quality naphtha and mid-distillate or a full-range distillate product. The remaining separator bottoms liquid fractions are distilled at successive atmospheric and vacuum pressures, low and intermediate-boiling hydrocarbon liquid products are withdrawn, and heavier distillate fractions are recycled and further upgraded to provide additional low-boiling hydrocarbon liquid products. This catalytic multistage hydrogenation process provides improved flexibility for hydroprocessing the various carbonaceous feedstocks and adjusting to desired product structures and for improved economy of operations.
Zepon Tarpani, Raphael Ricardo; Azapagic, Adisa
2018-06-01
Pharmaceutical and personal care products (PPCPs) are of increasing interest because of their ecotoxicological properties and environmental impacts. Wastewater treatment plants (WWTPs) are the main pathway for their release into freshwaters due to the inefficiency of conventional WWTPs in removing many of these contaminants from effluents. Therefore, different advanced effluent treatment techniques have been proposed for their treatment. However, it is not known at present how effective these treatment methods are and whether on a life cycle basis they cause other environmental impacts which may outweigh the benefits of the treatment. In an effort to provide an insight into this question, this paper considers life cycle environmental impacts of the following advanced treatment techniques aimed at reducing freshwater ecotoxicity potential of PPCPs: granular activated carbon (GAC), nanofiltration (NF), solar photo-Fenton (SPF) and ozonation. The results suggest that on average NF has the lowest impacts for 13 out of 18 categories considered. GAC is the best alternative for five impacts, including metals and water depletion, but it has the highest marine eutrophication. SPF and ozonation are the least sustainable for eight impacts, including ecotoxicity and climate change. GAC and NF are also more efficient in treating heavy metals while avoiding generation of harmful by-products during the treatment, thus being more suitable for potable reuse of wastewater. However, releasing the effluent without advanced treatment to agricultural land achieves a much higher reduction of freshwater ecotoxicity than treating it by any of the advanced treatments and releasing to the environment. Therefore, the use of advanced effluent treatment for agricultural purposes is not recommended. Copyright © 2018 Elsevier Ltd. All rights reserved.
Chu, Binh T T; Petrovich, Morgan L; Chaudhary, Adit; Wright, Dorothy; Murphy, Brian; Wells, George; Poretsky, Rachel
2018-03-01
Wastewater treatment plants (WWTPs) release treated effluent containing mobile genetic elements (MGEs), antibiotic resistance genes (ARGs), and microorganisms into the environment, yet little is known about their influence on nearby microbial communities and the retention of these factors in receiving water bodies. Our research aimed to characterize the genes and organisms from two different WWTPs that discharge into Lake Michigan, as well as from surrounding lake sediments to determine the dispersal and fate of these factors with respect to distance from the effluent outfall. Shotgun metagenomics coupled to distance-decay analyses showed a higher abundance of genes identical to those in WWTP effluent genes in sediments closer to outfall sites than in sediments farther away, indicating their possible WWTP origin. We also found genes attributed to organisms, such as those belonging to Helicobacteraceae , Legionellaceae , Moraxellaceae , and Neisseriaceae , in effluent from both WWTPs and decreasing in abundance in lake sediments with increased distance from WWTPs. Moreover, our results showed that the WWTPs likely influence the ARG composition in lake sediments close to the effluent discharge. Many of these ARGs were located on MGEs in both the effluent and sediment samples, indicating a relatively broad propensity for horizontal gene transfer (HGT). Our approach allowed us to specifically link genes to organisms and their genetic context, providing insight into WWTP impacts on natural microbial communities. Overall, our results suggest a substantial influence of wastewater effluent on gene content and microbial community structure in the sediments of receiving water bodies. IMPORTANCE Wastewater treatment plants (WWTPs) release their effluent into aquatic environments. Although treated, effluent retains many genes and microorganisms that have the potential to influence the receiving water in ways that are poorly understood. Here, we tracked the genetic footprint, including genes specific to antibiotic resistance and mobile genetic elements and their associated organisms, from WWTPs to lake sediments. Our work is novel in that we used metagenomic data sets to comprehensively evaluate total gene content and the genetic and taxonomic context of specific genes in environmental samples putatively impacted by WWTP inputs. Based on two different WWTPs with different treatment processes, our findings point to an influence of WWTPs on the presence, abundance, and composition of these factors in the environment. Copyright © 2018 Chu et al.
Chu, Binh T. T.; Petrovich, Morgan L.; Chaudhary, Adit; Wright, Dorothy; Murphy, Brian; Wells, George
2017-01-01
ABSTRACT Wastewater treatment plants (WWTPs) release treated effluent containing mobile genetic elements (MGEs), antibiotic resistance genes (ARGs), and microorganisms into the environment, yet little is known about their influence on nearby microbial communities and the retention of these factors in receiving water bodies. Our research aimed to characterize the genes and organisms from two different WWTPs that discharge into Lake Michigan, as well as from surrounding lake sediments to determine the dispersal and fate of these factors with respect to distance from the effluent outfall. Shotgun metagenomics coupled to distance-decay analyses showed a higher abundance of genes identical to those in WWTP effluent genes in sediments closer to outfall sites than in sediments farther away, indicating their possible WWTP origin. We also found genes attributed to organisms, such as those belonging to Helicobacteraceae, Legionellaceae, Moraxellaceae, and Neisseriaceae, in effluent from both WWTPs and decreasing in abundance in lake sediments with increased distance from WWTPs. Moreover, our results showed that the WWTPs likely influence the ARG composition in lake sediments close to the effluent discharge. Many of these ARGs were located on MGEs in both the effluent and sediment samples, indicating a relatively broad propensity for horizontal gene transfer (HGT). Our approach allowed us to specifically link genes to organisms and their genetic context, providing insight into WWTP impacts on natural microbial communities. Overall, our results suggest a substantial influence of wastewater effluent on gene content and microbial community structure in the sediments of receiving water bodies. IMPORTANCE Wastewater treatment plants (WWTPs) release their effluent into aquatic environments. Although treated, effluent retains many genes and microorganisms that have the potential to influence the receiving water in ways that are poorly understood. Here, we tracked the genetic footprint, including genes specific to antibiotic resistance and mobile genetic elements and their associated organisms, from WWTPs to lake sediments. Our work is novel in that we used metagenomic data sets to comprehensively evaluate total gene content and the genetic and taxonomic context of specific genes in environmental samples putatively impacted by WWTP inputs. Based on two different WWTPs with different treatment processes, our findings point to an influence of WWTPs on the presence, abundance, and composition of these factors in the environment. PMID:29269503
Klamerth, N; Rizzo, L; Malato, S; Maldonado, Manuel I; Agüera, A; Fernández-Alba, A R
2010-01-01
The degradation of 15 emerging contaminants (ECs) at low concentrations in simulated and real effluent of municipal wastewater treatment plant with photo-Fenton at unchanged pH and Fe=5 mg L(-1) in a pilot-scale solar CPC reactor was studied. The degradation of those 15 compounds (Acetaminophen, Antipyrine, Atrazine, Caffeine, Carbamazepine, Diclofenac, Flumequine, Hydroxybiphenyl, Ibuprofen, Isoproturon, Ketorolac, Ofloxacin, Progesterone, Sulfamethoxazole and Triclosan), each with an initial concentration of 100 microg L(-1), was found to depend on the presence of CO(3)(2-) and HCO(3)(-) (hydroxyl radicals scavengers) and on the type of water (simulated water, simulated effluent wastewater and real effluent wastewater), but is relatively independent of pH, the type of acid used for release of hydroxyl radicals scavengers and the initial H(2)O(2) concentration used. Toxicity tests with Vibrio fisheri showed that degradation of the compounds in real effluent wastewater led to toxicity increase. (c) 2009 Elsevier Ltd. All rights reserved.
Fragrance materials, such as synthetic musks in aqueous samples, are normally analyzed by GC/MS in the selected ion monitoring (SIM) mode to provide maximum sensitivity after liquid-liquid extraction of 1-L samples. A 1-L sample, however, usually provides too little ana...
Fragrance materials, such as synthetic musks in aqueous samples, are normally analyzed by GC/MS in the selected ion monitoring (SIM) mode to provide maximum sensitivity after liquid-liquid extraction of I -L samples. A I -L sample, however, usually provides too little ana...
The purpose of the research presented in this paper is two-fold: (1) to demonstrate the 4 coupling of two state-of-the-art techniques: a time-weighted polar organic integrative sampler (POCIS) and micro-liquid chromatography-electrospray/ion trap mass spectrometry (u-LC-6 ES/ITMS...
Sewage effluent was analyzed for 3,5,6-trichloropyridinol (TCP) by extracting one liter of water using liquid-liquid extraction and determined by GC/MS operated in the negative ion chemical ionization (electron capture) mode, TCP is the major metabolite of the commonly used insec...
Fragrance materials such as synthetic musks in aqueous samples, are normally determined by gas chromatography/mass spectrometry in the selected ion monitoring (SIM) mode to provide maximum sensitivity after liquid-liquid extraction of I -L samples. Full-scan mass spectra are requ...
40 CFR 417.85 - Standards of performance for new sources.
Code of Federal Regulations, 2014 CFR
2014-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.85 Standards of performance for new sources. The following standards of...
40 CFR 417.85 - Standards of performance for new sources.
Code of Federal Regulations, 2013 CFR
2013-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.85 Standards of performance for new sources. The following standards of...
40 CFR 417.85 - Standards of performance for new sources.
Code of Federal Regulations, 2010 CFR
2010-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.85 Standards of performance for new sources. The following standards of...
40 CFR 417.85 - Standards of performance for new sources.
Code of Federal Regulations, 2012 CFR
2012-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.85 Standards of performance for new sources. The following standards of...
40 CFR 417.85 - Standards of performance for new sources.
Code of Federal Regulations, 2011 CFR
2011-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.85 Standards of performance for new sources. The following standards of...
Ziarrusta, Haizea; Val, Nahia; Dominguez, Haizea; Mijangos, Leire; Prieto, Ailette; Usobiaga, Aresatz; Etxebarria, Nestor; Zuloaga, Olatz; Olivares, Maitane
2017-11-01
This work describes the optimization, validation, and application in real samples of accurate and precise analytical methods to determine ten fluoroquinolones (FQs) (norfloxacin, enoxacin, pefloxacin, ofloxacin, levofloxacin, ciprofloxacin, danofloxacin, lomefloxacin, enrofloxacin, and sparfloxacin) in different environmental matrices, such as water (estuarine, seawater, and wastewater treatment plant effluent), fish tissues (muscle and liver), and fish biofluids (plasma and bile). The analysis step performed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) was fully optimized to improve the separation and detection steps. The extraction of analytes from fish tissues was accomplished using focused ultrasound solid-liquid extraction using methanol/acetic acid (95:5 v/v) as extractant. The preconcentration and clean-up steps were optimized in terms of extraction efficiency and cleanliness and the best strategy for each matrix was selected: (i) Oasis HLB for seawater and muscle, (ii) liquid-liquid extraction combined with Oasis HLB for the lipid-rich liver, (iii) the combination of Evolute-WAX and Oasis HLB for estuarine water and wastewater treatment plant effluent, and (iv) molecular imprinted polymers for biofluids. The methods afforded satisfactory apparent recoveries (80-126%) and repeatability (RSD < 15%), except for sparfloxacin, which showed a lack of correction with the available isotopically labeled surrogates ([ 2 H 8 ]-ciprofloxacin and [ 2 H 5 ]-enrofloxacin). Ciprofloxacin, norfloxacin, and ofloxacin were detected in both water and fish liver samples from the Biscay Coast at concentrations up to 278 ng/L and 4 ng/g, respectively. To the best of our knowledge, this work is one of the few analyzing up to ten FQs and in so many fish tissues and biofluids. Graphical abstract Determination of fluoroquinolones in different environmental matrices, such as water (estuarine, seawater, and wastewater treatment plant effluent), fish tissues (muscle and liver), and fish biofluids (plasma and bile).
Data analysis and interpretation related to space system/environment interactions at LEO altitude
NASA Technical Reports Server (NTRS)
Raitt, W. John; Schunk, Robert W.
1991-01-01
Several studies made on the interaction of active systems with the LEO space environment experienced from orbital or suborbital platforms are covered. The issue of high voltage space interaction is covered by theoretical modeling studies of the interaction of charged solar cell arrays with the ionospheric plasma. The theoretical studies were complemented by experimental measurements made in a vacuum chamber. The other active system studied was the emission of effluent from a space platform. In one study the emission of plasma into the LEO environment was studied by using initially a 2-D model, and then extending this model to 3-D to correctly take account of plasma motion parallel to the geomagnetic field. The other effluent studies related to the releases of neutral gas from an orbiting platform. One model which was extended and used determined the density, velocity, and energy of both an effluent gas and the ambient upper atmospheric gases over a large volume around the platform. This model was adapted to study both ambient and contaminant distributions around smaller objects in the orbital frame of reference with scale sizes of 1 m. The other effluent studies related to the interaction of the released neutral gas with the ambient ionospheric plasma. An electrostatic model was used to help understand anomalously high plasma densities measured at times in the vicinity of the space shuttle orbiter.
Cardoso-Mohedano, J G; Páez-Osuna, F; Amezcua-Martínez, F; Ruiz-Fernández, A C; Ramírez-Reséndiz, G; Sanchez-Cabeza, J A
2016-03-15
Nutrient pollution causes environmental damages on aquatic ecosystems worldwide. Eutrophication produces impacts in coastal ecosystems, affecting biota and ecosystem services. The Urias coastal lagoon (SE Gulf of California) is a sub-tropical estuary under several environmental pressures such as nutrient inputs from shrimp farm effluents and dredging related to port operations, which can release substances accumulated in sediments. We assessed the water quality impacts caused by these activities and results showed that i) nitrogen was the limiting nutrient, ii) shrimp farm effluents increased particulate organic matter and chlorophyll a in the receiving stations, and iii) dredging activities increased nitrite and reduced dissolved oxygen concentrations. The co-occurrence of the shrimp farm releases and dredging activities was likely the cause of a negative synergistic effect on water quality which mainly decreases dissolved oxygen and increases nitrite concentrations. Coastal zone management should avoid the co-occurrence of these, and likely others, stressors in coastal ecosystems. Copyright © 2016 Elsevier Ltd. All rights reserved.
Santana-Viera, Sergio; Guedes-Alonso, Rayco; Sosa-Ferrera, Zoraida; Santana-Rodríguez, José Juan; Kabir, Abuzar; Furton, Kenneth G
2017-12-22
Every year, hundreds of tons of organic pollutants reach the environment through effluents released from wastewater treatment plants worldwide, and many of these compounds have harmful effects on the aquatic ecosystem. A new class of emerging pollutants of high concern is cytostatic drugs, which are designed to treat different types of cancers by attacking cells. Environmental concentrations of cytostatic drugs are known to be in the range of ngL -1 , and for this reason, it is imperative to develop analytical methods of extraction and preconcentration to allow for subsequent instrumental analysis of these drugs. In this work, a rapid, simple and green method for the analysis of seven cytostatic drug compounds that are commonly used in anti-cancer therapies was developed using a novel extraction process based on a powerful miniaturized technique, fabric phase sorptive extraction (FPSE) coupled to ultra-high performance liquid chromatography tandem mass spectrometry (UHPLC-MS/MS). The major parameters that affect the extraction process were optimized. The new method shows good linearity, with a relative standard deviation (RSD) of less than 12%. Relative recoveries higher than 40% were obtained for the studied compounds, and the detection limit of the method was within the values at which these compounds are usually found in environmental water (0.20ngL -1 to 80ngL -1 ). The Limit of Quantification ranged from 0.68 to 267ngL -1 . Significant suppression of the signal due to the matrix effect, a common shortcoming attributed to interference from the extraction process as well as the use of ionization mode, was not observed. Subsequently, the method was applied to real wastewater samples from an effluent obtained from a hospital area and three wastewater treatment plants located in Gran Canaria Island, Spain. Copyright © 2017 Elsevier B.V. All rights reserved.
Tetracycline resistance in semi-arid agricultural soils under long-term swine effluent application.
Popova, Inna E; Josue, Rosemarie D R; Deng, Shiping; Hattey, Jeffory A
2017-05-04
Annually, millions pounds of antibiotics are released unmetabolized into environment along with animal wastes. Accumulation of antibiotics in soils could potentially induce the persistence of antibiotic resistant bacteria. Antibiotics such as tetracyclines and tetracycline-resistant bacteria have been previously detected in fields fertilized with animal manure. However, little is known about the accumulation of tetracyclines and the development of tetracycline resistance in semi-arid soils. Here we demonstrate that continuous land application with swine effluent, containing trace amounts of chlortetracycline, does not necessarily induce tetracycline resistance in soil bacteria. Based on the testing of more than 3,000 bacteria isolated from the amended soils, we found no significant increase in the occurrence and level of chlortetracycline resistant bacteria in soils after 15 years of continuous swine effluent fertilization. To account for a possible transfer of tetracycline-resistant bacteria originated from the swine effluent to soils, we analyzed two commonly found tetracycline resistant genes, tet(O) and tet(M), in the swine effluent and fertilized soils. Both genes were present in the swine effluent, however, they were not detectable in soils applied with swine effluent. Our data demonstrate that agronomic application of manure from antibiotic treated swine effluent does not necessarily result in the development of antibiotic bacterial resistance in soils. Apparently, concentrations of chlortetracycline present in manure are not significant enough to induce the development of antibiotic bacterial resistance.
DOE Office of Scientific and Technical Information (OSTI.GOV)
NONE
1996-09-11
The Department of Energy (DOE) proposes to eliminate industrial effluent from 27 outfalls at Los Alamos National Laboratory (LANL). The Proposed Action includes both simple and extensive plumbing modifications, which would result in the elimination of industrial effluent being released to the environment through 27 outfalls. The industrial effluent currently going to about half of the 27 outfalls under consideration would be rerouted to LANL`s sanitary sewer system. Industrial effluent from other outfalls would be eliminated by replacing once-through cooling water systems with recirculation systems, or, in a few instances, operational changes would result in no generation of industrial effluent.more » After the industrial effluents have been discontinued, the affected outfalls would be removed from the NPDES Permit. The pipes from the source building or structure to the discharge point for the outfalls may be plugged, or excavated and removed. Other outfalls would remain intact and would continue to discharge stormwater. The No Action alternative, which would maintain the status quo for LANL`s outfalls, was also analyzed. An alternative in which industrial effluent would be treated at the source facilities was considered but dismissed from further analysis because it would not reasonably meet the DOE`s purpose for action, and its potential environmental effects were bounded by the analysis of the Proposed Action and the No Action alternatives.« less
Baig, Jameel Ahmed; Kazi, Tasneem Gul; Elci, Latif; Afridi, Hassan Imran; Khan, Muhammad Irfan; Naseer, Hafiz Muhammad
2013-01-01
Simple and robust analytical procedures were developed for hexavalent chromium (Cr(VI)) and lead (Pb(II)) by dispersive liquid-liquid microextraction (DLLME) using microsample injection system coupled with flame atomic absorption spectrophotometry (MIS-FAAS). For the current study, ammonium pyrrolidine dithiocarbamate (APDC), carbon tetrachloride, and ethanol were used as chelating agent, extraction solvent, and disperser solvent, respectively. The effective variables of developed method have been optimized and studied in detail. The limit of detection of Cr(VI) and Pb(II) were 0.037 and 0.054 µg/L, respectively. The enrichment factors in both cases were 400 with 40 mL of initial volumes. The relative standard deviations (RSDs, n = 6) were <4%. The applicability and the accuracy of DLLME were estimated by the analysis of Cr(VI) and Pb(II) in industrial effluent wastewater by standard addition method (recoveries >96%). The proposed method was successfully applied to the determination of Cr(VI) and Pb(II) at ultratrace levels in natural drinking water and industrial effluents wastewater of Denizli. Moreover, the proposed method was compared with the literature reported method. PMID:24163779
NASA Astrophysics Data System (ADS)
Ramsburg, C. A.; Muller, K.; Gill, J.
2012-12-01
Many current approaches to managing groundwater contamination rely on further advances in amendment delivery in order to initiate and sustain contaminant degradation or immobilization. In fact, limited or ineffective delivery is often cited when treatment objectives are not attained. Emulsions, specifically oil-in-water emulsions, have demonstrated potential to aid delivery of remediation amendments. Emulsions also afford opportunities to control the release of active ingredients encapsulated within the droplets. Our research is currently focused on the controlled release of nanoparticle-based buffering agents using oil-in-water emulsions. This interest is motivated by the fact that chemical and biological processes employed for the remediation and stewardship of contaminated sites often necessitate control of pH during treatment and, in some cases, long thereafter. Alkalinity-release nanoparticles (e.g., CaCO3, MgO) were suspended within soybean oil and subsequently encapsulated by through the creation of oil-in-water emulsions. These oil-in-water emulsions are designed to have physical properties which are favorable for subsurface delivery (nominal properties: 1 g/mL density; 10 cP viscosity; and 1.5 μm droplet diameter). Buffer capacity titrations suggest that MgO particles are moderately more accessible within the oil phase and nearly twice as effective (on a per mass basis) at releasing alkalinity (as compared to the CaCO3 particles). Results from experiments designed to assess the release kinetics suggest that a linear driving force model is capable of describing the release process and mass transfer coefficients are constant through the reactive life of the emulsion. The release kinetics in emulsions containing MgO particles were found to be three orders of magnitude faster than those quantified for emulsions containing CaCO3. The slower release kinetics of the emulsions containing CaCO3 particles may prove beneficial when considering pH control at sites where acid fluxes are lower. The ability of emulsions to sustain alkalinity release within porous media was preliminarily examined using a series of 1-D column experiments. Emulsions were introduced for 2 pore volumes in a medium sand at Darcy velocities of approximately 0.8 cm/hr. Following the emulsion pulse, a pH 4 solution (adjusted with HCl) was introduced into the column and the effluent was monitored for pH, oil content, and droplet size distributions. All un-retained emulsion (~20% wt. was retained) was flushed from the column within approximately 2 pore volumes of terminating the emulsion pulse. The effluent pH at quasi-steady state and the reactive life of the emulsion depended on the retention characteristics, as well as the type and loading of nanoparticles employed within the emulsion. For the scenarios considered here, quasi-steady effluent pHs were observed to be between 6.5 and 10, and reactive lifetimes (i.e., the number of pore volumes for which the retained emulsion resulted in the effluent pH exceeding that of the influent) were between 15 and 100 pore volumes. These results demonstrate the ability of the emulsion to offer longer-term release and highlight the ability to tune the alkalinity release rate to match site characteristics by adjusting the emulsion content. Current research is directed toward evaluation release properties in heterogeneous aquifer cell experiments.
DNAPL Dissolution in Bedrock Fractures And Fracture Networks
2011-06-01
were filtered through a 0.2 micron filter and then analyzed via ion chromatography ( Dionex DX-120, Sunnyvale, CA). An additional set of sorption...analyzed via ion chromatography ( Dionex DX-120, Sunnyvale, CA). The effluent pH was monitored periodically with pH test strips. Aqueous DHC...liquid EDTA ethylenediaminetetraacetic acid GC gas chromatograph HPLC high-performance liquid chromatography ISCO in situ chemical oxidation
Heidler, Jochen; Halden, Rolf U
2009-12-01
This study examined the occurrence in wastewater of 11 aromatic biocides, pesticides and degradates, and their fate during passage through US treatment plants, as well as the chemical mass contained in sewage sludge (biosolids) destined for land application. Analyte concentrations in wastewater influent, effluent and sludge from 25 facilities in 18 US states were determined by liquid chromatography electrospray (tandem) mass spectrometry. Dichlorocarbanilide, fipronil, triclocarban, and triclosan were found consistently in all sample types. Dichlorophene, hexachlorophene, and tetrachlorocarbanilide were detected infrequently only, and concentrations of the phenyl urea pesticides diflubenzuron, hexaflumuron, and linuron were below the limit of detection in all matrixes. Median concentrations (+/-95% confidence interval) of quantifiable compounds in influent ranged from 4.2 +/- 0.8 microg L(-1) for triclocarban to 0.03 +/- 0.01 microg L(-1) for fipronil. Median concentrations in effluent were highest for triclocarban and triclosan (0.23 +/- 0.08 and 0.07 +/- 0.04 microg L(-1), respectively). Median aqueous-phase removal efficiencies (+/-95% CI) of activated sludge treatment plants decreased in the order of: triclosan (96 +/- 2%) > triclocarban (87 +/- 7%) > dichlorocarbanilide (55 +/- 20%) > fipronil (18 +/- 22%). Median concentrations of organohalogens were typically higher in anaerobically than in aerobically digested sludges, and peaked at 27 600 +/- 9600 and 15 800 +/- 8200 microg kg(-1) for triclocarban and triclosan, respectively. Mass balances obtained for three primary pesticides in six activated sludge treatment plants employing anaerobic digestion suggested a decreasing overall persistence from fipronil (97 +/- 70%) to triclocarban (87 +/- 29%) to triclosan (28 +/- 30%). Nationwide release of the investigated organohalogens to agricultural land via municipal sludge recycling and into surface waters is estimated to total 258 000 +/- 110 00 kg year(-1) (mean +/- 95% confidence interval), with most of this mass derived from antimicrobial consumer products of daily use. This study addresses some of the data gaps identified by the National Research Council in its 2002 study on standards and practices of biosolids application on land.
Effect of wet oxidation on the fingerprints of polymeric substances from an activated sludge.
Urrea, José Luis; Collado, Sergio; Oulego, Paula; Díaz, Mario
2016-11-15
Thermal pre-treatments of activated sludge involve the release of a high amount of polymeric substances into the bulk medium. The molecular size of these polymers will largely define the subsequent biological treatment of the liquid effluent generated. In this work, the effects of wet oxidation treatment (WO) on the fingerprints of the polymeric substances which compose the activated sludge, were analysed. For a better understanding of these transformations, the sludge was separated into its main fractions: soluble microbial products (SMP), loosely bound extracellular polymeric substances (LB-EPS), tightly bound extracellular polymeric substances (TB-EPS) and naked cells, and then each one was subjected to WO separately (190 °C and 65 bar), determining the fingerprints evolution by size exclusion technique. Results revealed a fast degradation of larger molecules (over 500 kDa) during the first minutes of treatment (40 min). WO also increases the absorptive properties of proteins (especially for 30 kDa), which is possibly due to the hydroxylation of phenylalanine amino acids in their structure. WO of naked cells involved the formation of molecules between 23 and 190 kDa, which are related to the release of cytoplasmic polymers, and more hydrophobic polymers, probably from the cell membrane. The results allowed to establish a relationship between the location of polymeric material and its facility to become oxidised; thus, the more internal the polymeric material in the cell, the easier its oxidation. When working directly with the raw sludge, hydrolysis mechanisms played a key role during the starting period. Once a high degree of solubilisation was reached, the molecules were rapidly oxidised into other compounds with refractory characteristics. The final effluent after WO showed almost 90% of low molecular weight solubilised substances (0-35 kDa). Copyright © 2016 Elsevier Ltd. All rights reserved.
Salian, Rupa; Wani, Suhas; Reddy, Ramamohan; Patil, Mukund
2018-03-01
Brewing industry releases large quantities of wastewater after product generation. Brewery wastewater contains organic compounds which are biodegradable in nature. These biodegradable wastes can be recycled and reused and hence considered as suitable products for agriculture. But before using wastewater for agriculture, it is better to evaluate the phytotoxic effects of wastewater on crops. Hence, the main objective of this study is to evaluate the effects of brewery effluent on seed germination and growth parameters of selected crop species like chickpea (Cicer arietinum), maize (Zea mays), and pigeon pea (Cajanus cajan). Study comprised seven types of water treatments-tap water as control, diluted UASBR effluent (50% effluent + 50% distilled water): UASBR50, undiluted UASBR effluent: UASBR100, diluted TC effluent (50% effluent + 50% distilled water): ETP50,TC effluent without dilution: ETP100, 10% diluted reverse osmosis (RO10) reject (10% RO reject + 90% distilled water), and 25% diluted reverse osmosis(RO25) reject (25% RO reject + 75% distilled water) with three replications in completely randomized design. Germination test was performed in petri plates for 5 days. Parameters like germination percentage, germination rate index, seedling length, phytotoxicity index, seed vigor index, and biomass were calculated. All parameters decreased with increase in respective effluent concentration. Among all treatments, RO25 showed highest inhibitory effect on all three crops. Even though undiluted effluent of UASBR and ETP effluent showed positive effect on germination, seedling growth of three crops was promoted to the maximum by UASBR50 and ETP50. Hence, from the study, it was concluded that dilution of brewery effluent can be recommended before using it for irrigational purpose.
ETF Facility evaporator skid orifice sizing design analysis
DOE Office of Scientific and Technical Information (OSTI.GOV)
ELLINGSON, S.D.
1999-08-31
This document releases and records the design analysis for sizing the Orifice plate being installed on the Effluent Treatment Facility (ETF) evaporator skid per Engineering Change Notice (ECN) 651583.
Liquid chromatographic method for determining the concentration of bisazir in water
Scholefield, Ronald J.; Slaght, Karen S.; Allen, John L.
1997-01-01
Barrier dams, traps, and lampricides are the techniques currently used by the Great Lakes Fishery Commission to control sea lampreys (Petromyzon marinus) in the Great Lakes. To augment these control techniques, a sterile-male-release research program was initiated at the Lake Huron Biological Station. Male sea lampreys were sterilized by intraperitoneal injection of the chemical sterilant P,P-bis(1-aziridinyl)-N-methylphosphinothioic amide (bisazir). An analytical method was needed to quantitate the concentration of bisazir in water and to routinely verify that bisazir (>25 μg/L) does not persist in the treated effluent discharged from the sterilization facility to Lake Huron. A rapid, accurate, and sensitive liquid chromatographic (LC) method was developed for determining bisazir in water. Bisazir was dissolved in Lake Huron water; extracted and concentrated on a C18 solid-phase extraction column; eluted with methanol; and quantitated by reversed-phase LC using a C18 column, a mobile phase of 70% water and 30% methanol (v/v), and UV detection (205 nm). Bisazir retention time was 7-8 min; total run time was about 20 min. Method detection limit for bisazir dissolved in Lake Huron water was about 15 μg/L. Recovery from Lake Huron water fortified with bisazir at 100 μg/L was 94% (95% confidence interval, 90.2-98.2%).
Impact of chlorination on silver elution from ceramic water filters.
Lyon-Marion, Bonnie A; Mittelman, Anjuliee M; Rayner, Justine; Lantagne, Daniele S; Pennell, Kurt D
2018-06-05
Applying silver nanoparticles (nAg) or silver nitrate (AgNO 3 ) to ceramic water filters improves microbiological efficacy, reduces biofilm formation, and protects stored water from recontamination. A challenge in ceramic filter production is adding sufficient silver to achieve these goals without exceeding the maximum recommended silver concentration in drinking water. Silver release is affected by silver type, application method, and influent water chemistry. Despite a lack of data, there is an assumption that chlorinated water should not be used as influent water because it may increase silver elution. Thus, the objective of this work was to systematically evaluate the impact of chlorinated water (0-4 mg/L free chlorine residual, FCR) on silver release from ceramic filter disks painted with casein-coated nAg, painted with AgNO 3 , or containing fired-in nAg over a range of ionic strength (IS = 0-10 mM as NaNO 3 ) in the presence or absence of natural organic matter (NOM). Influent deionized water containing chlorine increased silver release 2-5-fold compared to controls. However, this effect of chlorine was mitigated at higher IS (≥1 mM) or in the presence of NOM (3 mg C/L). For filter disks painted with nAg or AgNO 3 , silver release increased with increasing IS (with or without chlorine), and effluent concentrations remained above the World Health Organization (WHO) guideline of 0.1 mg/L even after 30 h (80 pore volumes, PVs) of flow with a background solution of 10 mM NaNO 3 . Silver speciation (nAg vs. Ag + ) was monitored in effluent samples from painted or fired-in nAg filter disks. Results indicated that in general, greater than 90% of the eluted silver was due to Ag + dissolution rather than nAg release. Additionally, a filter disk prepared with fired-in nAg exhibited a lower % released in the nanoparticle form (nAg = 5% of total Ag in effluent) compared to painted on nAg (nAg = 14% of total Ag in effluent). The findings of this study suggest that chlorinated influent water has minimal impact on silver elution from ceramic filters under simulated natural water conditions, and thus, the recommendation to avoid the use of chlorinated water with ceramic filters is not necessary under most conditions. Copyright © 2018 Elsevier Ltd. All rights reserved.
Detoxification of kraft pulp ECF bleaching effluents by catalytic hydrotreatment.
Calvo, L; Gilarranz, M A; Casas, J A; Mohedano, A F; Rodríguez, J J
2007-02-01
Two different effluents from the D(1) and E(1) stages of the ECF bleaching of Eucalyptus globulus kraft pulp were treated by catalytic hydrogenation in a trickle bed reactor using commercial and homemade Pd/AC catalysts. The reactor was fed with the bleaching effluent and a H(2)/N(2) gas stream. The variables studied were space-time (1.4-5g(cat)min/mL), gas to liquid flow ratio (286-1000vol.), gas feed concentration (H(2):N(2), 1:1-1:7.3vol.), temperature (25-100 degrees C) and pressure (1-11bar). Hydrotreatment performance was evaluated in terms of ecotoxicity, adsorbable organic halogen (AOX), chemical oxygen demand (COD), biological oxygen demand (BOD(5)) and colour removal. In all the runs, the ecotoxicity of the effluents decreased as a result of the treatment, achieving reductions that ranged from 70% to 98%. Simultaneously to the reduction of toxicity, the hydrotreatment led to a decrease of the colour of the effluents, being the decrease significantly higher in the case of E(1) effluent. The AOX content was reduced by 85% and 23% for E(1) and D(1) effluents, respectively. In the case of D(1) effluent the removal of ecotoxicity was significantly higher than that of AOX, which indicates that much of the toxicity of the effluent must be associated to non-chlorinated organics. In spite of the important reduction of ecotoxicity, the biodegradability of the effluents only increased slightly. The homemade catalysts, prepared from activated carbons with a high external or non-microporous surface area and mesopore volume and a convenient surface chemistry showed a higher efficiency than the commercial one.
Environmental surveillance at Los Alamos during 1994
DOE Office of Scientific and Technical Information (OSTI.GOV)
NONE
1996-07-01
This report describes environmental monitoring activities at Los Alamos National Laboratory for 1994. Data were collected to assess external penetrating radiation, airborne emissions, liquid effluents, radioactivity of environmental materials and food stuffs, and environmental compliance.
Jiang, Ying-He; Liu, Pei-Ju; Wang, Lei; Tian, Zhong-Kai; Liu, Xiao-Ying
2014-04-01
By building the mass balance of nitrogen in A2/O process, the nitrogen model which raised some strategies on how to control sludge return ratio and mixed liquid return ratio to make the effluent nitrogen achieve the national standard A under different influent total nitrogen (TN) , was set up. And the presumed parameters were verified by the pilot test of the Wuhan's Longwangzui WWTP. The result showed that when the temperature and the TN were over 15 degrees C and below 30 mg x L(-1) respectively, the mixed liquid return ratio was 0. When the temperature was between 10 degrees C and 15 degrees C and TN was over 30 mg x L(-1), higher MLSS and DO elevated N removal. When the temperature was far below 10 degrees C, the mixed liquid return ratio was also at a higher level. Based on the Wuhan's Longwangzui WWTP influent water quality, measures of adjusting the return ratio were well adapted to obtain acceptable nitrogen effluent.
Circulating platelet aggregates damage endothelial cells in culture.
Aluganti Narasimhulu, Chandrakala; Nandave, Mukesh; Bonilla, Diana; Singaravelu, Janani; Sai-Sudhakar, Chittoor B; Parthasarathy, Sampath
2017-06-01
Presence of circulating endothelial cells (CECs) in systemic circulation may be an indicator of endothelial damage and/or denudation, and the body's response to repair and revascularization. Thus, we hypothesized that aggregated platelets (AgPlts) can disrupt/denude the endothelium and contribute to the presence of CEC and EC-derived particles (ECDP). Endothelial cells were grown in glass tubes and tagged with/without 0.5 μm fluorescent beads. These glass tubes were connected to a mini-pump variable-flow system to study the effect of circulating AgPlts on the endothelium. ECs in glass tube were exposed to medium alone, nonaggregated platelets (NAgPlts), AgPlts, and 90 micron polystyrene beads at a flow rate of 20 mL/min for various intervals. Collected effluents were cultured for 72 h to analyze the growth potential of dislodged but intact ECs. Endothelial damage was assessed by real time polymerase chain reaction (RT-PCR) for inflammatory genes and Western blot analysis for von Willebrand factor. No ECs and ECDP were observed in effluents collected after injecting medium alone and NAgPlts, whereas AgPlts and Polybeads drastically dislodged ECs, releasing ECs and ECDP in effluents as the time increased. Effluents collected when endothelial cell damage was seen showed increased presence of von Willebrand factor as compared to control effluents. Furthermore, we analyzed the presence of ECs and ECDPs in heart failure subjects, as well as animal plasma samples. Our study demonstrates that circulating AgPlts denude the endothelium and release ECs and ECDP. Direct mechanical disruption and shear stress caused by circulating AgPlts could be the underlying mechanism of the observed endothelium damage. Copyright © 2017 Elsevier Inc. All rights reserved.
Polishing of anaerobic secondary effluent by Chlorella vulgaris under low light intensity.
Cheng, Tuoyuan; Wei, Chun-Hai; Leiknes, TorOve
2017-10-01
To investigate anaerobic secondary effluent polishing by microalgae (Chlorella vulgaris) under low light intensity (14μmol/m 2 /s), bubbling column reactors were operated in batches of 8 d with initial ammonium nitrogen 10-50mg/L, initial phosphate phosphorus 2-10mg/L and microalgal seed 40mg/L. Maximum microalgal biomass and minimum generation time were 370.9mg/L and 2.5d, respectively. Nitrogen removal (maximum 99.6%) was mainly attributed to microalgal growth rate, while phosphorus removal (maximum 49.8%) was related to microalgal growth rate, cell phosphorus content (maximum 1.5%) and initial nutrients ratio. Dissolved microalgal organics release in terms of chemical oxygen demand (maximum 63.2mg/L) and hexane extractable material (i.e., oil and grease, maximum 8.5mg/L) was firstly reported and mainly affected by nitrogen deficiency and deteriorated effluent quality. Ultrafiltration critical flux (16.6-39.5L/m 2 /h) showed negative linear correlation to microalgal biomass. Anaerobic membrane bioreactor effluent polishing showed similar results with slight inhibition to synthetic effluent. Copyright © 2017 Elsevier Ltd. All rights reserved.
Dual liquid and gas chromatograph system
Gay, D.D.
A chromatographic system is described that utilizes one detection system for gas chromatographic and micro-liquid chromatographic determinations. The detection system is a direct-current, atmospheric-pressure, helium plasma emission spectrometer. The detector utilizes a nontransparent plasma source unit which contains the plasma region and two side-arms which receive effluents from the micro-liquid chromatograph and the gas chromatograph. The dual nature of this chromatographic system offers: (1) extreme flexibility in the samples to be examined; (2) extreme low sensitivity; (3) element selectivity; (4) long-term stability; (5) direct correlation of data from the liquid and gas samples; (6) simpler operation than with individual liquid and gas chromatographs, each with different detection systems; and (7) cheaper than a commercial liquid chromatograph and a gas chromatograph.
Dual liquid and gas chromatograph system
Gay, Don D.
1985-01-01
A chromatographic system that utilizes one detection system for gas chromatographic and micro-liquid chromatographic determinations. The detection system is a direct-current, atmospheric-pressure, helium plasma emission spectrometer. The detector utilizes a non-transparent plasma source unit which contains the plasma region and two side-arms which receive effluents from the micro-liquid chromatograph and the gas chromatograph. The dual nature of this chromatographic system offers: (1) extreme flexibility in the samples to be examined; (2) extremely low sensitivity; (3) element selectivity; (4) long-term stability; (5) direct correlation of data from the liquid and gas samples; (6) simpler operation than with individual liquid and gas chromatographs, each with different detection systems; and (7) cheaper than a commercial liquid chromatograph and a gas chromatograph.
Oak Ridge Reservation annual site environmental report for 1995
DOE Office of Scientific and Technical Information (OSTI.GOV)
Koncinski, W.S.
1996-09-01
This report presents the details of the environmental monitoring and management program for the Oak Ridge Reservation. Topics discussed include: site background, climate, and operations; environmental compliance strategies; effluent monitoring; environmental management program including environmental restoration, decontamination and decommissioning, technology development, and public involvement; effluent monitoring of airborne discharges, liquid discharges, toxicity control and monitoring, biological monitoring and abatement; environmental surveillance which encompasses meteorological monitoring, ambient air monitoring, surface water monitoring, soils monitoring, sediment monitoring, and contamination of food stuffs monitoring; radiation doses; chemical exposures; ground water monitoring; and quality assurance.
Cestonaro do Amaral, André; Kunz, Airton; Radis Steinmetz, Ricardo Luis; Scussiato, Lucas Antunes; Tápparo, Deisi Cristina; Gaspareto, Taís Carla
2016-03-01
As the fourth largest swine producer and exporter, Brazil has increased its participation in the global swine production market. Generally, these units concentrate a large number of animals and generate effluents that must be correctly managed to prevent environmental impacts, being anaerobic digestion is an interesting alternative for treating these effluents. The low-volatile solid concentration in the manure suggests the need for solid-liquid separation as a tool to improve the biogas generation capacity. This study aimed to determine the influence of simplified and inexpensive solid-liquid separation strategies (screening and settling) and the different manures produced during each swine production phase (gestating and farrowing sow houses, nursery houses and finishing houses) on biogas and methane yield. We collected samples in two gestating sow houses (GSH-a and GSH-b), two farrowing sow houses (FSH-a and FSH-b), a nursery house (NH) and a finishing house (FH). Biochemical methane potential (BMP) tests were performed according to international standard procedures. The settled sludge fraction comprised 20-30% of the raw manure volume, which comprises 40-60% of the total methane yield. The methane potential of the settled sludge fraction was approximately two times higher than the methane potential of the supernatant fraction. The biogas yield differed among the raw manures from different swine production phases (GSH-a 326.4 and GSH-b 577.1; FSH-a 860.1 and FSH-b 479.2; NH -970.2; FH 474.5 NmLbiogas.gVS(-1)). The differences were relative to the production phase (feed type and feeding techniques) and the management of the effluent inside the facilities (water management). Brazilian swine production has increased his participation in the global market, been the fourth producer and the fourth exporter. The segregation of swine production in multiple sites has increased its importance, due to the possibilities to have more specialized units. Generally, these units concentrate a large number of animals and generate effluents that must be correctly managed to avoid environmental impact. Due to the biodegradability of manure, anaerobic digestion is an interesting alternative to treat these effluents. The low volatile solid concentration in the swine manure suggests the need for solid-liquid separation as a tool to improve biogas generation capacity. The present study aimed to determine the influence of simplified and cheap solid-liquid separation strategies (based on screening and settling) and different manure of each swine production phases (gestating and farrowing sows houses, nursery houses and finishing houses) on biogas and methane yield. We collected samples in two gestating sows house (GSH-a and GSH-b), two farrowing sows house (FSH-a and FSH-b), a nursery house (NH) and a finishing house (FH). The Biochemical Methane Production (BMP) tests were performed according to international standard procedure (VDI 4630). The settled sludge fraction responds for 20-30% of raw manure volume, producing 40-60% of the total methane yield. The methane potential of settled sludge fraction was about 2 times higher than the supernatant fraction. There are differences on biogas yield between the raw manure of different swine production phases (GSH-a 326.4 and GSH-b 577.1; FSH-a 860.1 and FSH-b 479.2; NH 970.2; FH 474.5 NmLbiogas.gVS(-1)). The differences are relative to production phase (feed type, feeding techniques, etc.), but also the management of the effluent inside the facilities (water management). Copyright © 2015 Elsevier Ltd. All rights reserved.
2015-01-01
Attenuation of the pesticide fipronil and its major degradates was determined during conventional wastewater treatment and wetland treatment. Analysis of flow-weighted composite samples by liquid and gas chromatography–tandem mass spectrometry showed fipronil occurrence at 12–31 ng/L in raw sewage, primary effluent, secondary effluent, chlorinated effluent, and wetland effluent. Mean daily loads of total fipronil related compounds in raw sewage and in plant effluent after chlorination were statistically indistinguishable (p = 0.29; n = 10), whereas fipronil itself was partially removed (25 ± 3%; p = 0.00025; n = 10); the associated loss in toxicity was balanced by the formation of toxic fipronil degradates, showing conventional treatment to be unfit for reducing overall toxicity. In contrast to these findings at the municipal wastewater treatment, both parental fipronil and the sum of fipronil-related compounds were removed in the wetland with efficiencies of 44 ± 4% and 47 ± 13%, respectively. Total fipronil concentrations in plant effluent (28 ± 6 ng/L as fipronil) were within an order of magnitude of half-maximal effective concentrations (EC50) of nontarget invertebrates. This is the first systematic assessment of the fate of fipronil and its major degradates during full-scale conventional wastewater and constructed wetland treatment. PMID:26710933
Moreira-Neto, S L; Mussatto, S I; Machado, K M G; Milagres, A M F
2013-04-01
The discharge of highly coloured synthetic dye effluents into rivers and lakes is harmful to the water bodies, and therefore, intensive researches have been focussed on the decolorization of wastewater by biological, physical or chemical treatments. In the present study, 12 basidiomycetes strains from the genus Pleurotus, Trametes, Lentinus, Peniophora, Pycnoporus, Rigidoporus, Hygrocybe and Psilocybe were evaluated for decolorization of the reactive dyes Cibacron Brilliant Blue H-GR and Cibacron Red FN-2BL, both in solid and liquid media. Among the evaluated fungi, seven showed great ability to decolorize the synthetic textile effluent, both in vivo (74-77%) or in vitro (60-74%), and laccase was the main ligninolytic enzyme involved on dyes decolorization. Pleurotus ostreatus, Trametes villosa and Peniophora cinerea reduced near to 60% of the effluent colour after only 1 h of treatment. The decolorization results were still improved by establishing the nitrogen source and amount to be used during the fungal strains cultivation in synthetic medium previous their action on the textile effluent, with yeast extract being a better nitrogen source than ammonium tartarate. These results contribute for the development of an effective microbiological process for decolorization of dye effluents with reduced time of treatment. © 2013 The Society for Applied Microbiology.
Heavy metal contamination from geothermal sources.
Sabadell, J E; Axtmann, R C
1975-01-01
Liquid-dominated hydrothermal reservoirs, which contain saline fluids at high temperatures and pressures, have a significant potential for contamination of the environment by heavy metals. The design of the power conversion cycle in a liquid-dominated geothermal plant is a key factor in determining the impact of the installation. Reinjection of the fluid into the reservoir minimizes heavy metal effluents but is routinely practiced at few installations. Binary power cycles with reinjection would provide even cleaner systems but are not yet ready for commercial application. Vapor-dominated systems, which contain superheated steam, have less potential for contamination but are relatively uncommon. Field data on heavy metal effluents from geothermal plants are sparse and confounded by contributions from "natural" sources such as geysers and hot springs which often exist nearby. Insofar as geothermal power supplies are destined to multiply, much work is required on their environmental effects including those caused by heavy metals. PMID:1227849
Heavy metal contamination from geothermal sources.
Sabadell, J E; Axtmann, R C
1975-12-01
Liquid-dominated hydrothermal reservoirs, which contain saline fluids at high temperatures and pressures, have a significant potential for contamination of the environment by heavy metals. The design of the power conversion cycle in a liquid-dominated geothermal plant is a key factor in determining the impact of the installation. Reinjection of the fluid into the reservoir minimizes heavy metal effluents but is routinely practiced at few installations. Binary power cycles with reinjection would provide even cleaner systems but are not yet ready for commercial application. Vapor-dominated systems, which contain superheated steam, have less potential for contamination but are relatively uncommon. Field data on heavy metal effluents from geothermal plants are sparse and confounded by contributions from "natural" sources such as geysers and hot springs which often exist nearby. Insofar as geothermal power supplies are destined to multiply, much work is required on their environmental effects including those caused by heavy metals.
Siqueira, Ionara Rodrigues; Vanzella, Cláudia; Bianchetti, Paula; Rodrigues, Marco Antonio Siqueira; Stülp, Simone
2011-01-01
The leather industry is a major producer of wastewaters and releases large quantities of many different chemical agents used in hide processing into the environment. Since the central nervous system is sensitive to many different contaminants, our aim was to investigate the neurobehavioral effects of exposure of mice to tannery effluents using animal models of depression and anxiety, namely forced swim and elevated plus-maze. In order to propose a clean technology for the treatment of this effluent, we also investigated the exposure of mice to effluents treated by photoelectrooxidation process (PEO). Adult male Swiss albino mice (CF1 strain) were given free access to water bottles containing an effluent treated by a tannery (non-PEO) or PEO-treated tannery wastewater (0.1 and 1% in drinking water). Exposure to tannery wastewater induced behavioural changes in the mice in elevated plus-maze. Exposure to non-PEO 1% decreased the percentage of time spent in the open arms, indicating anxiety-like behaviour. Exposure to tannery wastewater did not alter immobility time in the forced swim test, suggesting that tannery effluents did not induce depression-like behaviour in the mice. These behavioural data suggest that non-PEO tannery effluent has an anxiogenic effect, whereas PEO-treated tannery effluents do not alter anxiety levels. Copyright © 2011 Elsevier Inc. All rights reserved.
Occurrence of neutral and acidic drugs in the effluents of Canadian sewage treatment plants.
Metcalfe, Chris D; Koenig, Brenda G; Bennie, Don T; Servos, Mark; Ternes, Thomas A; Hirsch, Roman
2003-12-01
Samples of influent (untreated) and effluent (treated) from 18 sewage treatment plants (STPs) in 14 municipalities in Canada were analyzed for residues of selected prescription and nonprescription drugs. Several neutral and acidic drugs were detected in effluents, including analgesic/anti-inflammatory agents, lipid regulators, and an antiepileptic drug, carbamazepine. Residues were extracted from effluents by solid-phase extraction, followed by either methylation and analysis of acidic drugs by gas chromatography/mass spectrometry or direct analysis of neutral drugs by liquid chromatography/tandem mass spectrometry. Analgesic/anti-inflammatory drugs such as ibuprofen and naproxen, as well as the metabolite of acetylsalicyclic acid, salicylic acid, were often detected in final effluents at microg/L concentrations. The acidic lipid regulator, clofibric acid, and the analgesic/anti-inflammatory drug diclofenac were not detected in any final effluent samples, which is not consistent with data from Europe. The precursor to clofibric acid, clofibrate, is not widely prescribed as a lipid regulator in Canada. However, the lipid regulators bezafibrate and gemfibrozil were detected in some samples of influent and effluent. The chemotherapy drugs ifosfamide and cyclophosphamide and the anti-inflammatory phenazone were not detected in influent or effluent samples, but the vasodilator drug pentoxyfylline was detected at ng/L concentrations in some final effluents. The widespread occurrence of carbamazepine at concentrations as high as 2.3 microg/L may be explained by use of this drug for other therapeutic purposes besides treatment of epilepsy and its resistance to elimination in STPs. The rates of elimination of ibuprofen and naproxen appeared to be elevated in STPs with hydraulic retention times for sewage greater than 12 h.
40 CFR 417.81 - Specialized definitions.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 30 2012-07-01 2012-07-01 false Specialized definitions. 417.81 Section 417.81 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
Rajkumar, A Samuel; Nagan, S
2010-10-01
In Tiruppur, 729 textile dyeing units are under operation and these units generate 96.1 MLD of wastewater. The untreated effluent was discharged into the Noyyal River till 1997. After the issuance of directions by Tamil Nadu Pollution Control Board (TNPCB) in 1997, these units have installed 8 common effluent treatment plants (CETP) consisting of physical, chemical and biological treatment units. Some of the units have installed individual ETP (IETP). The treated effluent was finally discharged into the river. The dyeing units use sodium chloride in the dyeing process for efficient fixing of dye in the fabric efficiently. This contributes high total dissolved solids (TDS) and chlorides in the effluent. CETPs and IETPs failed to meet discharge standards of TDS and chlorides and thereby significantly affected the river water quality. TDS level in the river water was in the range of 900 - 6600 mg/L, and chloride was in the range of 230 - 2700 mg/L. Orathupalayam dam is located across Noyyal river at 32 km down stream of Tiruppur. The pollutants carried by the river were accumulated in the dam. TDS in the dam water was in the range of 4250 - 7900 mg/L and chloride was in the range of 1600 - 2700 mg/L. The dam sediments contain heavy metals of chromium, copper, zinc and lead. In 2006, the High Court has directed the dyeing units to install zero liquid discharge (ZLD) plant and to stop discharging of effluent into the river. Accordingly, the industries have installed and commissioned the ZLD plant consisting of RO plant and reject management system in 2010. The effluent after secondary treatment from the CETP is further treated in RO plant. The RO permeate is reused by the member units. The RO reject is concentrated in multiple effect evaporator (MEE)/ mechanical vacuum re-compressor (MVR). The concentrate is crystallized and centrifuged to recover salt. The salt recovered is reused. The liquid separated from the centrifuge is sent to solar evaporation pan. The salt collected in the solar pan is bagged and stored in secure land fill facility. Thus, the discharge into the river is now stopped. However, the damage caused to the groundwater and soil contamination in the river basin is yet to be restored.
Rajamanickam, R; Nagan, S
2010-10-01
Karur is an industrial town located on the bank of river Amaravathi. There are 487 textile processing units in operation and discharge about 14610 kilo litres per day of treated effluent into the river. The groundwater quality in the downstream is deteriorated due to continuous discharge of effluent. In order to assess the present quality of groundwater, 13 open wells were identified in the river basin around Karur and samples were collected during pre-monsoon, post monsoon and summer, and analyzed for physico-chemical parameters. TDS, total alkalinity, total hardness, calcium, chlorides and sulphates exceeded the desirable limit. Amaravathi River water samples were also colleted at the upstream and downstream of Karur and the result shows the river is polluted. During summer season, there is no flow in the river and the river acts as a drainage for the effluent. Hence, there is severe impact on the groundwater quality in the downstream. The best option to protect the groundwater quality in the river basin is that the textile processing units should adopt zero liquid discharge (ZLD) system and completely recycle the treated effluent.
Dou, Weixiao; Zhou, Zhen; Ye, Jiongjiong; Huang, Rongwei; Jiang, Lu-Man; Chen, Guofeng; Fei, Xiaoyun
2017-09-01
Flue gas desulfurization (FGD) wastewater treatment by conventional neutralization, chemical precipitation and coagulation process removes most suspended solids and heavy metals, and provides an effluent rich in calcium, alkalinity and chloride, which obstructs its reclamation and reuse but is in favor of phosphorus (P) precipitation. The goals of this study were to investigate feasibility of reusing FGD effluent as a calcium source for P removal from P-rich wastewater. Results revealed that increasing the volumetric ratio between FGD effluent and P-rich wastewater achieved higher pH value and Ca/P ratio, and thus enhanced P removal efficiency to 94.3% at the ratio of 40%. X-ray diffraction and scanning electron microscope analysis of harvested precipitates showed that increasing pH from 8 to 10 induced the conversion of hydroxyapatite to tri-calcium phosphate, and then to whitlockite. This study demonstrated that for reusing FGD effluent for P removal was highly feasible, both technically and economically. This process not only saves the cost of precipitants for P removal, but also provides an economical alternative for current zero liquid discharge technology for FGD wastewater, which requires high energy consumption and capital costs.
Performance of Hybrid Photocatalytic-Ceramic Membrane System for the Treatment of Secondary Effluent
Song, Lili; Zhu, Bo; Gray, Stephen; Duke, Mikel; Muthukumaran, Shobha
2017-01-01
Evaluation of an advanced wastewater treatment system that combines photocatalysis with ceramic membrane filtration for the treatment of secondary effluent was undertaken. The results showed that, after photocatalysis and ceramic membrane filtration, the removal of dissolved organic carbon and UV254 was 60% and 54%, respectively, at a concentration of 4 g/L of TiO2. Dissolved organic matter (DOM) present in the secondary effluent was characterised with a liquid chromatography-organic carbon detector (LC-OCD) technique. The results showed low removal of humics, building blocks, the other oxidation by-products and no removal of biopolymers after TiO2/UV photocatalytic treatment. This suggested that the radical non-selective oxidation mechanisms of TiO2/UV process resulted in secondary effluent in which all of the DOM fractions were present. However, the hybrid system was effective for removing biopolymers with the exception of low molecular weight (LMW) compounds acids, which accumulated from the beginning of the reaction. In addition, monitoring of the DOM fractions with LC-OCD analysis demonstrated that the reduction of the effluent aromaticity was not firmly correlated with the removal of humic substances for the combined processes. PMID:28350320
Song, Lili; Zhu, Bo; Gray, Stephen; Duke, Mikel; Muthukumaran, Shobha
2017-03-28
Evaluation of an advanced wastewater treatment system that combines photocatalysis with ceramic membrane filtration for the treatment of secondary effluent was undertaken. The results showed that, after photocatalysis and ceramic membrane filtration, the removal of dissolved organic carbon and UV 254 was 60% and 54%, respectively, at a concentration of 4 g/L of TiO₂. Dissolved organic matter (DOM) present in the secondary effluent was characterised with a liquid chromatography-organic carbon detector (LC-OCD) technique. The results showed low removal of humics, building blocks, the other oxidation by-products and no removal of biopolymers after TiO₂/UV photocatalytic treatment. This suggested that the radical non-selective oxidation mechanisms of TiO₂/UV process resulted in secondary effluent in which all of the DOM fractions were present. However, the hybrid system was effective for removing biopolymers with the exception of low molecular weight (LMW) compounds acids, which accumulated from the beginning of the reaction. In addition, monitoring of the DOM fractions with LC-OCD analysis demonstrated that the reduction of the effluent aromaticity was not firmly correlated with the removal of humic substances for the combined processes.
Mineral composition and rates of flow of effluent from the distal ileum of liquid-fed calves
Smith, R. H.
1966-01-01
1. Liquid-fed calves (aged 1½-4 months) examined more than five weeks after inserting a re-entrant fistula into the distal ileum, of normal sodium and potassium status and without abnormal gut infection, showed mean emergence rates from the ileum for sodium, potassium and water of 2·3 m-mole/hr, 0·38 m-mole/hr and 21 g/hr respectively after 16 hr fasting. 2. Sodium and potassium emergence rates changed little when the residues from a milk or glucose-solution feed arrived at the distal ileum. When magnesium chloride was added to a glucose-solution feed an increase sometimes occurred but only in association with decreased small-intestine transit time. 3. Widely differing sodium and potassium intakes had no appreciable direct effect on their emergence rates. Continued feeding of a diet deficient in either ion, however, altered the calf's metabolism and led to appropriate changes in the sodium/potassium ratio of ileal effluent. These changes were not simulated by injecting adrenal cortex hormones. The ratio also decreased when ileal effluent was allowed to discharge for several weeks without being returned to the colon. It was abnormally high in samples obtained less than five weeks after inserting cannulae. 4. An increase in sodium and potassium emergence rates, which often occurred spontaneously at about 3 months of age, appeared to be due to infection and was usually prevented by giving aureomycin orally. 5. Water emergence rate reflected changes in the emergence rates of osmotically effective constituents and isotonicity was maintained. In effluent after fasting, the cations involved were mainly sodium and potassium, and [Na] + [K] was approximately constant (mean 132 m-mole/l.). In effluent following feeds of milk or glucose, magnesium chloride solution, [Na] + [K] was depressed and [Na] + [K] + 1·5 [Mg] was approximately constant (mean 139 m-mole/l.). Magnesium behaved as it were mainly ionic. Calcium had no apparent osmotic effect and was probably insoluble. 6. Bicarbonate was the major anion in ileal effluent after a milk feed with smaller amounts of chloride, phosphate and some other unknown anion(s). PMID:5919555
NASA Astrophysics Data System (ADS)
Velpula, Priyadarshini; Ghuge, Santosh; Saroha, Anil K.
2018-04-01
Ozonation is a chemical treatment process in which ozone reacts with the pollutants present in the effluent by infusion of ozone into the effluent. This study includes the effect of various parameters such as inlet ozone dose, pH of solution and initial concentration of dye on decolorization of dye in terms CRE. The maximum CRE of 98.62% with the reaction rate constant of 0.26 min-1 is achieved in 18 minutes of reaction time at inlet ozone dose of 11.5 g/m3, solution pH of 11 and 30 mg/L of initial concentration of dye. The presence of radical scavenger (Tertiary Butyl Alcohol) suppressed the CRE from 98.62% to 95.4% at high pH values indicates that the indirect mechanism dominates due to the presence of hydroxyl radicals which are formed by the decomposition of ozone. The diffusive and convective mass transfer coefficients of ozone are calculated as 1.78 × 10-5 cm2/sec and 0.075 min-1. It is observed that the fraction of resistance offered by liquid is very much high compared to gas phase indicates that the ozonation is a liquid phase mass transfer controlled operation.
dos Santos, Luciana Urbano; Alves, Delma Pegolo; Guaraldo, Ana Maria Aparecida; Cantusio Neto, Romeu; Durigan, Mauricio; Franco, Regina Maura Bueno
2013-01-01
Giardia duodenalis is a protozoan of public health interest that causes gastroenteritis in humans and other animals. In the city of Campinas in southeast Brazil, giardiasis is endemic, and this pathogen is detected at high concentrations in wastewater effluents, which are potential reservoirs for transmission. The Samambaia wastewater treatment plant (WWTP) in the city of Campinas employs an activated sludge system for sewage treatment and ultraviolet (UV) light for disinfection of effluents. To evaluate this disinfection process with respect to inactivating G. duodenalis cysts, two sample types were investigated: (i) effluent without UV disinfection (EFL) and (ii) effluent with UV disinfection (EFL+UV). Nude immunodeficient BALB/c mice were intragastrically inoculated with a mean dose of 14 cysts of G. duodenalis recovered from effluent from this WWTP, EFL, or EFL+UV. All animals inoculated with G. duodenalis cysts developed the infection, but animals inoculated with UV-exposed cysts released a lower average concentration of cysts in their faeces than animals inoculated with cysts that were not UV disinfected. Trophozoites were also observed in both groups of animals. These findings suggest that G. duodenalis cysts exposed to UV light were damaged but were still able to cause infection. PMID:27335858
Release of volatile and semi-volatile toxicants during house fires.
Hewitt, Fiona; Christou, Antonis; Dickens, Kathryn; Walker, Richard; Stec, Anna A
2017-04-01
Qualitative results are presented from analysis of volatile and semi-volatile organic compounds (VOCs/SVOCs) obtained through sampling of gaseous effluent and condensed particulates during a series of experimental house fires conducted in a real house. Particular emphasis is given to the 16 polycyclic aromatic hydrocarbons (PAHs) listed by the Environmental Protection Agency due to their potentially carcinogenic effects. The initial fuel packages were either cooking oil or a single sofa; these were burned both alone, and in furnished surroundings. Experiments were performed at different ventilation conditions. Qualitative Gas Chromatography-Mass Spectrometry (GC-MS) analysis found VOC/SVOC releases in the developing stages of the fires, and benzo(a)pyrene - the most carcinogenic PAH - was found in at least one sampling interval in the majority of fires. A number of phosphorus fire retardants were detected, in both the gaseous effluent and particulates, from fires where the initial fuel source was a sofa. Their release during the fire is significant as they pose toxicological concerns separate from those presented by the PAHs. Copyright © 2016. Published by Elsevier Ltd.
1990-05-30
phase HPLC using an IBM Instruments Inc. model LC 9533 ternary liquid chromatograph attached to a model F9522 fixed UV module and a model F9523...acid analyses are done by separation and quantitation of phenylthiocarbamyl amino acid derivatives using a second IBM model LC 9533 ternary liquid...computer which controls the HPLC and an IBM Instruments Inc. model LC 9505 automatic sampler. The hemoglobin present in the effluent from large
NASA Astrophysics Data System (ADS)
Colson, David Michael
This research was conducted to evaluate the potential for growth of Monoraphidium sp. Dek19 using side streams from an ethanol plant for culture medium. Additionally, the potential of using enzymes to break down the cell wall material to release fermentable sugars and oil was examined. The ethanol streams selected were methanator influent, methanator effluent, and thin stillage. This species of microalgae has been previously studied and found to have the ability to grow in and remediate the effluent water from the DeKalb Sanitary District (DSD). The Monoraphidium sp. Dek19 was grown in various concentrations of the ethanol plant side streams concurrently with algae cultures grown in the DSD effluent. The algae cultures were grown in 250ml flasks to determine the optimal concentrations of the ethanol streams. The concentrations with the growth rate and cell counts closest to or higher than the DSD effluents were selected for further examination. These concentrations were repeated to evaluate the most optimal growth conditions using the ethanol streams in comparison to the DSD effluent grown algae. The selected growth condition for the ethanol streams was determined to be using the methanator effluent as the base water component with the thin stillage added to a 2% concentration. The 2% concentration showed an average increase in cell count to be 8.49% higher than the control cell count. The methanator influent was discarded as a base water component, as the growth of the algae was 40.18% less than that of the control. Other concentrations considered resulted in a decrease in cell. count ranging from 9.20-48.97%. The three closest growth results of the concentration of thin stillage and methanator effluent (1%, 2%, and 4%) were scaled up to 2L flasks to confirm the results on a larger scale. The results showed a greater reduction in the cell count of the 1% and 4% concentrations, 23.52% and 16.31% reduction in cell count respectively. The 2% concentration showed a similar increase in cell count as before at 12.59% increase in cell count over the control. The 2% concentration algae growth cultures were grown exclusively alongside of the control group of DSD effluent grown algae. The solutions were grown to carrying capacity and the algae biomass was extracted from the solution by centrifugation and air drying in a dehydrator. This was repeated until enough biomass was collected to conduct rehydration and a typical anaerobic fermentation process. The resuspended algae were pH adjusted to a pH of 5.2 ±0.2. The algae were treated with a combination of cellulase and alpha-amylase, and put through a liquefaction process at 80°C for 3 hours. The resulting solutions were analyzed using High Performance Liquid Chromatography (HPLC) to evaluate the sugar profile of each treatment. The liquefaction solutions were treated with further enzymes, nutrients, and yeast and ran through an anaerobic fermentation process. The fermentations were allowed to progress for 72 hours, and were again analyzed using an HPLC for ethanol and sugar profile. The fermentation results showed a potential of up to 0.587%w/v ethanol production in a 10% solids microalgae slurry. The remaining fermentation products were analyzed using a petroleum ether lipid extraction unit. This analysis showed that the DSD effluent microalgae had an average of 15.53% lipid content on a dry matter basis, and the methanator effluent with 2% thin stillage added resulted in 28.02% lipid content on a dry matter basis. The fermentation products were also treated with a demulsifier, spun down with a centrifuge, and examination of a released lipid layer was conducted. This analysis showed that there was a thin layer of oil on almost all treatments of the algae solutions when spun down in a centrifuge. These. results indicate that the cellulosic enzymes broke down the cell wall material sufficiently for the quick extraction of the oil without the use of hexane. The entirety of the resulting analysis showed that Monoraphidium sp. Dek19 is a viable option for growth using the side streams from an ethanol plant and the use of enzymes will breakdown the biomass of the algae for production of cellulosic ethanol. Additionally, the extraction of oil can be performed in a quicker and safer manner.
Controlled release liquid dosage formulation
Benton, Ben F.; Gardner, David L.
1989-01-01
A liquid dual coated dosage formulation sustained release pharmaceutic having substantial shelf life prior to ingestion is disclosed. A dual coating is applied over controlled release cores to form dosage forms and the coatings comprise fats melting at less than approximately 101.degree. F. overcoated with cellulose acetate phthalate or zein. The dual coated dosage forms are dispersed in a sugar based acidic liquid carrier such as high fructose corn syrup and display a shelf life of up to approximately at least 45 days while still retaining their release profiles following ingestion. Cellulose acetate phthalate coated dosage form cores can in addition be dispersed in aqueous liquids of pH <5.
Kheriji, Jamel; Tabassi, Dorra; Hamrouni, Béchir
2015-01-01
Industrial effluents loaded with cadmium have contributed to the pollution of the environment and health troubles for humans. Therefore, these effluents need treatment to reduce cadmium concentration before releasing them to public sewage. The purpose of the research is to study the major role of reverse osmosis (RO) and nanofiltration (NF) processes, which can contribute to the removal of cadmium ions from model water and wastewater from the battery industry. For this reason, two RO and two nanofiltration membranes have been used. The effects of feed pressure, concentration, ionic strength, nature of anion associated with cadmium and pH on the retention of Cd(II) were studied with model solutions. Thereafter, NF and RO membranes were used to reduce cadmium ions and total salinity of battery industry effluent. Among these membranes, there are only three which eliminate more than 95% of cadmium. This was found to depend on operating conditions. It is worth noting that the Spiegler-Kedem model was applied to fit the experimental results.
Wu, Sarah Xiao; Chen, Lide; Zhu, Jun; Walquist, McKenzie; Christian, David
2018-04-30
Insufficient denitrification in biological treatment is often a result of the lack of a carbon source. In this study, use of the volatile fatty acids (VFAs) generated via pre-digestion as a carbon source to improve denitrification in sequencing batch reactor (SBR) treatment of liquid swine manure was investigated. The pre-digestion of swine manure was realized by storing the manure in a sealed container in room temperature and samples were taken periodically from the container to determine the VFA levels. The results showed that after 14 days of pre-digestion, the VFA level in the digested liquid was increased by 200%. A polynomial relationship for the VFA level in the digested manure with the digestion time was observed with a correlation coefficient being 0.9748. Two identical SBRs were built and operated on 8-h cycles in parallel, with one fed with pre-digested and the other raw swine manure. There were five phases included in each cycle, i.e., anaerobic (90 min), anoxic (150 min), anoxic/anaerobic (90 min), anoxic/aerobic (120 min), and settle/decant (30 min), and the feeding was split to 600 mL/200 mL and performed at the beginning of and 240 min into the cycle. The SBR fed on pre-digested swine manure achieved successful denitrification with only 0.35 mg/L nitrate left in the effluent, compared to 15.9 mg/L found in the effluent of the other SBR. Nitrite was not detected in the effluent from both SBRs. The results also indicated that there was no negative impact of feeding SBRs with the pre-digested liquid swine manure for treatment on the removal of other constituents such as total solids (TS), volatile solids (VS), suspended solids (SS), volatile suspended solids (VSS), and soluble chemical oxygen demand (COD). Therefore, anaerobic digestion as a pretreatment can be an effective way to condition liquid swine manure for SBR treatment to achieve sufficient nitrate removal.
Tong, Juan; Chen, Yinguang
2009-07-01
In previous publications we reported that by controlling the pH at 10.0 the accumulation of short-chain fatty acids (SCFA) during waste activated sludge (WAS) fermentation was remarkably improved [Yuan, H., Chen, Y., Zhang, H., Jiang, S., Zhou, Q., Gu, G., 2006. Improved bioproduction of short-chain fatty acids (SCFAs) from excess sludge under alkaline conditions. Environ. Sci. Technol. 40, 2025-2029], but significant ammonium nitrogen (NH(4)-N) and soluble ortho-phosphorus (SOP) were released [Chen, Y., Jiang, S., Yuan, H., Zhou, Q., Gu, G., 2007. Hydrolysis and acidification of waste activated sludge at different pHs. Water Res. 41, 683-689]. This paper investigated the simultaneous recovery of NH(4)-N and SOP from WAS alkaline fermentation liquid and the application of the fermentation liquid as an additional carbon source for municipal wastewater biological nitrogen and phosphorus removal. The central composite design (CCD) of the response surface methodology (RSM) was employed to optimize and model the simultaneous NH(4)-N and SOP recovery from WAS alkaline fermentation liquid. Under the optimum conditions, the predicted and experimental recovery efficiency was respectively 73.4 and 75.7% with NH(4)-N, and 82.0 and 83.2% with SOP, which suggested that the developed models described the experiments well. After NH(4)-N and SOP recovery, the alkaline fermentation liquid was added to municipal wastewater, and the influence of volume ratio of fermentation liquid to municipal wastewater (FL/MW) on biological nitrogen and phosphorus removal was investigated. The addition of fermentation liquid didn't significantly affect nitrification. Both SOP and total nitrogen (TN) removal were increased with fermentation liquid, but there was no significant increase at FL/MW greater than 1/35. Compared to the blank test, the removal efficiency of SOP and TN at FL/MW=1/35 was improved from 44.0 to 92.9%, and 63.3 to 83.2%, respectively. The enhancement of phosphorus and nitrogen removal was mainly attributed to the increase of influent SCFA, or rather, the increase of intracellular polyhydroxyalkanoates (PHA) which served as the carbon and energy sources for denitrification and phosphorus uptake. The addition of alkaline fermentation liquid to municipal wastewater, however, increased the effluent COD, which was caused mainly by the increase of influent humic acid, not protein or carbohydrate.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true [Reserved] 409.33 Section 409.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.33 [Reserved] ...
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 409.33 Section 409.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.33 [Reserved] ...
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 417.164 Section 417.164 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417...
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 30 2012-07-01 2012-07-01 false [Reserved] 409.33 Section 409.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.33 [Reserved] ...
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 30 2013-07-01 2012-07-01 true [Reserved] 409.33 Section 409.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.33 [Reserved] ...
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 29 2014-07-01 2012-07-01 true [Reserved] 409.33 Section 409.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409.33 [Reserved] ...
40 CFR 417.81 - Specialized definitions.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 29 2014-07-01 2012-07-01 true Specialized definitions. 417.81 Section 417.81 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory...
40 CFR 417.81 - Specialized definitions.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true Specialized definitions. 417.81 Section 417.81 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory...
40 CFR 417.81 - Specialized definitions.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 30 2013-07-01 2012-07-01 true Specialized definitions. 417.81 Section 417.81 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory...
40 CFR 417.81 - Specialized definitions.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Specialized definitions. 417.81 Section 417.81 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory...
COAL CONVERSION CONTROL TECHNOLOGY. VOLUME I. ENVIRONMENTAL REGULATIONS; LIQUID EFFLUENTS
This volume is the product of an information-gathering effort relating to coal conversion process streams. Available and developing control technology has been evaluated in view of the requirements of present and proposed federal, state, regional, and international environmental ...
NASA Astrophysics Data System (ADS)
Lee, Karen; Lacombe, Y.; Cheluget, E.
2008-07-01
The Advanced SCLAIRTECH™ Technology process is used to manufacture Linear Low Density Polyethylene using solution polymerization. In this process ethylene is polymerized in an inert solvent, which is subsequently evaporated and recycled. The reactor effluent in the process is a polymer solution containing the polyethylene product, which is separated from the solvent and unconverted ethylene/co-monomer before being extruded and pelletized. The design of unit operations in this process requires a detailed understanding of the thermophysical properties, phase behaviour and rheology of polymer containing streams at high temperature and pressure, and over a wide range of composition. This paper describes a device used to thermo-rheologically characterize polymer solutions under conditions prevailing in polymerization reactors, downstream heat exchangers and attendant phase separation vessels. The downstream processing of the Advanced SCLAIRTECH™ Technology reactor effluent occurs at temperatures and pressures near the critical point of the solvent and co-monomer mixture. In addition, the process trajectory encompasses regions of liquid-liquid and liquid-liquid-vapour co-existence, which are demarcated by a `cloud point' curve. Knowing the location of this phase boundary is essential for the design of downstream devolatilization processes and for optimizing operating conditions in existing plants. In addition, accurate solution rheology data are required for reliable equipment sizing and design. At NOVA Chemicals, a robust high-temperature and high-pressure-capable version of the Multi-Pass Rheometer (MPR) is used to provide data on solution rheology and phase boundary location. This sophisticated piece of equipment is used to quantify the effects of solvent types, comonomer, and free ethylene concentration on the properties of the reactor effluent. An example of the experimental methodology to characterize a polyethylene solution with hexane solvent, and the ethylene dosing technique developed for the MPR will be described. ™Advanced SCLAIRTECH is a trademark of NOVA Chemicals.
Yang, Shinwoo; Cha, Jongmun; Carlson, Kenneth
2006-06-01
Two wastewater treatment plants (WWTPs) of northern Colorado were monitored for anhydroerythromycin and tylosin. An analytical method has been developed and validated for the trace determination and confirmation of these compounds in the raw influent and final effluent water matrices. This method was used to evaluate the occurrence and fate of these compounds in WWTPs. The method uses solid-phase extraction and liquid chromatography-tandem mass spectrometry with positive electrospray ionization. Detection and quantification was performed using selected reaction monitoring, and a method detection limit of between 0.01 and 0.06 microg/L was obtained. Unequivocal confirmation analysis of analyte identity according to the criteria (based on the use of identification points) of the 2002/657/EC European Commission Decision was possible with satisfactory results. Average recoveries for the two compounds ranged from 89.2+/-9.7% for raw influent to 93.7+/-6.9% for effluent wastewaters. The within-run precision of the assay was found to be always less than 14.1% for the two analytes. The overall precision was always less than 13.7%. The relative uncertainty of the present assay was also evaluated and the combined relative uncertainty ranged from 6.4 to 15.5% over three days of the validation study. These compounds were partially removed in the WWTPs with a removal efficiency of >50%. The measured concentrations in raw influents and effluents ranged from 0.09-0.35 and 0.04-0.12 microg/L for anhydroerythromycin to 0.06-0.18 and ND-0.06 microg/L for tylosin, respectively. The results indicate that WWTP effluents are relevant point sources for residues of these compounds in the aquatic environment. These occurrence results were compared with those in WWTP wastewaters of other countries.
Fluxes of 13 selected pharmaceuticals in the water cycle of Stockholm, Sweden.
Wahlberg, C; Björlenius, B; Paxéus, N
2011-01-01
Mass flows of 13 pharmaceutical active ingredients (APIS) found in drinking water were studied in the water cycle of Stockholm. Data were collected by analyzing samples of surface water, raw water and drinking water as well as influents, effluents and sludges from waste water treatment plants (WWTPs) in Stockholm area. A mass balance was performed, based on sold amounts of pharmaceuticals and the measured concentrations in water and sludge. The selected APls were all present in WWTP effluents and the removal rates for many of them were poor. Mass balance calculations showed that the three studied WWTPs in Stockholm release considerable amounts of the selected APIs into the Baltic Sea while the portions ending up in WWTP sludge were significantly lower. The levels of APIs found in drinking water are low at present, but may increase in the future unless the releases from WWTPs in the catchment of Lake Mälären are mitigated.
Optical properties of marine stratocumulus clouds modified by ship track effluents
NASA Technical Reports Server (NTRS)
King, Michael D.; Nakajima, Teruyuki; Radke, Lawrence F.
1990-01-01
Results are presented from multispectral radiation measurements made within a marine stratocumulus cloud layer modified by ship-track effluents. The measurements showed that, compared with nearby noncontaminated clouds not affected by pollution, the upwelling intensity field of the modified stratocumulus clouds increased at a nonabsorbing wavelength in the visible region and decreased in the NIR, where absorption by liquid water is significant. The observations are consistent with an increased optical thickness, a reduced effective radius of the cloud droplets, and a reduced absorption in the contaminated cloud layer compared to a noncontaminated cloud.
Bentley, Bill F.; Jett, James H.; Martin, John C.; Saunders, George C.
1992-01-01
Method and apparatus for removing material from a gas. A mist created by a piezoelectric ultrasonic transducer is contacted with the gas and both gas and mist are passed through baffled separators. Liquid effluent from the separators contains solid material removed from the gas and gaseous material which reacted with the liquid or was absorbed by the liquid. The invention is useful for collecting a sample of material in a gas, such as a vapor in the atmosphere, and in cleaning a gas. A relatively concentrated solution of a material present in a gas in a very small concentration can be obtained.
FACTORS AFFECTING THE DISSIPATION OF WINDSCALE RADIOACTIVE EFFLUENT IN THE IRISH SEA
DOE Office of Scientific and Technical Information (OSTI.GOV)
Shaw, A.E.; Charlesworth, F.R.
1952-02-20
diffusion, and residual currents was orginally assessed by Seligman and Scott in 1948. Further experimental work is described which has enabled a new assessment to be made. This work has included a measurement of the initial dilution of fresh water from the pipe line, and a study of the movement of water as indicated by drift bottles. lt is now envisaged that initial dilution, by a factor of 10, will be followed by eddy diffusion with the coefficients as measured by Seligman, and bulk movement primarily due to the force of the wind. Exceptions will occur when defined calm conditionsmore » exist. The discharged effluent will then tend to float on the surface with an initial dilution factor of only a few hundred and successive tidal releases will pour into the diffusing remains of the previous activity, there being no indications of residual currents. No work has been done to see if this more concentrated effluent can come ashore without further dilution. lt is recommended that, to avoid floating effluent, water should not be discharged during very calm weather. Maximum storage space can be assured by normally pumping effluent to sea at the next high tide after treatment. (auth)« less
Singh, Shail; Chandra, R; Patel, D K; Reddy, M M K; Rai, Vibhuti
2008-09-01
Mixed culture of two bacterial strains Bacillus sp. and Serratia marcescens showed potential pentachlorophenol (PCP) degradation and decolorisation of pulp paper mill effluent. The physico-chemical quality of pulp paper mill effluent has been analyzed after 168 h incubation period degraded by mixed culture. The study revealed that it has decreased high load of BOD, COD, TS, TDS, TSS, sulphate, phosphate, total nitrogen, total phenols, metals and different salts (i.e. chloride, sodium, nitrate, potassium) at 168 h incubation period. PCP degradation in pulp paper mill effluent was confirmed by HPLC analysis. Mixed culture was found to degrade PCP up to (94%) present in pulp paper mill effluent with 1% glucose and 0.5% peptone (w/v) at 30+/-1 degrees C, pH 8.0+/-0.2 at 120 rpm in 168 h incubation period. The simultaneous release of chloride ion up to 1,200 mg/l at 168 h emphasized the bacterial dechlorination in the medium. The pulp paper mill effluent degradation was also supported by decline in pH, AOX (absorbable organic halides), color, D.O., BOD, COD and PCP. The analysis of pulp paper mill effluent degradation products by GC-MS analysis revealed the formation of low molecular weight compound like 2-chlorophenol (RT=3.8 min) and tetrachlorohydroquinone (RT=11.86 min) from PCP extracted degraded sample. Further, mixed culture may be used for bioremediation of PCP containing pulp paper mill waste in the environment.
GAS-ATOMIZED SPRAY SCRUBBER EVALUATION
The report gives results of fine particle collection efficiency measurements of a gas-atomized spray scrubber, cleaning effluent gas from a No. 7 gray iron cupola. Tests were made at several levels of pressure drop and liquid/gas ratio. Particle size measurements on inlet and out...
40 CFR 409.34 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true Pretreatment standards for existing sources. 409.34 Section 409.34 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.34 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Pretreatment standards for existing sources. 409.34 Section 409.34 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.34 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 29 2014-07-01 2012-07-01 true Pretreatment standards for existing sources. 409.34 Section 409.34 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.34 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 30 2013-07-01 2012-07-01 true Pretreatment standards for existing sources. 409.34 Section 409.34 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.34 - Pretreatment standards for existing sources.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 30 2012-07-01 2012-07-01 false Pretreatment standards for existing sources. 409.34 Section 409.34 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
75 FR 81675 - Notice of Issuance of Regulatory Guide
Federal Register 2010, 2011, 2012, 2013, 2014
2010-12-28
... Fuel Cycle Facilities.'' FOR FURTHER INFORMATION CONTACT: Mekonen M. Bayssie, Regulatory Guide... Materials in Liquid and Gaseous Effluents from Nuclear Fuel Cycle Facilities,'' was published as Draft... guidance is applicable to nuclear fuel cycle facilities, with the exception of uranium milling facilities...
EMISSION CHARACTERIZATION OF STATIONARY NOX SOURCES: VOLUME 1. RESULTS
The report gives results of an inventory of gaseous, liquid, and solid effluents from stationary NOx sources, projected to the year 2000, and ranks them according to their potential for environmental hazard. It classifies sources according to their pollution formation characteris...
ON-SITE SOLID-PHASE EXTRACTION AND LABORATORY ...
Fragrance materials such as synthetic musks in aqueous samples, are normally determined by gas chromatography/mass spectrometry in the selected ion monitoring (SIM) mode to provide maximum sensitivity after liquid-liquid extraction of I -L samples. Full-scan mass spectra are required to verify that a target analyte has been found by comparison with the mass spectra of fragrance compounds in the NIST mass spectral library. A I -L sample usually provides insufficient analyte for full scan data acquisition. This paper describes an on-site extraction method developed at the U.S. Environmental Protection Agency (USEPA)- Las Vegas Nevada - for synthetic musks from 60 L of wastewater effluent. Such a large sample volume permits high-quality, full-scan mass spectra to be obtained for a wide array of synthetic musks. Quantification of these compounds was achieved from the full-scan data directly, without the need to acquire SIM data. The detection limits obtained with this method are an order of magnitude lower than those obtained from liquid-liquid and other solid phase extraction methods. This method is highly reproducible, and recoveries ranged from 80 to 97% in spiked sewage treatment plant effluent. The high rate of sorbent-sample mass transfer eliminated the need for a methanolic activation step, which reduced extraction time, labor, and solvent use, More samples could be extracted in the field at lower cost. After swnple extraction, the light- weight cartridges ar
Preparation and evaluation of Vinpocetine self-emulsifying pH gradient release pellets.
Liu, Mengqi; Zhang, Shiming; Cui, Shuxia; Chen, Fen; Jia, Lianqun; Wang, Shu; Gai, Xiumei; Li, Pingfei; Yang, Feifei; Pan, Weisan; Yang, Xinggang
2017-11-01
The main objective of this study was to develop a pH gradient release pellet with self-emulsifying drug delivery system (SEDDS), which could not only improve the oral bioavailability of Vinpocetine (VIN), a poor soluble drug, but reduce the fluctuation of plasma concentration. First, the liquid VIN SEDDS formulation was prepared. Then the self-emulsifying pH gradient release pellets were prepared by extrusion spheronization technique, and formulation consisted by the liquid SEDDS, absorbent (colloidal silicon dioxide), penetration enhancer (sodium chloride), microcrystalline cellulose, ethyl alcohol, and three coating materials (HPMC, Eudragit L30D55, Eudragit FS30D) were eventually selected. Three kinds of coated pellets were mixed in capsules with the mass ratio of 1:1:1. The release curves of capsules were investigated in vitro under the simulated gastrointestinal conditions. In addition, the oral bioavailability and pharmacokinetics of VIN self-emulsifying pH gradient release pellets, commercial tablets and liquid VIN SEDDS were evaluated in Beagle dogs. The oral bioavailability of self-emulsifying pH gradient release pellets was about 149.8% of commercial VIN tablets, and it was about 86% of liquid VIN SEDDS, but there were no significant difference between liquid SEDDS and self-emulsifying pH gradient release pellets. In conclusion, the self-emulsifying pH gradient release pellets could significantly enhance the absorption of VIN and effectively achieve a pH gradient release. And the self-emulsifying pH gradient release pellet was a promising method to improve bioavailability of insoluble drugs.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pires, Richard P.; Westsik, Joseph H.; Serne, R. Jeffrey
2011-07-14
Screening tests are being conducted to evaluate waste forms for immobilizing secondary liquid wastes from the Hanford Tank Waste Treatment and Immobilization Plant (WTP). Plans are underway to add a stabilization treatment unit to the Effluent Treatment Facility to provide the needed capacity for treating these wastes from WTP. The current baseline is to use a Cast Stone cementitious waste form to solidify the wastes. Through a literature survey, DuraLith alkali-aluminosilicate geopolymer, fluidized-bed steam reformation (FBSR) granular product encapsulated in a geopolymer matrix, and a Ceramicrete phosphate-bonded ceramic were identified both as candidate waste forms and alternatives to the baseline.more » These waste forms have been shown to meet waste disposal acceptance criteria, including compressive strength and universal treatment standards for Resource Conservation and Recovery Act (RCRA) metals (as measured by the toxicity characteristic leaching procedure [TCLP]). Thus, these non-cementitious waste forms should also be acceptable for land disposal. Information is needed on all four waste forms with respect to their capability to minimize the release of technetium. Technetium is a radionuclide predicted to be in the secondary liquid wastes in small quantities, but the Integrated Disposal Facility (IDF) risk assessment analyses show that technetium, even at low mass, produces the largest contribution to the estimated IDF disposal impacts to groundwater.« less
Karas, Panagiotis; Metsoviti, Aria; Zisis, Vasileios; Ehaliotis, Constantinos; Omirou, Michalis; Papadopoulou, Evangelia S; Menkissoglou-Spiroudi, Urania; Manta, Stella; Komiotis, Dimitri; Karpouzas, Dimitrios G
2015-10-15
Wastewaters from the fruit-packaging industry constitute a serious point source contamination with pesticides. In the absence of effective depuration methods, they are discharged in municipal wastewater treatment plants or spread to land. Modified biobeds could be an applicable solution for their treatment. We studied the dissipation of thiabendazole (TBZ), imazalil (IMZ), ortho-phenylphenol (OPP), diphenylamine (DPA) and ethoxyquin (EQ), used by the fruit-packaging industry, in anaerobically digested sewage sludge, liquid aerobic sewage sludge and in various organic substrates (biobeds packing materials) composed of soil, straw and spend mushroom substrate (SMS) in various volumetric ratios. Pesticide sorption was also determined. TBZ and IMZ showed higher persistence especially in the anaerobically digested sewage sludge (DT50=32.3-257.6d), in contrast to OPP and DPA which were rapidly dissipated especially in liquid aerobic sewage sludge (DT50=1.3-9.3d). EQ was rapidly oxidized mainly to quinone imine (QI) which did not persist and dimethyl ethoxyquinoline (EQNL, minor metabolite) which persisted for longer. Sterilization of liquid aerobic sewage sludge inhibited pesticide decay verifying the microbial nature of pesticide dissipation. Organic substrates rich in SMS showed the highest dissipation capacity with TBZ and IMZ DT50s of ca. 28 d compared to DT50s of >50 d in the other substrates. TBZ and IMZ showed the highest sorption affinity, whereas OPP and DPA were weakly sorbed. Our findings suggest that current disposal practices could not guarantee an efficient depuration of effluents from the fruit-packaging industry, whereas SMS-rich biobed organic substrates show efficient depuration of effluents from the fruit-packaging industry via accelerated dissipation even of recalcitrant fungicides. Copyright © 2015 Elsevier B.V. All rights reserved.
Yang, Zhenzhou; Tian, Sicong; Ji, Ru; Liu, Lili; Wang, Xidong; Zhang, Zuotai
2017-10-01
The present study systemically investigated the effect of a water-washing process on the removal of harmful chlorides, sulfates, and heavy metals in the air pollution control (APC) residue from municipal solid wastes incineration (MSWI), for sake of a better reuse and disposal of this kind of waste. In addition, the kinetic study was conducted to reveal the releasing mechanism of relevant element in the residue. The results show that, over 70wt.% of chlorides and nearly 25wt.% of sulfates in the residue could be removed by water washing. Based on an economical consideration, the optimal operation conditions for water washing of APC residue was at liquid/solid (L/S) ratio of 3mL:1g and extracting time of 5min. As expected, the concentrations of Co, Cr, Fe, Ni, V and Cu in the washing effluent increased with time during the washing process. However, the extracting regime differs among different heavy metals. The concentrations of Ba and Mn increased firstly but declined afterwards, and concentrations of Pb and Zn gradually declined while Cd and As kept constant with the increase of extracting time. It is worth mentioning that the bubbling of CO 2 into the washing effluent is promisingly effective for a further removal of Pb, Cu and Zn. Furthermore, kinetic study of the water washing process reveals that the extracting of heavy metals during water washing follows a second-order model. Copyright © 2017 Elsevier Ltd. All rights reserved.
Zhang, Caixiang; Eganhouse, Robert P.; Pontolillo, James; Cozzarelli, Isabelle M.; Wang, Yanxin
2012-01-01
4-Nonylphenols (4-NPs) are known endocrine disruptors and by-products of the microbial degradation of nonylphenol polyethoxylate surfactants. One of the challenges to understanding the toxic effects of nonylphenols is the large number of isomers that may exist in environmental samples. In order to attribute toxic effects to specific compounds, a method is needed for the separation and quantitation of individual nonylphenol isomers. The pre-concentration methods of solvent sublimation, solid-phase extraction or liquid–liquid extraction prior to chromatographic analysis can be problematic because of co-extraction of thousands of compounds typically found in complex matrices such as municipal wastewater or landfill leachate. In the present study, steam distillation extraction (SDE) was found to be an effective pre-concentration method for extraction of 4-NPs from leachate and wastewater, and comprehensive two-dimensional gas chromatography (GC × GC) coupled with fast mass spectral data acquisition by time-of-flight mass spectrometry (ToFMS) enhanced the resolution and identification of 4-NP isomers. Concentrations of eight 4-NP isomers were determined in leachate from landfill cells of different age and wastewater influent and effluent samples. 4-NP isomers were about 3 times more abundant in leachate from the younger cell than the older one, whereas concentrations in wastewater effluent were either below detection limits or <1% of influent concentrations. 4-NP isomer distribution patterns were found to have been altered following release to the environment. This is believed to reflect isomer-specific degradation and accumulation of 4-NPs in the aquatic environment.
Can, Zehra Semra; Fırlak, Melike; Kerç, Aslıhan; Evcimen, Serkan
2014-01-01
Endocrine-disrupting compounds (EDCs) are exogenous substances that cause adverse health effects in an intact organism, or its progeny, subsequent to the changes in endocrine function. Recent studies have shown that wastewater treatment plant effluents play an important role in the release of EDCs into aquatic environments. Therefore, in this study, influent and effluent samples from three different wastewater treatment plants (WWTPs) in Istanbul were analysed for the presence of the principal EDCs. These chemicals include steroids and synthetic organic chemicals. Thus, the occurrence and fate of EDCs of great health concern were monitored at three WWTPs in Istanbul. Furthermore, these WWTPs are employing different treatment processes. Therefore, the EDC removal performances of different treatment regimes were also evaluated. Phytosterol was the most abundant EDC in the influent samples. Second group of compounds at high influent levels were alkyl phenols. Pesticide levels of all three WWTP influent samples were low. Pasakoy Advanced WWTP is more effective at eliminating EDCs. Kadikoy Primary WWTP exhibits the lowest EDC elimination efficiencies. To the best of our knowledge, this work comprises the first detailed report on the occurrence and behaviour of both natural and synthetic EDCs in WWTPs of Istanbul and Turkey. The steroid estrogen levels of this study are higher than the previously documented values, except the levels given for Gaobeidian WWTP in Beijing, China. This is attributed to higher population densities of Beijing and Istanbul and as well as to lower individual water consumption rates in the two cities.
Use of once-through treat gas to remove the heat of reaction in solvent hydrogenation processes
Nizamoff, Alan J.
1980-01-01
In a coal liquefaction process wherein feed coal is contacted with molecular hydrogen and a hydrogen-donor solvent in a liquefaction zone to form coal liquids and vapors and coal liquids in the solvent boiling range are thereafter hydrogenated to produce recycle solvent and liquid products, the improvement which comprises separating the effluent from the liquefaction zone into a hot vapor stream and a liquid stream; cooling the entire hot vapor stream sufficiently to condense vaporized liquid hydrocarbons; separating condensed liquid hydrocarbons from the cooled vapor; fractionating the liquid stream to produce coal liquids in the solvent boiling range; dividing the cooled vapor into at least two streams; passing the cooling vapors from one of the streams, the coal liquids in the solvent boiling range, and makeup hydrogen to a solvent hydrogenation zone, catalytically hydrogenating the coal liquids in the solvent boiling range and quenching the hydrogenation zone with cooled vapors from the other cooled vapor stream.
Colloid release and clogging in porous media: Effects of solution ionic strength and flow velocity.
Torkzaban, Saeed; Bradford, Scott A; Vanderzalm, Joanne L; Patterson, Bradley M; Harris, Brett; Prommer, Henning
2015-10-01
The release and retention of in-situ colloids in aquifers play an important role in the sustainable operation of managed aquifer recharge (MAR) schemes. The processes of colloid release, retention, and associated permeability changes in consolidated aquifer sediments were studied by displacing native groundwater with reverse osmosis-treated (RO) water at various flow velocities. Significant amounts of colloid release occurred when: (i) the native groundwater was displaced by RO-water with a low ionic strength (IS), and (ii) the flow velocity was increased in a stepwise manner. The amount of colloid release and associated permeability reduction upon RO-water injection depended on the initial clay content of the core. The concentration of released colloids was relatively low and the permeability reduction was negligible for the core sample with a low clay content of about 1.3%. In contrast, core samples with about 6 and 7.5% clay content exhibited: (i) close to two orders of magnitude increase in effluent colloid concentration and (ii) more than 65% permeability reduction. Incremental improvement in the core permeability was achieved when the flow velocity increased, whereas a short flow interruption provided a considerable increase in the core permeability. This dependence of colloid release and permeability changes on flow velocity and colloid concentration was consistent with colloid retention and release at pore constrictions due to the mechanism of hydrodynamic bridging. A mathematical model was formulated to describe the processes of colloid release, transport, retention at pore constrictions, and subsequent permeability changes. Our experimental and modeling results indicated that only a small fraction of the in-situ colloids was released for any given change in the IS or flow velocity. Comparison of the fitted and experimentally measured effluent colloid concentrations and associated changes in the core permeability showed good agreement, indicating that the essential physics were accurately captured by the model. Copyright © 2015 Elsevier B.V. All rights reserved.
Pérez-Alvarez, Itzayana; Islas-Flores, Hariz; Gómez-Oliván, Leobardo Manuel; Barceló, Damià; López De Alda, Miren; Pérez Solsona, Sandra; Sánchez-Aceves, Livier; SanJuan-Reyes, Nely; Galar-Martínez, Marcela
2018-05-08
Due to the activities inherent to medical care units, the hospital effluent released contains diverse contaminants such as tensoactives, disinfectants, metals, pharmaceutical products and chemical reagents, which are potentially toxic to the environment since they receive no treatment or are not effectively removed by such treatment before entering the drain. They are incorporated into municipal wastewater, eventually entering water bodies where they can have harmful effects on organisms and can result in ecological damage. To determine the toxicological risk induced by this type of eflluents, eight metals and 11 pharmaceuticals were quantified, in effluent from a hospital. Developmental effects, teratogenesis and oxidative stress induction were evaluated in two bioindicator species: Xenopus laevis and Lithobates catesbeianus. FETAX (frog embryo teratogenesis assay-Xenopus) was used to obtain the median lethal concentration (LC 50 ), effective concentration inducing 50% malformation (EC 50 ), teratogenic index (TI), minimum concentration to inhibit growth (MCIG), and the types of malformation induced. Twenty oocytes in midblastula transition were exposed to six concentrations of effluent (0.1, 0.3, 0.5, 0.7, 0.9, 1%) and negative and positive (6-aminonicotinamide) controls. After 96 h of exposure, diverse biomarkers of oxidative damage were evaluated: hydroperoxide content, lipid peroxidation, protein carbonyl content, and the antioxidant enzymes superoxide dismutase and catalase. TI was 3.8 in X. laevis and 4.0 in L. catesbeianus, both exceed the value in the FETAX protocol (1.2), indicating that this effluent is teratogenic to both species. Growth inhibition was induced as well as diverse malformation including microcephaly, cardiac and facial edema, eye malformations, and notochord, tail, fin and gut damage. Significant differences relative to the control group were observed in both species with all biomarkers. This hospital effluent contains contaminants which represents a toxic risk, since these substances are teratogenic to the bioindicators used. The mechanism of damage induction may be associated with oxidative stress. Copyright © 2018 Elsevier Ltd. All rights reserved.
Munir, Mariya; Wong, Kelvin; Xagoraraki, Irene
2011-01-01
The purpose of this study was to quantify the occurrence and release of antibiotic resistant genes (ARGs) and antibiotic resistant bacteria (ARB) into the environment through the effluent and biosolids of different wastewater treatment utilities including an MBR (Membrane Biological Reactor) utility, conventional utilities (Activated Sludge, Oxidative Ditch and Rotatory Biological Contactors-RBCs) and multiple sludge treatment processes (Dewatering, Gravity Thickening, Anaerobic Digestion and Lime Stabilization). Samples of raw wastewater, pre- and post-disinfected effluents, and biosolids were monitored for tetracycline resistant genes (tetW and tetO) and sulfonamide resistant gene (Sul-I) and tetracycline and sulfonamide resistant bacteria. ARGs and ARB concentrations in the final effluent were found to be in the range of ND(non-detectable)-2.33 × 10(6) copies/100 mL and 5.00 × 10(2)-6.10 × 10(5) CFU/100 mL respectively. Concentrations of ARGs (tetW and tetO) and 16s rRNA gene in the MBR effluent were observed to be 1-3 log less, compared to conventional treatment utilities. Significantly higher removals of ARGs and ARB were observed in the MBR facility (range of removal: 2.57-7.06 logs) compared to that in conventional treatment plants (range of removal: 2.37-4.56 logs) (p < 0.05). Disinfection (Chlorination and UV) processes did not contribute in significant reduction of ARGs and ARB (p > 0.05). In biosolids, ARGs and ARB concentrations were found to be in the range of 5.61 × 10(6)-4.32 × 10(9) copies/g and 3.17 × 10(4)-1.85 × 10(9) CFU/g, respectively. Significant differences (p < 0.05) were observed in concentrations of ARGs (except tetW) and ARB between the advanced biosolid treatment methods (i.e., anaerobic digestion and lime stabilization) and the conventional dewatering and gravity thickening methods. Copyright © 2010 Elsevier Ltd. All rights reserved.
A bleached-kraft mill effluent fraction causing induction of a fish mixed-function oxygenase enzyme
DOE Office of Scientific and Technical Information (OSTI.GOV)
Burnison, B.K.; Hodson, P.V.; Nuttley, D.J.
1996-09-01
Pulp mill effluents contain a myriad of chemicals that have the potential to cause deleterious effects on aquatic biota in receiving waters. Some of these chemicals evoke an acute lethal response of exposed biota while others evoke sublethal responses. One such sublethal response is the induction of mixed-function oxygenases (MFO) in fish, specifically the CYP1A1 enzyme ethoxy-resorufin-o-deethylase (EROD). Compounds causing MFO induction include congeners of polychlorinated biphenyls (PCBs), dioxins, furans, and polycyclic aromatic hydrocarbons (PAHs). The authors followed the partitioning of the inducing chemicals in pulp mill effluent fractions by Toxicity Identification Evaluation (TIE), or bioassay-driven chemical analysis. This proceduremore » was eventually modified to a more direct technique involving centrifugation, filtration, cleanup procedures, and C{sub 18} solid-phase adsorption. The extracts from the fractionation of two pulp mill effluents after secondary treatment were tested for EROD-inducing activity in a 4-d rainbow trout bioassay. The methanol extracts of particulates/colloids showed significant inducing capacity in Mill A effluent but not in Mill B effluent. The C{sub 18} methanol extracts induced activity from both effluents, with extracts from Mill A causing the greatest response. The particulate/colloidal extract (Mill A) was used as the source material for chemicals which caused EROD induction. The fraction was purified by solid-phase extraction techniques and reverse-phase high-performance liquid chromatography. The majority of the EROD activity was found in the moderately nonpolar region of the chromatogram (K{sub ow} = 4.6 to 5.1).« less
The feasibility of effluent trading in the energy industries
DOE Office of Scientific and Technical Information (OSTI.GOV)
Veil, J.A.
1997-05-01
In January 1996, the U.S. Environmental Protection Agency (EPA) released a policy statement endorsing effluent trading in watersheds, hoping to spur additional interest in the subject. The policy describes five types of effluent trades - point source/point source, point source/nonpoint source, pretreatment, intraplant, and nonpoint source/nonpoint source. This report evaluates the feasibility of effluent trading for facilities in the oil and gas industry (exploration and production, refining, and distribution and marketing segments), electric power industry, and the coal industry (mines and preparation plants). Nonpoint source/nonpoint source trades are not considered since the energy industry facilities evaluated here are all pointmore » sources. EPA has administered emission trading programs in its air quality program for many years. Programs for offsets, bubbles, banking, and netting are supported by federal regulations, and the 1990 Clean Air Act (CAA) amendments provide a statutory basis for trading programs to control ozone and acid rain. Different programs have had varying degrees of success, but few have come close to meeting their expectations. Few trading programs have been established under the Clean Water Act (CWA). One intraplant trading program was established by EPA in its effluent limitation guidelines (ELGs) for the iron and steel industry. The other existing effluent trading programs were established by state or local governments and have had minimal success.« less
Recovery of ammonia and phosphate minerals from swine wastewater using gas-permeable membranes
USDA-ARS?s Scientific Manuscript database
Gas-permeable membrane technology is useful to recover ammonia from liquid manures. In this study, phosphorus (P) recovery via magnesium chloride precipitation was enhanced by combining it with ammonia recovery through gas-permeable membranes. Anaerobically digested swine effluent containing approx...
40 CFR 409.35 - Standards of performance for new sources.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true Standards of performance for new sources. 409.35 Section 409.35 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.35 - Standards of performance for new sources.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new sources. 409.35 Section 409.35 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.35 - Standards of performance for new sources.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 30 2013-07-01 2012-07-01 true Standards of performance for new sources. 409.35 Section 409.35 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.35 - Standards of performance for new sources.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 30 2012-07-01 2012-07-01 false Standards of performance for new sources. 409.35 Section 409.35 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 409.35 - Standards of performance for new sources.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 29 2014-07-01 2012-07-01 true Standards of performance for new sources. 409.35 Section 409.35 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining...
40 CFR 417.86 - Pretreatment standards for new sources.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 29 2014-07-01 2012-07-01 true Pretreatment standards for new sources. 417.86 Section 417.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
40 CFR 417.86 - Pretreatment standards for new sources.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true Pretreatment standards for new sources. 417.86 Section 417.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
40 CFR 417.86 - Pretreatment standards for new sources.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 30 2012-07-01 2012-07-01 false Pretreatment standards for new sources. 417.86 Section 417.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
40 CFR 417.86 - Pretreatment standards for new sources.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Pretreatment standards for new sources. 417.86 Section 417.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
40 CFR 417.86 - Pretreatment standards for new sources.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 30 2013-07-01 2012-07-01 true Pretreatment standards for new sources. 417.86 Section 417.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps...
Use of ammonia to reduce the viscosity of bottoms streams produced in hydroconversion processes
Zaczepinski, Sioma; Billimoria, Rustom M.; Tao, Frank; Lington, Christopher G.; Plumlee, Karl W.
1984-01-01
Coal, petroleum residuum and similar carbonaceous feed materials are subjected to hydroconversion in the presence of molecular hydrogen to produce a hydroconversion effluent which is then subjected to one or more separation steps to remove lower molecular weight liquids and produce a heavy bottoms stream containing high molecular weight liquids and unconverted carbonaceous material. The viscosity of the bottoms streams produced in the separation step or steps is prevented from increasing rapidly by treating the feed to the separation step or steps with ammonia gas prior to or during the separation step or steps. The viscosity of the heavy bottoms stream produced in the final separation step is also controlled by treating these bottoms with ammonia gas. In a preferred embodiment of the invention, the effluent from the hydroconversion reactor is subjected to an atmospheric distillation followed by a vacuum distillation and the feeds to these distillations are contacted with ammonia during the distillations.
Santos, J L; Aparicio, I; Alonso, E
2007-05-01
The occurrence of four anti-inflammatory drugs (diclofenac, ibuprofen, ketoprofen and naproxen), an antiepileptic drug (carbamazepine) and a nervous stimulant (caffeine) in influent and effluent samples from four wastewater treatment plants (WWTPs) in Seville was evaluated. Removal rates in the WWTPs and risk assessment of the pharmaceutically active compounds have been studied. Analytical determination was carried out by high performance liquid chromatography (HPLC) with diode array (DAD) and fluorescence (Fl) detectors after sample clean up and concentration by solid phase extraction. All pharmaceutically active compounds, except diclofenac, were detected not only in wastewater influents but also in wastewater effluents. Mean concentrations of caffeine, carbamazepine, ketoprofen and naproxen ranged between 0.28-11.44 microg l(-1) and 0.21-2.62 microg l(-1) in influent and effluent wastewater, respectively. Ibuprofen was present in the highest concentrations in the range 12.13-373.11 microg l(-1) and 0.78-48.24 microg l(-1) in influent and effluent wastewater, respectively. Removal rates of the pharmaceuticals ranged between 6 and 98%. Risk quotients, expressed as ratios between the measured environmental concentration (MEC) and the predicted no effect concentrations (PNEC) were higher than 1 for ibuprofen and naproxen in influent wastewater and for ibuprofen in effluent wastewater.
Kinetics and Effects of Dichloroacetic Acid in Rainbow Trout
Halogenated acetic acids (HAAs) are continuously released to surface waters in municipal wastewater effluents. Very little is known, however, about their potential to adversely impact aquatic life. The purpose of this study was to investigate the uptake, distribution, elimination...
Apparatuses and methods for deoxygenating biomass-derived pyrolysis oil
Kalnes, Tom N.
2015-12-29
Apparatuses and methods for deoxygenating a biomass-derived pyrolysis oil are provided herein. In one example, the method comprises of dividing a feedstock stream into first and second feedstock portions. The feedstock stream comprises the biomass-derived pyrolysis oil and has a temperature of about 60.degree. C. or less. The first feedstock portion is combined with a heated organic liquid stream to form a first heated diluted pyoil feed stream. The first heated diluted pyoil feed stream is contacted with a first deoxygenating catalyst in the presence of hydrogen to form an intermediate low-oxygen pyoil effluent. The second feedstock portion is combined with the intermediate low-oxygen pyoil effluent to form a second heated diluted pyoil feed stream. The second heated diluted pyoil feed stream is contacted with a second deoxygenating catalyst in the presence of hydrogen to form additional low-oxygen pyoil effluent.
Code of Federal Regulations, 2012 CFR
2012-07-01
... other than a liquid manure handling system. (12) 30,000 ducks (if the farm uses other than a liquid manure handling system). (13) 5,000 ducks (if the farm uses a liquid manure handling system). (h) Any...
Code of Federal Regulations, 2014 CFR
2014-07-01
... other than a liquid manure handling system. (12) 30,000 ducks (if the farm uses other than a liquid manure handling system). (13) 5,000 ducks (if the farm uses a liquid manure handling system). (h) Any...
Code of Federal Regulations, 2011 CFR
2011-07-01
... other than a liquid manure handling system. (12) 30,000 ducks (if the farm uses other than a liquid manure handling system). (13) 5,000 ducks (if the farm uses a liquid manure handling system). (h) Any...
Code of Federal Regulations, 2013 CFR
2013-07-01
... other than a liquid manure handling system. (12) 30,000 ducks (if the farm uses other than a liquid manure handling system). (13) 5,000 ducks (if the farm uses a liquid manure handling system). (h) Any...
Code of Federal Regulations, 2010 CFR
2010-07-01
... other than a liquid manure handling system. (12) 30,000 ducks (if the farm uses other than a liquid manure handling system). (13) 5,000 ducks (if the farm uses a liquid manure handling system). (h) Any...
Desulfurization of Coal in Fluidized Beds
NASA Technical Reports Server (NTRS)
Maddury, R.; Kalvinskas, J.
1985-01-01
Experimental dry chemical process for removing sulfur from coal-and thereby reducing harmful sulfur emissions from coal-fired electric powerplants-promises more economical and effective than older wet chemical processes. New process faster, requires smaller amounts of chemical reagents, and produces no liquid effluents, which poses disposal problem.
Separation of ammonia and phosphate minerals from wastewater using gas-permeable membranes
USDA-ARS?s Scientific Manuscript database
Conservation and recovery of nitrogen and phosphorus from animal wastes and municipal effluents is important because of economic and environmental reasons. In this paper we present a novel technology for separation and recovery of ammonia and phosphorus from liquid swine manure. Phosphorus recovery ...
40 CFR 409.36 - Pretreatment standards for new sources.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 29 2011-07-01 2009-07-01 true Pretreatment standards for new sources. 409.36 Section 409.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409...
40 CFR 409.36 - Pretreatment standards for new sources.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Pretreatment standards for new sources. 409.36 Section 409.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409...
Automatic Flushing Unit With Cleanliness Monitor
NASA Technical Reports Server (NTRS)
Hildebrandt, N. E.
1982-01-01
Liquid-level probe kept clean, therefore at peak accuracy, by unit that flushes probe with solvent, monitors effluent for contamination, and determines probe is particle-free. Approach may be adaptable to industrial cleaning such as flushing filters and pipes, and ensuring that manufactured parts have been adequately cleaned.
40 CFR 409.36 - Pretreatment standards for new sources.
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 30 2013-07-01 2012-07-01 true Pretreatment standards for new sources. 409.36 Section 409.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409...
40 CFR 409.36 - Pretreatment standards for new sources.
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 30 2012-07-01 2012-07-01 false Pretreatment standards for new sources. 409.36 Section 409.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409...
40 CFR 409.36 - Pretreatment standards for new sources.
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 29 2014-07-01 2012-07-01 true Pretreatment standards for new sources. 409.36 Section 409.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SUGAR PROCESSING POINT SOURCE CATEGORY Liquid Cane Sugar Refining Subcategory § 409...
NASA Astrophysics Data System (ADS)
Aprilia, N. A. S.; Fauzi; Azmi, N.; Najwan, N.; Amin, A.
2018-03-01
Performance of cellulose acetate membrane for treatment of POME liquid has studied with different additives. Cellulose acetate membranes were prepared with different additive ie formamide and polyethylene glycol and used acetone as solvent. The function of formamide and polyethylene glycol (PEG) is to increase the porosity of the membrane surface. Performance of the membrane were included SEM, FT-IR and coefficient permeability. Membrane performance has been performed for percent rejection of total suspended solid (TSS) and turbidity of POME liquid waste. Cellulose acetate with formamide shows an increased percentage of rejection in removing TSS and turbidity than cellulose acetate with PEG.
Closed end regeneration method
Yang, Arthur Jing-Min; Zhang, Yuehua
2006-06-27
A nanoporous reactive adsorbent incorporates a relatively small number of relatively larger reactant, e.g. metal, enzyme, etc. particles (10) forming a discontinuous or continuous phase interspersed among and surrounded by a continuous phase of smaller adsorbent particles (12) and connected interstitial pores (14) therebetween. The reactive adsorbent can effectively remove inorganic or organic impurities in a liquid by causing the liquid to flow through the adsorbent. For example, silver ions may be adsorbed by the adsorbent particles (12) and reduced to metallic silver by reducing metal, such as irons, as the reactant particles (10). The column can be regenerated by backwashing with the liquid effluent containing, for example, acetic acid.
TOXIC METAL EMISSIONS FROM INCINERATION: MECHANISMS AND CONTROL
Toxic metals appear in the effluents of many combustion processes, and their release into the environment has come under regulatory scrutiny. This paper reviews the nature of the problems associated with toxic metals in combustion processes, and describes where these problems occ...
Heidler, Jochen; Halden, Rolf U.
2009-01-01
This study examined the occurrence in wastewater of 11 aromatic biocides, pesticides and degradates, and their fate during passage through U.S. treatment plants, as well as the chemical mass contained in sewage sludge (biosolids) destined for land application. Analyte concentrations in wastewater influent, effluent and sludge from 25 facilities in 18 U.S. states were determined by liquid chromatography electrospray (tandem) mass spectrometry. Dichlorocarbanilide, fipronil, triclocarban, and triclosan were found consistently in all sample types. Dichlorophene, hexachlorophene, and tetrachlorocarbanilide were detected infrequently only, and concentrations of the phenyl urea pesticides diflubenzuron, hexaflumuron, and linuron were below the limit of detection in all matrixes. Median concentrations (± 95% confidence interval) of quantifiable compounds in influent ranged from 4.2 ± 0.8 µg L−1 for triclocarban to 0.03 ± 0.01 µg L−1 for fipronil. Median concentrations in effluent were highest for triclocarban and triclosan (0.23 ± 0.08 and 0.07 ± 0.04 µg L−1, respectively). Median aqueous-phase removal efficiencies (± 95% CI) of activated sludge treatment plants decreased in the order of: triclosan (96 ± 2%) > triclocarban (87 ± 7%) > dichlorocarbanilide (55 ± 20%) > fipronil (18 ± 22%). Median concentrations of organohalogens were typically higher in anaerobically than in aerobically digested sludges, and peaked at 27,600 ± 9,600 and 15,800 ± 8,200 µg kg−1 for triclocarban and triclosan, respectively. Mass balances obtained for three primary pesticides in six activated sludge treatment plants employing anaerobic digestion suggested a decreasing overall persistence from fipronil (97 ± 70%) to triclocarban (87 ± 29%) to triclosan (28 ± 30%). Nationwide release of the investigated organohalogens to agricultural land via municipal sludge recycling and into surface waters is estimated to total 258,000 ± 110,00 kg yr−1 (mean ± 95% confidence interval), with most of this mass derived from antimicrobial consumer products of daily use. This study addresses some of the data gaps identified by the National Research Council in its 2002 study on standards and practices of biosolids application on land. PMID:20024018
Wang, Xiaowei; Xi, Beidou; Huo, Shouliang; Sun, Wenjun; Pan, Hongwei; Zhang, Jingtian; Ren, Yuqing; Liu, Hongliang
2013-07-01
Characterization, treatment and releases of eight polybrominated diphenyl ethers (PBDEs) congeners and sixteen polycyclic aromatic hydrocarbons (PAHs) in wastewater were evaluated along the treatment processes of a typical secondary treatment municipal sewage treatment plant (STP) (in Hefei City) situated the beside Nanfei River, East China. The findings showed that the average concentrations of the total PBDEs in raw wastewater and treated effluent were 188.578 and 36.884 ng/L respectively. Brominated diphenyl ether (BDE) 209 congener, the predominant PBDE in the STP and Nanfei River, could be related to the discharge of car-industry-derived wastes. For PAHs, the average concentrations in raw wastewater and treated effluent were 5758.8 and 2240.4 ng/L respectively, with naphthalene, benzo[a]pyrene and indeno[1,2,3-c,d]pyrene being detected at the highest concentrations. PAHs mainly originate from the combustion of biomass/coal and petroleum. The STP reduced about 80% of the PBDEs and 61% of the PAHs, which were eliminated mainly by sedimentation processes. The removal rates of PBDEs/PAHs increased with the increase of their solid-water partitioning coefficients. Accordingly, the STP's effluent, containing some PBDE congeners (e.g., BDE 47, 99 and 209, etc.) and low-molecular-weight PAHs, could be an important contributor of these contaminants' input to Nanfei River. It resulted in a significant increase of PBDE/PAH concentrations and PAH toxicological risk in the river water downstream. About 4.040 kg/yr of PBDEs and 245.324 kg/yr of PAHs could be released into the Nanfei River. The current conventional wastewater treatment processes should be improved to remove the relatively low-molecular-weight PBDEs/PAHs more effectively.
NASA Astrophysics Data System (ADS)
Urakoshi, T.; Kawagoe, T.; Ohta, T.
2017-12-01
Effluent from rock muck piles consisting of waste rock, as a by-product of construction, sometimes contains heavy metals that affects human health and environment. Rain is the key to estimate water quality of the effluent because infiltrated rain to piles reacts with minerals of rocks. Thus, we newly proposed a dissolution test, namely cyclic injection test, considering rain events, as the following steps: Firstly, we crushed rock sample to particles of size of between 2 and 20 mm, and filled them into the column with 54 mm in diameter and 300 mm in length. Secondly, we saturated void in the column with pure water. One hour after, we opened a valve of the bottom of the column, and collected effluent. Thirdly, we preserved the column for 14 days. After then, we injected 200 ml of pure water from the top of the column within about 15 minutes, and collected efflent. We repeated injection of pure water every 14 days. We conducted the cyclic injection test for altered volcanic rock sample, and observed that the effluent just after the injection showed highest concentration. This result indicated that dissolved chemicals were released from minerals to capillary water after an injection, and advected outside of the column at the next injection.
Barco-Bonilla, Nieves; Romero-González, Roberto; Plaza-Bolaños, Patricia; Martínez Vidal, José L; Garrido Frenich, Antonia
2013-03-01
The occurrence of priority organic pollutants in wastewater (WW) effluents was evaluated in a semi-arid area, characterized by a high agricultural and tourism activity, as Almeria province (Southeastern Spain). Twelve wastewater treatment plants (WWTPs) were sampled in three campaigns during 2011, obtaining a total of 33 WW samples, monitoring 226 compounds, including pesticides, polycyclic aromatic hydrocarbons (PAHs), phenolic compounds and volatile organic compounds (VOCs). Certain banned organochlorine pesticides such as aldrin, pentachlorobenzene, o,p'-DDD and endosulfan lactone were found, and the most frequently detected pesticides were herbicides (diuron, triazines). PAHs and VOCs were also detected, noting that some of these pollutants were ubiquitous. Regarding phenolic compounds, 4-tertoctylphenol was found in all the WW samples at high concentration levels (up to 89.7 μg/L). Furthermore, it was observed that WW effluent samples were less contaminated in the second and third sampling periods, which corresponded to dry season. This evaluation revealed that despite the WW was treated in the WWTP, organic contaminants are still being detected in WW effluents and therefore they are released into the environment. Finally the risk of environmental threat due to the presence of some compounds in WWTP effluents, especially concerning 4-tertoctylphenol must be indicated. Copyright © 2013 Elsevier B.V. All rights reserved.
Impact of tannery effluents on the aquatic environment of the Buriganga River in Dhaka, Bangladesh.
Asaduzzaman, Mohammad; Hasan, Imtiaj; Rajia, Sultana; Khan, Nazneen; Kabir, Kazi Ahmed
2016-06-01
This study presents an overview of the existence and effects of six heavy metals, chromium (Cr), lead (Pb), cadmium (Cd), mercury (Hg), manganese (Mn), and aluminum (Al), in tannery effluents released to the Buriganga River in Dhaka, Bangladesh. The pollutants were found in three different sources, such as effluents from tanneries, contaminated river water and three species of fish-climbing perch (Anabas testudineus), spotted snakehead (Channa punctata), and Black tilapia (Oreochromis mossambicus) caught from the river. Tannery effluents, water, and fish samples were collected from three different factories, five sample stations, and three different harvesting points, respectively. Effluents from all three factories contained significant amounts of heavy metals, especially Cr (374.19 ppm in average), whereas lesser amounts were found in the tissues of the three fish species studied. The trends in tissue elemental concentrations of fish were Cr > Pb > Al > Hg > Mn > Cd. In most cases (Cr, Cd, Mn, and Al), heavy metal concentrations were found to be greater in climbing perch than in Black tilapia and spotted snakehead. Although the river water contained high concentrations of harmful heavy metals, the fish species under study had concentrations well below the permissible Food and Agriculture Organization/World Health Organization levels for those metals and seemed to be safe for human consumption. © The Author(s) 2014.
Bioremediation of an iron-rich mine effluent by Lemna minor.
Teixeira, S; Vieira, M N; Espinha Marques, J; Pereira, R
2014-01-01
Contamination of water resources by mine effluents is a serious environmental problem. In a old coal mine, in the north of Portugal (São Pedro da Cova, Gondoma),forty years after the activity has ended, a neutral mine drainage, rich in iron (FE) it stills being produced and it is continuously released in local streams (Ribeiro de Murta e Rio Ferreira) and in surrounding lands. The species Lemna minor has been shown to be a good model for ecotoxicological studies and it also has the capacity to bioaccumulate metals. The work aimed test the potential of the species L. minor to remediate this mine effluent, through the bioaccumulation of Fe, under greenhouse experiments and, at the same time, evaluate the time required to the maximum removal of Fe. The results have shown that L. minor was able to grow and develop in the Fe-rich effluent and bioaccumulating this element. Throughout the 21 days of testing it was found that there was a meaningful increase in the biomass of L. minor both in the contaminated and in the non-contaminated waters. It was also found that bioaccumulation of Fe (iron) occurred mainly during the first 7 days of testing. It was found that L. minor has potential for the bioremediation of effluents rich in iron.
de Sousa, José Tavares; Lima, Jéssyca de Freitas; da Silva, Valquíria Cordeiro; Leite, Valderi Duarte; Lopes, Wilton Silva
2017-03-01
The aim of the present study was to evaluate the biological oxidation of sulphide in two different UASB reactors by assessing the occurrence of oxidized forms of sulphur in the effluents and the amount of S 0 that could be recovered in the process. The bioreactors employed were an anaerobic hybrid (AH) reactor employing porous polyurethane foam as support media and a micro-aerated UASB reactor equipped with an aeration device above the digestion zone. The AH reactor produced a final effluent containing low concentrations of S 2- (3.87% of total sulphur load). It was achieved due to a complete oxidation of 56.1% of total sulphur. The partial biological oxidation that occurred in the AH reactor allowed the recovery of 30% of the sulphur load as S 0 . The effluent from the micro-aerated UASB reactor contained 5% of the sulphur load in the form of S 2- , while 20.9% was present as dissolved SO 4 2- and 46% was precipitated as S 0 . It is concluded that the AH reactor or micro-aeration carried out above the digestion zone of the UASB reactor favoured the biological oxidation of S 2- and the release of odourless effluents. Both technologies represent feasible and low-cost alternatives for the anaerobic treatment of domestic sewage.
NASA Astrophysics Data System (ADS)
Ediviani, W.; Priadi, C. R.; Moersidik, S. S.
2018-05-01
Indonesia has implemented energy recovery from organic (food) waste by anaerobic digestion method, but the digestate was commonly treated only by composting, and still as a separated treatment (not integrated into a resource recovery system). Whilst not getting any pretreatment, the digestate was disposed to the environment and then act as a pollutant. Yet it contains nutrients which could be recovered as a nutrient source for plants. The study was about how ornamental aquatic macrophytes could uptake nitrogen from liquid digestate in a constructed wetland method. Canna indica, Iris pseudacorus, and Typha latifolia were the experimented ornamental aquatic macrophytes used to uptake the nutrient (nitrogen—N) from liquid digestate. The study showed that the highest N uptake was done by C. indica (25.1%) which has the highest biomass increment as well (80.5%). Effluent quality improvement also shown by N removal by C. indica (68.5—76.4% TN), I. pseudacorus (61.8—71.3% TN), and T. latifolia (61.6—74.5%). This research proved that C. indica has the performance for the N uptake, best N removal efficiency, with a great growth rate as well. This system using C. indica could also improve the water quality of the effluent and add the aesthetic of environment.
NASA Astrophysics Data System (ADS)
Bradley, P. M.; Barber, L. B.; Duris, J. W.; Foreman, W. T.; Furlong, E. T.; Hubbard, L. E.; Hutchinson, K. J.; Keefe, S. H.; Kolpin, D. W.
2014-12-01
Wastewater pharmaceutical contamination of shallow groundwater is a substantial concern in effluent-dominated streams, due to aqueous mobility and designed bioactivity of pharmaceuticals and due to effluent-driven hydraulic gradients. Improved understanding of the environmental fate and transport of wastewater-derived pharmaceuticals is essential for effective protection of vital aquatic ecosystem services, environmental health, and drinking-water supplies. Substantial longitudinal (downstream) transport of pharmaceutical contaminants has been documented in effluent-impacted streams. The comparative lack of information on vertical and lateral transport (infiltration) of wastewater contaminants from surface-water to hyporheic and shallow groundwater compartments is a critical scientific data gap, given the potential for contamination of groundwater supplies in effluent-impacted systems. Growing dependencies on bank filtration and artificial recharge applications for release of wastewater to the environment and for pretreatment of poor-quality surface-water for drinking water emphasize the critical need to better understand the exchange of wastewater contaminants, like pharmaceuticals, between surface-water and groundwater compartments. The potential transport of effluent-derived pharmaceutical contaminants from surface-water to hyporheic-water and shallow groundwater compartments was examined in a wastewater-treatment-facility (WWTF) impacted stream in Ankeny, Iowa under effluent-dominated (71-99% of downstream flow) conditions. Strong hydraulic gradients and hydrologic connectivity were evident between surface-water and shallow-groundwater compartments in the vicinity of the WWTF outfall. Carbamazepine, sulfamethoxazole, and immunologically-related compounds were detected in groundwater 10-20 meters from the stream bank. Direct aqueous-injection HPLC-MS/MS revealed high percentage detections of pharmaceuticals (110 total analytes) in surface-water and groundwater samples. The results demonstrate the importance of effluent discharge as a driver of local hydrologic conditions in an effluent-impacted stream and thus as a fundamental control on surface-water to groundwater transport of effluent-derived pharmaceutical contaminants.
The relative efficiencies of a buffered beef extract solution, sewage secondary effluent, and distilled water, were compared in a study designed to simulate leaching of indigenous enteric viruses from raw primary sewage sludge. The initial sludge liquid fractions, termed sludge l...
Prakash, Jyotsana; Gupta, Rahul Kumar; Xx, Priyanka; Kalia, Vipin Chandra
2018-05-01
Biodiesel industrial effluent rich in crude glycerol (CG) was processed to produce value-added product. Under continuous culture system, Bacillus amyloliquefaciens strain CD16 immobilized within its biofilm, produced 3.2 L H 2 /day/L feed, over a period of 60 days at a hydraulic retention time of 2 days. The effective H 2 yield by B. amyloliquefaciens strain CD16 was 165 L/L CG. This H 2 yield was 1.18-fold higher than that observed with non-biofilm forming Bacillus thuringiensis strain EGU45. Bioprocessing of the effluent released after this stage, by recycling it up to 25% did not have any adverse effect on H 2 production by strain EGU45; however, a 25% reduction in yield was recorded with strain CD16. Biofilm forming H 2 producers thus proved effective as self-immobilizing system leading to enhanced process efficiency.
Identifying fluorescent pulp mill effluent in the Gulf of Maine and its watershed
Cawley, Kaelin M.; Butler, Kenna D.; Aiken, George R.; Larsen, Laurel G.; Huntington, Thomas G.; McKnight, Diane M.
2012-01-01
Using fluorescence spectroscopy and parallel factor analysis (PARAFAC) we characterized and modeled the fluorescence properties of dissolved organic matter (DOM) in samples from the Penobscot River, Androscoggin River, Penobscot Bay, and the Gulf of Maine (GoM). We analyzed excitation-emission matrices (EEMs) using an existing PARAFAC model (Cory and McKnight, 2005) and created a system-specific model with seven components (GoM PARAFAC). The GoM PARAFAC model contained six components similar to those in other PARAFAC models and one unique component with a spectrum similar to a residual found using the Cory and McKnight (2005) model. The unique component was abundant in samples from the Androscoggin River immediately downstream of a pulp mill effluent release site. The detection of a PARAFAC component associated with an anthropogenic source of DOM, such as pulp mill effluent, demonstrates the importance for rigorously analyzing PARAFAC residuals and developing system-specific models.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Brown, R.C.; Perkins, C.J.
1991-02-01
The 1301-N Liquid Waste Disposal Facility, located on the Hanford Site received N Reactor low-level radioactive liquid process effluent from 1962 to 1985. Radiation emanating from the top of the trench sections was not significant because of the sediments were normally under several meters of water, which provided the necessary shielding. Following retirement of the facility, the liquid in the trench sections percolated into the ground leaving the residual radioactively contaminated sediments unshielded along the bottom and sides of the trench sections. The radioactive constituents of the contaminated sediments include the gamma-emitting isotopes Co-60 and Cs-137. Because of the lackmore » of water covering, some of the gamma photons that were emitted upward were scattered downward due to Compton interaction with atmospheric constituents. This phenomenon is known as skyshine.'' A radiological characterization was required to provide guidance for determining the effectiveness of interim stabilization alternatives that would not adversely affect future Resource Conservation and Recovery Act site closure activities, (e.g., filling in trench sections with spoils from excavation activities). A noninvasive radiological characterization of this disposal facility and the affected area of the Columbia River shoreline was conducted. This characterization confirmed that skyshine is the cause of the elevated shoreline exposure rates and provided a model that could be used to rate the effectiveness of alternative interim stabilization measures. 4 refs., 5 figs.« less
Messman, J.D.; Rains, T.C.
1981-01-01
A liquid chromatography-atomic absorption spectrometry (LC-AAS) hybrid analytical technique is presented for metal speciation measurements on complex liquid samples. The versatility and inherent metal selectivity of the technique are Illustrated by the rapid determination of five tetraalkyllead compounds in commercial gasoline. Separation of the individual tetraalkyllead species is achieved by reversed-phase liquid chromatography using an acetonitrile/water mobile phase. The effluent from the liquid Chromatograph Is introduced directly into the aspiration uptake capillary of the nebulizer of an air/acetylene flame atomic absorption spectrometer. Spectral interferences due to coeluting hydrocarbon matrix constituents were not observed at the 283.3-nm resonance line of lead used for analysis. Detection limits of this LC-AAS hydrid analytical technique, based on a 20-??L injection, are approximately 10 ng Pb for each tetraalkyllead compound.
Federal Register 2010, 2011, 2012, 2013, 2014
2013-01-29
... Accidental Releases of Radioactive Materials From Liquid Waste Tanks in Ground and Surface Waters for... Radioactive Materials from Liquid Waste Tanks in Ground and Surface Waters for Combined License Applications... Radioactive Materials from Liquid Waste Tanks in Ground and Surface Waters for Combined License Applications...
Although Concentrated Animal Feeding Operations CAFOs) have been identified as potentially important sources for the release of estrogens into the environment, information is lacking on the concentrations of estrogens in whole lagoon effluents (including suspended solids)which ar...
Effects of Shock-Breakout Pressure on Ejection of Micron-Scale Material from Shocked Tin Surfaces
NASA Astrophysics Data System (ADS)
Zellner, Michael; Hammerberg, James; Hixson, Robert; Morley, Kevin; Obst, Andrew; Olson, Russell; Payton, Jeremy; Rigg, Paulo; Buttler, William; Grover, Michael; Iverson, Adam; Macrum, Gregory; Stevens, Gerald; Turley, William; Veeser, Lynn; Routley, Nathan
2007-06-01
Los Alamos National Lab (LANL) is actively engaged in the development of a model to predict the formation of micron-scale fragments ejected (ejecta) from shocked metal surfaces. The LANL ejecta model considers that the amount of ejecta is mainly related to the material's phase on shock release at the free-surface. This effort investigates the relation between ejecta production and shock-breakout pressure for Sn shocked with high explosives to pressures near the solid-on-release/partial-liquid-on-release phase transition region. We found that the amount of ejecta produced for shock-breakout pressures that resulted in partial-liquid-on-release increased significantly compared to that which resulted in solid-on-release. Additionally, we found that the amount of ejecta remained relatively constant within the partial-liquid-on-release, regardless of shock-breakout pressure.
Pressure Effects on the Ejection of Material from Shocked Tin Surfaces
NASA Astrophysics Data System (ADS)
Zellner, M. B.; Grover, M.; Hammerberg, J. E.; Hixson, R. S.; Iverson, A. J.; Macrum, G. S.; Morley, K. B.; Obst, A. W.; Olson, R. T.; Payton, J. R.; Rigg, P. A.; Routley, N.; Stevens, G. D.; Turley, W. D.; Veeser, L.; Buttler, W. T.
2007-12-01
Los Alamos National Lab (LANL) is actively engaged in the development of a model to predict the formation of micron-scale fragments ejected (ejecta) from shocked metals that have surface defects. The LANL ejecta model considers that the amount of ejecta is mainly related to the material's phase on shock release at the free-surface. This effort investigates the relation between ejecta production and shock-breakout pressure for Sn shocked with high explosives to pressures near the solid-on-release/partial-liquid-on-release phase transition region. We found that the amount of ejecta produced for shock-breakout pressures that resulted in partial-liquid-on-release increased significantly compared to that which resulted in solid-on-release. Additionally, we found that the amount of ejecta remained relatively constant within the partial-liquid-on-release, regardless of shock-breakout pressure.
Strategies for decolorization and detoxification of pulp and paper mill effluent.
Garg, Satyendra K; Tripathi, Manikant
2011-01-01
The potential hazards associated with industrial effluents, coupled with increasing awareness of environment problems, have prompted many countries to limit the indiscriminate discharge of untreated wastewaters. The pulp and paper industry has been among the most significant of industrial polluters of the waterways, and therefore has been one of the industries of concern. The pulp and paper industry produces large quantities of brown/black effluent that primarily result from pulping, bleaching, and paper-making production stages. The dark color and toxicity of pulp-paper mill effluent comes primarily from lignin and its chlorinated derivatives (e.g., lignosulphonic acid, resins, phenols, and hydrocarbons) that are released during various processing steps of lignocellulosic materials. The color originates from pulping and pulp bleaching stages, while adsorbable organic halides (AOX) originates exclusively from chlorine bleaching. Discharge of untreated effluent results in increased BOD/COD, slime growth, thermal problems, scum formation, discoloration, loss of aesthetic quality and toxicity to the aquatic life, in the receiving waterbodies. The dark brow color of pulp-paper effluent is not only responsible for aesthetic unacceptability, but also prevents the passage of sunlight through colored waterbodies. This reduces the photosynthetic activity of aquatic flora, ultimately causing depletion of dissolved oxygen. The pulp-paper organic waste, coupled with the presence of chlorine, results in the generation of highly chlorinated organic compounds. These toxic constituents of wastewater pose a human health risk through long term exposure. via drinking water and\\or through consumption of fish that can bioaccumulate certain pollutants from the food chain. Therefore, considerable attention has been focused by many countries on decolorization of paper mill effluents , along with reduction in the contaminants that pose human health or other environmental hazards. Various physicochemical remediation treatments in the pulp-paper industry are now used, or have been suggested, but often are not implemented, because of the high cost involved. More recently, the paper and pulp industry has been investigating the use of biological remediation steps to replace or augment current treatment strategies. Certain biological treatments offer opportunities to reduce cost (both capital and operating), reduce energy consumption, and minimize environmental impact. Two primary approaches may be effective to curtail release of toxic effluents: first, development of pulping and bleaching processes that emphasize improved oxygen delignification or biopulping, plus partial or complete replacement of chlorine treatment with hydrogen peroxide or with biobleaching; second, implementation of biological processing that involves sequential two-step anaerobic-aerobic or three-step aerobic-anaerobic treatment technologies at end of pipe. The selection of the specific process will depend upon the type of pollutants/toxicants/mutagens present in the effluent. The use of environmental-friendly technologies in the pulp and paper industry is becoming more popular, partly because of increasing regulation, and partly because of the availability of new techniques that can be used to economically deal with pollutants in the effluents. Moreover, biotechnology research methods are offering promise for even greater improvements in the future. The obvious ultimate goal of the industry and the regulators should be zero emission through recycling of industrial wastewater, or discharge of the bare minimum amount of toxicants or color.
5 CFR 351.605 - Liquidation provisions.
Code of Federal Regulations, 2010 CFR
2010-01-01
... FORCE Release From Competitive Level § 351.605 Liquidation provisions. When an agency will abolish all positions in a competitive area within 180 days, it must release employees in group and subgroup order...
5 CFR 351.605 - Liquidation provisions.
Code of Federal Regulations, 2011 CFR
2011-01-01
... FORCE Release From Competitive Level § 351.605 Liquidation provisions. When an agency will abolish all positions in a competitive area within 180 days, it must release employees in group and subgroup order...
Stewart, M H; Wolfe, R L; Means, E G
1990-01-01
Bacteriological analyses were performed on the effluent from a conventional water treatment pilot plant in which granular activated carbon (GAC) had been used as the final process to assess the impact of GAC on the microbial quality of the water produced. Samples were collected twice weekly for 160 days from the effluents of six GAC columns, each of which used one of four different empty-bed contact times (7.5, 15, 30, and 60 min). The samples were analyzed for heterotrophic plate counts and total coliforms. Effluent samples were also exposed to chloramines and free chlorine for 60 min (pH 8.2, 23 degrees C). Bacterial identifications were performed on the disinfected and nondisinfected effluents. Additional studies were conducted to assess the bacteriological activity associated with released GAC particles. The results indicated that heterotrophic plate counts in the effluents from all columns increased to 10(5) CFU/ml within 5 days and subsequently stabilized at 10(4) CFU/ml. The heterotrophic plate counts did not differ at different empty-bed contact times. Coliforms (identified as Enterobacter spp.) were recovered from the nondisinfected effluent on only two occasions. The disinfection results indicated that 1.5 mg of chloramines per liter inactivated approximately 50% more bacteria than did 1.0 mg of free chlorine per liter after 1 h of contact time. Chloramines and chlorine selected for the development of different bacterial species--Pseudomonas spp. and Flavobacterium spp., respectively.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:2082828
Wang, Shuo; Yu, Shui-Li; Shi, Wen-Xin; Bao, Rui-Ling; Yi, Xue-Song; Li, Jian-Zheng
2012-04-01
COD decreased obviously in normal molasses wastewater after anaerobic treatment, however, concentrations of nitrogen and phosphorus were still higher in the effluent which seriously damaged the ecological balance. In this study, aerobic granules cultivated in sequencing batch airlift reactor (SBAR) were carried out for treating the effluent; phosphorus removal processes and characteristics were discussed as well. The mean diameter of aerobic granules cultivated by multiple carbon sources (acetate, propionate and butyrate) was 1.7 mm. The average phosphorus removal efficiency was 90.9% and the level of phosphorus in effluent was only 1.3 mg x L(-1); TP released per COD consumed was 0.571 and the specific rate of TP released was 5.73 mg x (g x h)(-1). NO3(-) -N usage of phosphorus accumulating organisms (PAOs) improved during denitrifying process because the concentration of propionate and butyrate increased in multiple carbon sources which means the phosphorus uptake efficiency increased when per NO3(-) -N consumed. Phosphorus content represented a stronger correlation with magnesium, calcium and ferrum contents in aerobic granules and their extracellular polymeric substances (EPS), the phosphorus adsorption by EPS could enhance phosphorus removal. 61.9% of phosphorus accumulating organisms were denitrifying phosphorus accumulating organisms in aerobic granules and TP uptake per NO3(-) -N consumed was 1.14 which was higher than that of aerobic granules only cultivated by acetate.
NASA Astrophysics Data System (ADS)
Lee, Hyo Jin; Kim, Gi Beum
2017-06-01
Wastewater treatment plants (WWTPs) play an important role in minimizing the release of many pollutants into the environment. Nineteen congeners in two WWTPs in Korea were determined to investigate the occurrence and fate of polybrominated diphenyl ethers (PBDEs) during wastewater treatment processes. The concentration of total PBDEs was 69.6 and 183 ng/L in influent, which declined to 1.59 and 2.34 ng/L in the final effluent, respectively (Tongyeong and Jinhae WWTPs). PBDEs were found to exist mostly in the particulate phase of wastewater, which rendered sedimentation efficient for the removal of PBDEs. BDE-209 was the predominant congener in the influent and sludge. Most of the PBDEs entering the WWTPs presumably ended up in the sludge, with < 2% being discharged with the final effluent. According to the mass loading estimation, every day 2.55-9.29 g PBDEs entered the two WWTPs, 2.8-10.4 g were disposed to landfill sites in sludge form and 0.06-0.12 g were discharged to the surrounding water through final effluent, respectively. Preliminary results indicated that the ecological risk to organisms in soil exposed to PBDEs through the usage of sludge application to agricultural land was relatively low. To our knowledge, this study is the first to report on the removal efficiency of PBDEs in a WWTP in Korea.
van Berlo, C L; de Jonge, H R; van den Bogaard, A E; van Eijk, H M; Janssen, M A; Soeters, P B
1987-09-01
In recent hypotheses concerning the pathogenesis of hepatic encephalopathy, gamma-aminobutyric acid (GABA) is claimed to be produced by the colonic flora, although enzymes necessary to generate GABA have been reported to be present in intestinal mucosa. In this study, using normal and germ-free Wistar rats, we determined GABA levels and amino-grams of arterial blood and of venous effluent from small and large bowel. The data indicate that large and small intestinal mucosa significantly contribute to GABA production. In the fasted state GABA concentrations are greater in the venous effluent of the small bowel than in the venous effluent of the large bowel. Feeding increases the arterioportal differences, and uptake in the small bowel is still significantly higher than in the large bowel. This process is not, or can only be to a minor degree, bacterially mediated, because GABA production in the gut both in the fed and fasted state is of similar magnitude in germ-free and normal animals. gamma-Aminobutyric acid release correlates significantly with glutamine uptake in the small bowel of fasted rats. Only a small fraction of the glutamine taken up is needed to account for GABA release, so that conclusions concerning which amino acids may serve as precursors of GABA cannot be drawn. Further studies are needed to delineate the metabolic pathways leading to GABA synthesis.
White, J R; Gardner, L M; Sees, M; Corstanje, R
2008-01-01
Nutrient removal by constructed wetlands can decline over time due to the accumulation of organic matter. A prescribed burn is one of many management strategies used to remove detritus in macrophyte-dominated systems. We quantified the short-term effects on effluent water quality and the amount of aboveground detritus removed from a prescribed burn event. Surface water outflow concentrations were approximately three times higher for P and 1.5 times higher for total Kjeldhal nitrogen (TKN) following the burn event when compared to the control. The length of time over which the fire effect was significant (P < 0.05), 3 d for TKN and up to 23 d for P fractions. Over time, the concentration of soluble reactive phosphorus (SRP) in the effluent decreased, but was compensated with increases in dissolved organic phosphorus (DOP) and particulate phosphorus (PP), such that net total P remained the same. Total aboveground biomass decreased by 68.5% as a result of the burn, however, much of the live vegetation was converted to standing dead material. These results demonstrate that a prescribed burn can significantly decrease the amount of senescent organic matter in a constructed wetland. However, short-term nutrient releases following the burn could increase effluent nutrient concentrations. Therefore, management strategies should include hydraulically isolating the burned area immediately following the burn event to prevent nutrient export.
Estracanholli, Eder André; Praça, Fabíola Silva Garcia; Cintra, Ana Beatriz; Pierre, Maria Bernadete Riemma; Lara, Marilisa Guimarães
2014-12-01
Liquid crystalline systems of monoolein/water could be a promising approach for the delivery of celecoxib (CXB) to the skin because these systems can sustain drug release, improve drug penetration into the skin layers and minimize side effects. This study evaluated the potential of these systems for the delivery of CXB into the skin based on in vitro drug release and skin permeation studies. The amount of CXB that permeated into and/or was retained in the skin was assayed using an HPLC method. Polarizing light microscopy studies showed that liquid crystalline systems of monoolein/water were formed in the presence of CXB, without any changes in the mesophases. The liquid crystalline systems decreased drug release when compared to control solution. Drug release was independent of the initial water content of the systems and CXB was released from cubic phase systems, irrespective of the initial water content. The systems released the CXB following zero-order release kinetics. In vitro drug permeation studies showed that cubic phase systems allowed drug permeation and retention in the skin layers. Cubic phase systems of monoolein/water may be promising vehicles for the delivery of CXB in/through the skin because it improved CXB skin permeation compared with the control solution.
Small-scale experimental study of vaporization flux of liquid nitrogen released on water.
Gopalaswami, Nirupama; Olewski, Tomasz; Véchot, Luc N; Mannan, M Sam
2015-10-30
A small-scale experimental study was conducted using liquid nitrogen to investigate the convective heat transfer behavior of cryogenic liquids released on water. The experiment was performed by spilling five different amounts of liquid nitrogen at different release rates and initial water temperatures. The vaporization mass fluxes of liquid nitrogen were determined directly from the mass loss measured during the experiment. A variation of initial vaporization fluxes and a subsequent shift in heat transfer mechanism were observed with changes in initial water temperature. The initial vaporization fluxes were directly dependent on the liquid nitrogen spill rate. The heat flux from water to liquid nitrogen determined from experimental data was validated with two theoretical correlations for convective boiling. It was also observed from validation with correlations that liquid nitrogen was found to be predominantly in the film boiling regime. The substantial results provide a suitable procedure for predicting the heat flux from water to cryogenic liquids that is required for source term modeling. Copyright © 2015 Elsevier B.V. All rights reserved.
High wettability of liquid caesium iodine with solid uranium dioxide.
Kurosaki, Ken; Suzuki, Masanori; Uno, Masayoshi; Ishii, Hiroto; Kumagai, Masaya; Anada, Keito; Murakami, Yukihiro; Ohishi, Yuji; Muta, Hiroaki; Tanaka, Toshihiro; Yamanaka, Shinsuke
2017-09-13
In March 2011, the Fukushima Daiichi Nuclear Power Plant accident caused nuclear fuel to melt and the release of high-volatility fission products into the environment. Caesium and iodine caused environmental contamination and public exposure. Certain fission-product behaviours remain unclear. We found experimentally that liquid CsI disperses extremely favourably toward solid UO 2 , exhibiting a contact angle approaching zero. We further observed the presence of CsI several tens of micrometres below the surface of the solid UO 2 sample, which would be caused by the infiltration of pores network by liquid CsI. Thus, volatile fission products released from molten nuclear fuels with complex internal composition and external structure migrate or evaporate to varying extents, depending on the nature of the solid-liquid interface and the fuel material surface, which becomes the pathway for the released fission products. Introducing the concept of the wettability of liquid chemical species of fission products in contact with solid fuels enabled developing accurate behavioural assessments of volatile fission products released by nuclear fuel.
Herrmann, Andreas; Giuseppone, Nicolas; Lehn, Jean-Marie
2009-01-01
Application of an electric field to liquid crystalline film forming imines with negative dielectric anisotropy, such as N-(4-methoxybenzylidene)-4-butylaniline (MBBA, 1), results in the expulsion of compounds that do not participate in the formation of the liquid crystalline phase. Furthermore, amines and aromatic aldehydes undergo component exchange with the imine by generating constitutional dynamic libraries. The strength of the electric field and the duration of its application to the liquid crystalline film influence the release rate of the expelled compounds and, at the same time, modulate the equilibration of the dynamic libraries. The controlled release of volatile organic molecules with different chemical functionalities from the film was quantified by dynamic headspace analysis. In all cases, higher headspace concentrations were detected in the presence of an electric field. These results point to the possibility of using imine-based liquid crystalline films to build devices for the controlled release of a broad variety of bioactive volatiles as a direct response to an external electric signal.
NASA Astrophysics Data System (ADS)
Heerspink, B. P.; Wang, D.; Ware, D.; Marina, O.; Perkins, G.; WoldeGabriel, G. W.; Goering, T.; Boukhalfa, H.
2017-12-01
High-explosive compounds including hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) were used extensively in weapons research and testing at Los Alamos National Laboratory (LANL) in Los Alamos, NM. Liquid effluents containing RDX released at LANL's Technical Area 16 (TA-16) resulted in the contamination of alluvial, perched-intermediate, and regional groundwater bodies. Past investigations have shown persistent RDX contamination in the perched-intermediate zone located between 225 to 311 m below ground surface, where transport studies have shown that RDX and its degradation products transport conservatively. In this study, we compared RDX degradation by chemical treatments using reduction by sodium dithionite, oxidation by potassium permanganate, and alkaline hydrolysis by carbonate/bicarbonate buffering, with microbial degradation under biostimulated conditions. The experiments were conducted using groundwater and sediments representative of the contaminated aquifer beneath TA-16. Batch testing showed that all chemical treatments degraded RDX very rapidly, with half-lives ranging from 50 minutes to 22 hours. Comparatively, RDX degradation in biostimulated reactors under strict anaerobic conditions was significantly slower, with half-lives of about 3 weeks. Results from column experiments with chemically treated sediments deviated from the results of the batch testing. Dithionite treated sediments reduced RDX with no breakthrough observed before clogging occurred at 50 pour volumes. Treatments by oxidation using potassium permanganate, and hydrolysis under buffered alkaline conditions, were less effective with complete RDX breakthrough after 2 pore volumes. No known degradation products were observed in the column effluents. RDX degradation in biostimulated columns was very effective initially for both treatments. However, the column biostimulated with safflower oil clogged very rapidly. The column biostimulated with molasses was very effective when molasses was continuously supplied but less effective after molasses injection stopped. Degradation products (hexahydro-1-nitroso-3,5-dinitro-1,3,5-triazine [MNX]; hexahydro-1,3-dinitro-5-nitro-1,3,5-triazine [DNX]; 2,4,6-trinitroxylene [TNX]) were visible in the effluents from the biostimulated columns.
Okwuosa, Tochukwu C; Soares, Cindy; Gollwitzer, Verena; Habashy, Rober; Timmins, Peter; Alhnan, Mohamed A
2018-06-15
A method for the production of liquid capsules with the potential of modifying drug dose and release is presented. For the first time, the co-ordinated use of fused deposition modelling (FDM), 3D printing and liquid dispensing to fabricate individualised dosage form on demand in a fully automated fashion has been demonstrated. Polymethacrylate shells (Eudragit EPO and RL) for immediate and extended release were fabricated using FDM 3D printing and simultaneously filled using a computer-controlled liquid dispenser loaded with model drug solution (theophylline) or suspension (dipyridamole). The impact of printing modes: simultaneous shell printing and filling (single-phase) or sequential 3D printing of shell bottom, filling and shell cap (multi-phase), nozzle size, syringe volume, and shell structure has been reported. The use of shell thickness of 1.6 mm, and concentric architecture allowed successful containment of liquid core whilst maintaining the release properties of the 3D printed liquid capsule. The linear relationship between the theoretical and the actual volumes from the dispenser reflected its potential for accurate dosing (R 2 = 0.9985). Modifying the shell thickness of Eudragit RL capsule allowed a controlled extended drug release without the need for formulation change. Owing to its low cost and versatility, this approach can be adapted to wide spectrum of liquid formulations such as small and large molecule solutions and obviate the need for compatibility with the high temperature of FDM 3D printing process. In a clinical setting, health care staff will be able to instantly manufacture in small volumes liquid capsules with individualised dose contents and release pattern in response to specific patient's needs. Copyright © 2018 Elsevier B.V. All rights reserved.
Experimental Study on Ice Forming Process of Cryogenic Liquid Releasing underwater
NASA Astrophysics Data System (ADS)
Zhang, Bin; Wu, Wanqing; Zhang, Xingdong; Zhang, Yi; Zhang, Chuanlin; Zhang, Haoran; Wang, Peng
2017-11-01
Cryogenic liquid releasing into water would be a process combines hyperactive boiling with ice forming. There are still few researches on the experimental study on the environmental conditions for deciding ice forming speed and liquid surviving state. In this paper, to advance our understanding of ice forming deciding factors in the process of LN2 releasing underwater, a visualization experimental system is built. The results show that the pressure difference significantly influences the ice forming speed and liquid surviving distance, which is observed by the experiment and theoretically analysed by Kelvin-Helmholtz instability. Adding nucleating agent is helpful to provide ice nucleus which can accelerate the ice forming speed. Water flowing has some effect on changing pressure difference, which can affect the ice forming speed and liquid surviving distance.
Phenol wastewater remediation: advanced oxidation processes coupled to a biological treatment.
Rubalcaba, A; Suárez-Ojeda, M E; Stüber, F; Fortuny, A; Bengoa, C; Metcalfe, I; Font, J; Carrera, J; Fabregat, A
2007-01-01
Nowadays, there are increasingly stringent regulations requiring more and more treatment of industrial effluents to generate product waters which could be easily reused or disposed of to the environment without any harmful effects. Therefore, different advanced oxidation processes were investigated as suitable precursors for the biological treatment of industrial effluents containing phenol. Wet air oxidation and Fenton process were tested batch wise, while catalytic wet air oxidation and H2O2-promoted catalytic wet air oxidation processes were studied in a trickle bed reactor, the last two using over activated carbon as catalyst. Effluent characterisation was made by means of substrate conversion (using high liquid performance chromatography), chemical oxygen demand and total organic carbon. Biodegradation parameters (i.e. maximum oxygen uptake rate and oxygen consumption) were obtained from respirometric tests using activated sludge from an urban biological wastewater treatment plant (WWTP). The main goal was to find the proper conditions in terms of biodegradability enhancement, so that these phenolic effluents could be successfully treated in an urban biological WWTP. Results show promising research ways for the development of efficient coupled processes for the treatment of wastewater containing toxic or biologically non-degradable compounds.
Development of an analytical method for the determination of anthracyclines in hospital effluents.
Mahnik, Susanne N; Rizovski, Blanka; Fuerhacker, Maria; Mader, Robert M
2006-11-01
Little is known about the fate of cytostatics after their elimination from humans into the environment. Being often very toxic compounds, their quantification in hospital effluents may be necessary to individualise the putative magnitude of pollution problems. We therefore developed a method for the determination of the very important group of anthracyclines (doxorubicin, epirubicin, and daunorubicin) in hospital effluents. Waste water samples were enriched by solid phase extraction (concentration factor 100), analysed by reversed-phase high performance liquid chromatography (RP-HPLC), and monitored by fluorescence detection. This method is reproducible and accurate within a range of 0.1-5 micro g l(-1) for all compounds (limits of quantification: 0.26-0.29 micro g l(-1) ; recoveries >80%). The applicability of the method was proven by chemical analysis of hospital sewage samples (range: 0.1-1.4 micro g l(-1) epirubicin and 0.1-0.5 micro g l(-1) doxorubicin). Obtained over a time period of one month, the results were in line with those calculated by an input-output model. These investigations show that the examined cytostatics are easily detectable and that the presented method is suitable to estimate the dimension of pharmaceutical contamination originating from hospital effluents.
Viancelli, A; Kunz, A; Steinmetz, R L R; Kich, J D; Souza, C K; Canal, C W; Coldebella, A; Esteves, P A; Barardi, C R M
2013-01-01
Swine effluents must be correctly handled to avoid negative environmental impacts. In this study, the profiles of two swine manure treatment systems were evaluated: a solid-liquid separation step, followed by an anaerobic reactor, and an aerobic step (System 1); and a biodigester followed by serial lagoons (System 2). Both systems were described by the assessment of chemical, bacterial and viral parameters. The results showed that in System 1, there was reduction of chemicals (COD, phosphorus, total Kjeldhal nitrogen - TKN - and NH(3)), total coliforms and Escherichia coli; however, the same reduction was not observed for Salmonella sp. Viral particles were significantly reduced but not totally eliminated from the effluent. In System 2, there was a reduction of chemicals, bacteria and viruses with no detection of Salmonella sp., circovirus, parvovirus, and torque teno virus in the effluent. The chemical results indicate that the treated effluent can be reused for cleaning swine facilities. However, the microbiological results show a need of additional treatment to achieve a complete inactivation for cases when direct contact with animals is required. Copyright © 2012 Elsevier Ltd. All rights reserved.
Kumar, Anuj; Priyadarshinee, Rashmi; Roy, Abhishek; Dasgupta, Dalia; Mandal, Tamal
2016-12-01
Rice mills release huge volumes of wastewater and other by-products when processing paddy rice. The wastewater often contains toxic inorganic and organic contaminants which cause environmental damage when released. Accordingly, cost-effective techniques for removing contaminants are needed. This article reviews current processes for curbing pollution and also reusing and recycling waste products. Novel techniques exist for converting waste products into energy and value-added products. Copyright © 2016 Elsevier Ltd. All rights reserved.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Anspaugh, L. R.; Napier, Bruce A.
2009-10-23
This brief report documents the selection of parameters needed to support individual-dose calculations from 131I released into the environment with gaseous effluents from the Mayak Production Association.
EFFECTS OF ETHYNYL ESTRADIOL EXPOSURE ON REPRODUCTIVE PARAMETERS IN AN ESTUARINE FISH
This study investigated the impact of ethynyl estradiol (EE2) on reproductive success of cunner, Tautogolabrus adspersus. EE2 is the estrogen used in human contraceptives and is released into the aquatic environment in sewage treatment effluent. Reproductively active male and fem...
Although Concentrated Animal Feeding Operations (CAFOs) have been identified as potentially important sources for the release of estrogens into the environment, information is lacking on the concentrations of estrogens in whole lagoon effluents (including suspended solids) which ...
Luo, Zhe; Zhou, Guang-Jie; Liu, Hong-Bo; Nie, Xin-Yu; Chen, Yu; Zhai, Li-Qin; Liu, He
2015-03-01
In order to explore the possibility of enhanced nitrogen and phosphorus removal in wastewater using sludge anaerobic fermentation liquid as external carbon source, the present study proposed an A2/O reactor system with a total effective volume of 4 660 L and real municipal wastewater for treatment. The results showed that under the conditions of the influent COD at 243.7 mg x L(-1), NH4(+) -N at 30. 9 mg x L(-1), TN at 42.9 mg'L- , TP at 2.8 mg x L(-1), the backflow ratio of nitrification liquid at 200% and recycle ratio of sludge at 100%, the addition of acetic acid into anoxic tank could enhance the removal efficiency of nitrogen and phosphorus, and the optimal influent quantity and SCOD incremental of carbon were 7 500 L x d(-1) and 50 mg L(-1), respectively. When the sludge fermentation liquid was used as external carbon source and the average effluent COD, NH4(+) -N, TN, TP removal efficiency were 81.60%, 88.91%, 64.86% and 87.61%, the effluent concentrations were 42.18, 2.77, 11.92 and 0.19 mg x L(-1), respectively, which met China's first Class (A) criteria specified in the Discharge Standard Urban Sewage Treatment Plant Pollutant (GB 18918-2002). The results of the present study demonstrated that the addition of sludge anaerobic fermented liquid as external carbon source was a feasible way to enhance the removal of nitrogen and phosphorous in municipal wastewater, providing a new feasible strategy for the reuse and recycle of sewage sludge in China.
Components of released liquid from ultrasonic waste activated sludge disintegration.
Wang, Fen; Lu, Shan; Ji, Min
2006-05-01
Ultrasound can be applied as a pretreatment to disintegrate sludge. In this paper, by observing the solution concentration of polysaccharide, protein, DNA, Ca and Mg before and after disintegration, the main components in the released liquid are analyzed. It has been found that the predominant component of the released liquid in this research is protein. Ultrasound can destroy the extracellular polymeric substances (EPS), which is important to the sludge flocs structure. Ca2+ and Mg2+, which play a key role in binding the EPS are released into the aqueous phase. As a result, the sludge flocs are loosened. Under the effect of the hydraulic shear force, the sludge is disintegrated. Then the hydraulic shear forces destroy the cell walls, the substances inside the cells are released into the aqueous phase.
High air volume to low liquid volume aerosol collector
Masquelier, Donald A.; Milanovich, Fred P.; Willeke, Klaus
2003-01-01
A high air volume to low liquid volume aerosol collector. A high volume flow of aerosol particles is drawn into an annular, centripetal slot in a collector which directs the aerosol flow into a small volume of liquid pool contained is a lower center section of the collector. The annular jet of air impinges into the liquid, imbedding initially airborne particles in the liquid. The liquid in the pool continuously circulates in the lower section of the collector by moving to the center line, then upwardly, and through assistance by a rotating deflector plate passes back into the liquid at the outer area adjacent the impinging air jet which passes upwardly through the liquid pool and through a hollow center of the collector, and is discharged via a side outlet opening. Any liquid droplets escaping with the effluent air are captured by a rotating mist eliminator and moved back toward the liquid pool. The collector includes a sensor assembly for determining, controlling, and maintaining the level of the liquid pool, and includes a lower centrally located valve assembly connected to a liquid reservoir and to an analyzer for analyzing the particles which are impinged into the liquid pool.
Effect of Ozone Treatment on Nano-Sized Silver Sulfide in Wastewater Effluent.
Thalmann, Basilius; Voegelin, Andreas; von Gunten, Urs; Behra, Renata; Morgenroth, Eberhard; Kaegi, Ralf
2015-09-15
Silver nanoparticles used in consumer products are likely to be released into municipal wastewater. Transformation reactions, most importantly sulfidation, lead to the formation of nanoscale silver sulfide (nano-Ag2S) particles. In wastewater treatment plants (WWTP), ozonation can enhance the effluent quality by eliminating organic micropollutants. The effect of ozonation on the fate of nano-Ag2S, however, is currently unknown. In this study, we investigate the interaction of ozone with nano-Ag2S and evaluate the effect of ozonation on the short-term toxicity of WWTP effluent spiked with nano-Ag2S. The oxidation of nano-Ag2S by ozone resulted in a stoichiometric factor (number of moles of ozone required to oxidize one mole of sulfide to sulfate) of 2.91, which is comparable to the results obtained for the reaction of bisulfide (HS(-)) with ozone. The second-order rate constant for the reaction of nano-Ag2S with ozone (k = 3.1 × 10(4) M(-1) s(-1)) is comparable to the rate constant of fast-reacting micropollutants. Analysis of the ozonation products of nano-Ag2S by transmission electron microscopy (TEM) and X-ray absorption spectroscopy (XAS) revealed that ozonation dominantly led to the formation of silver chloride in WWTP effluent. After ozonation of the Ag2S-spiked effluent, the short-term toxicity for the green algae Chlamydomonas reinhardtii increased and reached EC50 values comparable to Ag(+). This study thus reveals that ozone treatment of WWTP effluent results in the oxidation of Ag2S and, hence, an increase of the Ag toxicity in the effluent, which may become relevant at elevated Ag concentrations.
Razak, Okine Abdul; Masaaki, Hanada; Yimamu, Aibibula; Meiji, Okamoto
2012-04-01
The role of moisture absorptive capacity of pre-silage material and its relationship with silage effluent in high moisture by-product feedstuffs (HMBF) is assessed. The term water retention capacity which is sometimes used in explaining the rate of effluent control in ensilage may be inadequate, since it accounts exclusively for the capacity of an absorbent incorporated into a pre-silage material prior to ensiling, without consideration to how much the pre-silage material can release. A new terminology, 'potential water retention capacity' (PWRC), which attempts to address this shortcoming, is proposed. Data were pooled from a series of experiments conducted separately over a period of five years using laboratory silos with four categories of agro by-products (n = 27) with differing moisture contents (highest 96.9%, lowest 78.1% in fresh matter, respectively), and their silages (n = 81). These were from a vegetable source (Daikon, Raphanus sativus), a root tuber source (potato pulp), a fruit source (apple pomace) and a cereal source (brewer's grain), respectively. The pre-silage materials were adjusted with dry in-silo absorbents consisting wheat straw, wheat or rice bran, beet pulp and bean stalks. The pooled mean for the moisture contents of all pre-silage materials was 78.3% (±10.3). Silage effluent decreased (p<0.01), with increase in PWRC of pre-silage material. The theoretical moisture content and PWRC of pre-silage material necessary to stem effluent flow completely in HMBF silage was 69.1% and 82.9 g/100 g in fresh matter, respectively. The high correlation (r = 0.76) between PWRC of ensiled material and silage effluent indicated that the latter is an important factor in silage-effluent relationship.
Razak, Okine Abdul; Masaaki, Hanada; Yimamu, Aibibula; Meiji, Okamoto
2012-01-01
The role of moisture absorptive capacity of pre-silage material and its relationship with silage effluent in high moisture by-product feedstuffs (HMBF) is assessed. The term water retention capacity which is sometimes used in explaining the rate of effluent control in ensilage may be inadequate, since it accounts exclusively for the capacity of an absorbent incorporated into a pre-silage material prior to ensiling, without consideration to how much the pre-silage material can release. A new terminology, ‘potential water retention capacity’ (PWRC), which attempts to address this shortcoming, is proposed. Data were pooled from a series of experiments conducted separately over a period of five years using laboratory silos with four categories of agro by-products (n = 27) with differing moisture contents (highest 96.9%, lowest 78.1% in fresh matter, respectively), and their silages (n = 81). These were from a vegetable source (Daikon, Raphanus sativus), a root tuber source (potato pulp), a fruit source (apple pomace) and a cereal source (brewer’s grain), respectively. The pre-silage materials were adjusted with dry in-silo absorbents consisting wheat straw, wheat or rice bran, beet pulp and bean stalks. The pooled mean for the moisture contents of all pre-silage materials was 78.3% (±10.3). Silage effluent decreased (p<0.01), with increase in PWRC of pre-silage material. The theoretical moisture content and PWRC of pre-silage material necessary to stem effluent flow completely in HMBF silage was 69.1% and 82.9 g/100 g in fresh matter, respectively. The high correlation (r = 0.76) between PWRC of ensiled material and silage effluent indicated that the latter is an important factor in silage-effluent relationship. PMID:25049587
Reversed-phase high-performance liquid chromatography of sulfur mustard in water
DOE Office of Scientific and Technical Information (OSTI.GOV)
Raghuveeran, C.D.; Malhotra, R.C.; Dangi, R.S.
1993-01-01
A reversed-phase high-performance liquid chromatography method for the detection and quantitation of sulfur mustard (HD) in water is described with detection at 200 nm. The detection based on the solubility of HD in water revealed that extremely low quantities of HD (4 to 5 mg/L) only are soluble. Experience shows that water is still the medium of choice for the analysis of HD in water and aqueous effluents in spite of the minor handicap of its half-life of ca. 4 minutes, which only calls for speedy analysis.
Role of membrane fouling substances on the rejection of N-nitrosamines by reverse osmosis.
Fujioka, Takahiro; Kodamatani, Hitoshi; Aizawa, Hidenobu; Gray, Stephen; Ishida, Kenneth P; Nghiem, Long D
2017-07-01
The impact of fouling substances on the rejection of four N-nitrosamines by a reverse osmosis (RO) membrane was evaluated by characterizing individual organic fractions in a secondary wastewater effluent and deploying a novel high-performance liquid chromatography-photochemical reaction-chemiluminescence (HPLC-PR-CL) analytical technique. The HPLC-PR-CL analytical technique allowed for a systematic examination of the correlation between the fouling level and the permeation of N-nitrosamines in the secondary wastewater effluent and synthetic wastewaters through an RO membrane. Membrane fouling caused by the secondary wastewater effluent led to a notable decrease in the permeation of N-nitrosodimethylamine (NDMA) while a smaller but nevertheless discernible decrease in the permeation of N-nitrosomethylethylamine (NMEA), N-nitrosopyrrolidine (NPYR) and N-nitrosomorpholine (NMOR) was also observed. Fluorescence spectrometry analysis revealed that major foulants in the secondary wastewater effluent were humic and fulvic acid-like substances. Analysis using the size exclusion chromatography technique also identified polysaccharides and proteins as additional fouling substances. Thus, further examination was conducted using solutions containing model foulants (i.e., sodium alginate, bovine serum albumin, humic acid and two fulvic acids). Similar to the secondary wastewater effluent, membrane fouling with fulvic acid solutions resulted in a decrease in N-nitrosamine permeation. In contrast, membrane fouling with the other model foulants resulted in a negligible impact on N-nitrosamine permeation. Overall, these results suggest that the impact of fouling on the permeation of N-nitrosamines by RO is governed by specific small organic fractions (e.g. fulvic acid-like organics) in the secondary wastewater effluent. Copyright © 2017 Elsevier Ltd. All rights reserved.
Tritium monitor and collection system
Bourne, G.L.; Meikrantz, D.H.; Ely, W.E.; Tuggle, D.G.; Grafwallner, E.G.; Wickham, K.L.; Maltrud, H.R.; Baker, J.D.
1992-01-14
This system measures tritium on-line and collects tritium from a flowing inert gas stream. It separates the tritium from other non-hydrogen isotope contaminating gases, whether radioactive or not. The collecting portion of the system is constructed of various zirconium alloys called getters. These alloys adsorb tritium in any of its forms at one temperature and at a higher temperature release it as a gas. The system consists of four on-line getters and heaters, two ion chamber detectors, two collection getters, and two guard getters. When the incoming gas stream is valved through the on-line getters, 99.9% of it is adsorbed and the remainder continues to the guard getter where traces of tritium not collected earlier are adsorbed. The inert gas stream then exits the system to the decay chamber. Once the on-line getter has collected tritium for a predetermined time, it is valved off and the next on-line getter is valved on. Simultaneously, the first getter is heated and a pure helium purge is employed to carry the tritium from the getter. The tritium loaded gas stream is then routed through an ion chamber which measures the tritium activity. The ion chamber effluent passes through a collection getter that readsorbs the tritium and is removable from the system once it is loaded and is then replaced with a clean getter. Prior to removal of the collection getter, the system switches to a parallel collection getter. The effluent from the collection getter passes through a guard getter to remove traces of tritium prior to exiting the system. The tritium loaded collection getter, once removed, is analyzed by liquid scintillation techniques. The entire sequence is under computer control except for the removal and analysis of the collection getter. 7 figs.
Analysis of Process Gases and Trace Contaminants in Membrane-Aerated Gaseous Effluent Streams.
NASA Technical Reports Server (NTRS)
Coutts, Janelle L.; Lunn, Griffin Michael; Meyer, Caitlin E.
2015-01-01
In membrane-aerated biofilm reactors (MABRs), hollow fibers are used to supply oxygen to the biofilms and bulk fluid. A pressure and concentration gradient between the inner volume of the fibers and the reactor reservoir drives oxygen mass transport across the fibers toward the bulk solution, providing the fiber-adhered biofilm with oxygen. Conversely, bacterial metabolic gases from the bulk liquid, as well as from the biofilm, move opposite to the flow of oxygen, entering the hollow fiber and out of the reactor. Metabolic gases are excellent indicators of biofilm vitality, and can aid in microbial identification. Certain gases can be indicative of system perturbations and control anomalies, or potentially unwanted biological processes occurring within the reactor. In confined environments, such as those found during spaceflight, it is important to understand what compounds are being stripped from the reactor and potentially released into the crew cabin to determine the appropriateness or the requirement for additional mitigation factors. Reactor effluent gas analysis focused on samples provided from Kennedy Space Center's sub-scale MABRs, as well as Johnson Space Center's full-scale MABRs, using infrared spectroscopy and gas chromatography techniques. Process gases, such as carbon dioxide, oxygen, nitrogen, nitrogen dioxide, and nitrous oxide, were quantified to monitor reactor operations. Solid Phase Microextraction (SPME) GC-MS analysis was used to identify trace volatile compounds. Compounds of interest were subsequently quantified. Reactor supply air was examined to establish target compound baseline concentrations. Concentration levels were compared to average ISS concentration values and/or Spacecraft Maximum Allowable Concentration (SMAC) levels where appropriate. Based on a review of to-date results, current trace contaminant control systems (TCCS) currently on board the ISS should be able to handle the added load from bioreactor systems without the need for secondary mitigation.
Zamalloa, Carlos; De Vrieze, Jo; Boon, Nico; Verstraete, Willy
2012-01-01
The biomass of industrially grown Phaeodactylum tricornutum was subjected in a novel way to bio-methanation at 33°C, i.e., in an anaerobic membrane bioreactor (AnMBR) at a hydraulic retention time of 2.5 days, at solid retention times of 20 to 10 days and at loading rates in the range of 2.6-5.9 g biomass-COD L(-1) day(-1) with membrane fluxes ranging from 1 to 0.8 L m(-2) h(-1). The total COD recovered as biogas was in the order of 52%. The input suspension was converted to a clear effluent rich in total ammonium nitrogen (546 mg TAN L(-1)) and phosphate (141 mg PO(4)-P L(-1)) usable as liquid fertilizer. The microbial community richness, dynamics, and organization in the reactor were interpreted using the microbial resource management approach. The AnMBR communities were found to be moderate in species richness and low in dynamics and community organization relative to UASB and conventional CSTR sludges. Quantitative polymerase chain reaction analysis revealed that Methanosaeta sp. was the dominant acetoclastic methanogen species followed by Methanosarcina sp. This work demonstrated that the use of AnMBR for the digestion of algal biomass is possible. The fact that some 50% of the organic matter is not liquefied means that the algal particulates in the digestate constitute a considerable fraction which should be valorized properly, for instance as slow release organic fertilizer. Overall, 1 kg of algae dry matter (DM) could be valorized in the form of biogas ( euro 2.07), N and P in the effluent (euro 0.02) and N and P in the digestate (euro 0.04), thus totaling about euro 2.13 per kilogram algae DM.
Nanopore reactive adsorbents for the high-efficiency removal of waste species
Yang, Arthur Jing-Min; Zhang, Yuehua
2005-01-04
A nanoporous reactive adsorbent incorporates a relatively small number of relatively larger reactant, e.g., metal, enzyme, etc., particles (10) forming a discontinuous or continuous phase interspersed among and surrounded by a continuous phase of smaller adsorbent particles (12) and connected interstitial pores (14) therebetween. The reactive adsorbent can effectively remove inorganic or organic impurities in a liquid by causing the liquid to flow through the adsorbent. For example, silver ions may be adsorbed by the adsorbent particles (12) and reduced to metallic silver by reducing metal, such as ions, as the reactant particles (10). The column can be regenerated by backwashing with the liquid effluent containing, for example, acetic acid.
Long-term flow-through column experiments and their relevance to natural granitoid weathering rates
White, Arthur F.; Schulz, Marjorie S.; Lawrence, Corey R.; Vivit, Davison V.; Stonestrom, David A.
2017-01-01
Four pairs of fresh and partly-weathered granitoids, obtained from well-characterized watersheds—Merced River, CA, USA; Panola, GA, USA; Loch Vale, CO, USA, and Rio Icacos, Puerto Rico—were reacted in columns under ambient laboratory conditions for 13.8 yrs, the longest running experimental weathering study to date. Low total column mass losses (<1 wt. %), correlated with the absence of pitting or surface roughening of primary silicate grains. BET surface area (SBET) increased, primarily due to Fe-oxyhydroxide precipitation. Surface areas returned to within factors of 2 to 3 of their original values after dithionite extraction. Miscible displacement experiments indicated homogeneous plug flow with negligible immobile water, commonly cited for column experiments. Fresh granitoid effluent solute concentrations initially declined rapidly, followed by much slower decreases over the next decade. Weathered granitoid effluent concentrations increased modestly over the same time period, indicating losses of natural Fe-oxide and/or clay coatings and the increased exposure of primary mineral surfaces. Corresponding (fresh and weathered) elemental effluent concentrations trended toward convergence during the last decade of reaction. NETPATH/PHREEQC code simulations indicated non-stoichiometric dissolution involving Ca release from disseminated calcite and excess K release from interlayer biotite. Effluent 87Sr/85Sr ratios reflected a progressive weathering sequence beginning and ending with 87Sr/85Sr values of plagioclase with an additional calcite input and a radiogenic biotite excursion proportional to the granitoid ages.Effluents became thermodynamically saturated with goethite and gibbsite, slightly under-saturated with kaolinite and strongly under-saturated with plagioclase, consistent with kinetically-limited weathering in which solutes such as Na varied with column flow rates. Effluent Na concentrations showed no clear trend with time during the last decade of reaction (fresh granitoids) or increased slowly with time (weathered granitoids). Analysis of cumulative Na release indicated that plagioclase dissolution achieved steady state in 3 of the 4 fresh granitoids during the last decade of reaction. Surface-area normalized plagioclase dissolution rates exhibited a narrow range (0.95 to 1.26 10-13 moles m-2 s-1), in spite of significant stoichiometric differences (An0.21 to An0.50). Rates were an order of magnitude slower than previously reported in shorter duration experiments but generally 2 to 3 orders of magnitude faster than corresponding natural analogs. CrunchFlow simulations indicated that more than a hundredfold decrease in column flow rates would be required to produce near-saturation reaction affinities that would start to slow plagioclase weathering to real-world levels. Extending simulations to approximate long term weathering in naturally weathered profiles required additional decreases in the intrinsic plagioclase dissolution and kaolinite precipitation rates and relatively large decreases in the fluid flow rate, implying that exposure to reactive mineral surfaces is significantly limited in the natural environment compared to column experiments.
Long-term flow-through column experiments and their relevance to natural granitoid weathering rates
NASA Astrophysics Data System (ADS)
White, Art F.; Schulz, Marjorie S.; Lawrence, Corey R.; Vivit, Davison V.; Stonestrom, David A.
2017-04-01
Four pairs of fresh and partly-weathered granitoids, obtained from well-characterized watersheds-Merced River, CA, USA; Panola, GA, USA; Loch Vale, CO, USA, and Rio Icacos, Puerto Rico-were reacted in columns under ambient laboratory conditions for 13.8 yrs, the longest running experimental weathering study to date. Low total column mass losses (<1 wt.%), correlated with the absence of pitting or surface roughening of primary silicate grains. BET surface area (SBET) increased, primarily due to Fe-oxyhydroxide precipitation. Surface areas returned to within factors of 2-3 of their original values after dithionite extraction. Miscible displacement experiments indicated homogeneous plug flow with negligible immobile water, commonly cited for column experiments. Fresh granitoid effluent solute concentrations initially declined rapidly, followed by much slower decreases over the next decade. Weathered granitoid effluent concentrations increased modestly over the same time period, indicating losses of natural Fe-oxide and/or clay coatings and the increased exposure of primary mineral surfaces. Corresponding (fresh and weathered) elemental effluent concentrations trended toward convergence during the last decade of reaction. NETPATH/PHREEQC code simulations indicated non-stoichiometric dissolution involving Ca release from disseminated calcite and excess K release from interlayer biotite. Effluent 87Sr/85Sr ratios reflected a progressive weathering sequence beginning and ending with 87Sr/85Sr values of plagioclase with an additional calcite input and a radiogenic biotite excursion proportional to the granitoid ages. Effluents became thermodynamically saturated with goethite and gibbsite, slightly under-saturated with kaolinite and strongly under-saturated with plagioclase, consistent with kinetically-limited weathering in which solutes such as Na varied with column flow rates. Effluent Na concentrations showed no clear trend with time during the last decade of reaction (fresh granitoids) or increased slowly with time (weathered granitoids). Analysis of cumulative Na release indicated that plagioclase dissolution achieved steady state in 3 of the 4 fresh granitoids during the last decade of reaction. Surface-area normalized plagioclase dissolution rates exhibited a narrow range (0.95-1.26 10-13 moles m-2 s-1), in spite of significant stoichiometric differences (An0.21 to An0.50). Rates were an order of magnitude slower than previously reported in shorter duration experiments but generally 2-3 orders of magnitude faster than corresponding natural analogs. CrunchFlow simulations indicated that more than a hundredfold decrease in column flow rates would be required to produce near-saturation reaction affinities that would start to slow plagioclase weathering to real-world levels. Extending simulations to approximate long term weathering in naturally weathered profiles required additional decreases in the intrinsic plagioclase dissolution and kaolinite precipitation rates and relatively large decreases in the fluid flow rate, implying that exposure to reactive mineral surfaces is significantly limited in the natural environment compared to column experiments.
Design Seminar for Land Treatment of Municipal Wastewater Effluents.
ERIC Educational Resources Information Center
Demirjian, Y. A.
This document reports the development and operation of a country-wide wastewater treatment program. The program was designed to treat liquid wastewater by biological treatment in aerated lagoons, store it, and then spray irrigate on crop farmland during the growing season. The text discusses the physical design of the system, agricultural aspects,…
Code of Federal Regulations, 2011 CFR
2011-07-01
.... Each new or reconstructed flame lamination affected source using a scrubber a. Maintain the daily average scrubber inlet liquid flow rate above the minimum value established during the performanceb. Maintain the daily average scrubber effluent pH within the operating range established during the...
Tang, Bing; Yu, Guojun; Fang, Jianzhang; Shi, Taihong
2010-05-15
An emulsion liquid membrane (ELM)-crystallization process, using hypophosphorous acid as a reducing agent in the internal aqueous phase, has been developed for the purpose of recovering high-purity silver directly from dilute industrial effluents (waste rinse water). After pretreatment with HNO(3), silver in waste rinse water can be reliably recovered with high efficiency through the established process. The main parameters in the process of ELM-crystallization include the concentration of carrier in the membrane phase, the concentration of reducing agent in the internal aqueous phase, and the treatment ratio, which influence the recovery efficiency to various extents and must be controlled carefully. The results indicated that more than 99.5% (wt.) of the silver ions in the external aqueous phase were extracted by the ELM-crystallization process, with an average efficiency of recovery of 99.24% (wt.) and a purity of 99.92% (wt.). The membrane phase can be used repeatedly without loss of the efficiency of recovery. Copyright (c) 2009 Elsevier B.V. All rights reserved.
USDA-ARS?s Scientific Manuscript database
Nitrate-nitrogen removal rates can be increased substantially in denitrifying bioreactors with a corn cob bed medium compared to woodchips; however, additional organic carbon (C) is released into the effluent. This laboratory column experiment was conducted to test the performance of a post-bed cha...
The identification and quantitation of non-method-specific target analytes have greater importance with respect to EPA's current combustion strategy. The risk associated with combustion process emissions must now be characterized. EPA has recently released draft guidance on pr...
LeBlanc, Kelly L; Wallschläger, Dirk
2016-06-21
Laboratory algal cultures exposed to selenate were shown to produce and release selenomethionine, selenomethionine oxide, and several other organic selenium metabolites. Released discrete organic selenium species accounted for 1.6-13.1% of the selenium remaining in the media after culture death, with 1.3-6.1% of the added selenate recovered as organic metabolites. Analysis of water from an industrially impacted river collected immediately after the death of massive annual algal blooms showed that no selenomethionine or selenomethionine oxide was present. However, other discrete organic selenium species, including a cyclic oxidation product of selenomethionine, were observed, indicating the previous presence of selenomethionine. Industrial biological treatment systems designed for remediation of selenium-contaminated waters were shown to increase both the concentration of organic selenium species in the effluent, relative to influent water, and the fraction of organic selenium to up to 8.7% of the total selenium in the effluent, from less than 1.1% in the influent. Production and emission of selenomethionine, selenomethionine oxide, and other discrete organic selenium species were observed. These findings are discussed in the context of potentially increased selenium bioavailability caused by microbial activity in aquatic environments and biological treatment systems, despite overall reductions in total selenium concentration.
In vitro-in vivo evaluation of in situ gelling and thermosensitive ketoprofen liquid suppositories.
Ozgüney, Işık; Kardhiqi, Anita; Yıldız, Gülbeyaz; Ertan, Gökhan
2014-12-01
The main objective of this study was to investigate the release and pharmacokinetic profiles of ketoprofen (KP) from developed thermosensitive and mucoadhesive liquid suppositories. Thermosensitive liquid suppositories were prepared using KP, poloxamer 407 (P 407), poloxamer 188 (P 188) and various amounts of different mucoadhesive polymers. In vitro release studies was monitored by the USP XXVI paddle method. The results thus obtained were evaluated kinetically and mechanism of release was analyzed. Identification of poloxamer gel localization in vivo was conducted using white male rabbits by adding 1 % methylene blue. For in vivo studies, twenty-four white male rabbits were randomly divided into three groups. The rabbits in each group were administered with liquid suppository F1 [P407/P188/KP (4/20/2.5 %)], F5 [P407/P188/KP/C (4/20/2.5/0.8 %)] or conventional suppository (F-C) into the rectum. The plasma concentration of KP was analyzed by high performance liquid chromatography (HPLC). C max, AUC, MRT and T max were evaluated. The release of KP was variously affected by the mucoadhesive polymers. In vitro release studies showed that Carbopol 934 P(C) has significant effect on release rate among the mucoadhesive polymers. When the formulations were evaluated kinetically, different kinetic models were obtained. Formulation F6 [P407/P188/KP/C (4/20/2.5/1.6 %)] which contains the highest C concentration and very high viscosity, shows a significantly better fit with Higuchi kinetic model. n value of this formulation was also found approximately 0.5. n exponent results of the other formulations showed that KP might be released from the suppositories by non-Fickian diffusion. Identification of poloxamer gel localization in vivo showed that the suppositories remain in the rectum without leakage after administration. With regard to the results of in vivo studies, the AUC6→14 values of KP in liquid suppository containing C are significantly higher than those in liquid suppository without C. MRT0→24 and MRT0→∞ values of liquid suppository containing C are significantly higher than those in liquid suppository without C and conventional suppository. Conventional suppository and liquid suppository without C significantly gave faster time to reach the maximum plasma concentrations of KP. With regard to the in vitro and in vivo experiments, liquid suppository formulation F5 might be a promising formulation for the development of an effective rectal dosage form.
NASA Astrophysics Data System (ADS)
Aissa Grouz, Najla; Billen, Gilles; Garnier, Josette; Mercier, Benjamin; Martinez, Anun
2014-05-01
The major branch of the Seine river from the confluence with the Marne river to the entrance of the estuary is deeply affected by the release of wastewater from the huge Paris agglomeration. In the first years of 2000, the largest part of the effluents were still discharged at the Seine-Aval (Achères) treatment plant with only a standard, low residence time, activated sludge treatment, thus releasing a high ammonium load. NH4 concentration as high as 7 mgN/l were frequently observed downstream from Paris agglomeration. Cébron et al. (2003, 2005) and Garnier et al. 2007 described in details how this massive reduced nitrogen concentrations triggered the growth of nitrifying bacteria, already present in the upstream Seine and Marne rivers, but also brought in large amount by the effluents of the wastewater treatment plant themselves. The decrease of ammonium concentration was slow, however, and was only completed 200 km downstream, in the upper estuarine area, where it causes a severe oxygen deficiency. Since 2007, important changes occurred in the treatment of nitrogen in the Parisian wastewater purification plants. In 2007, the Seine-Aval plant treated up to 90% of the ammonium contained in wastewater through nitrification, and 30% of the total supply of nitrates is treated by denitrification. These modifications have of course favorably affected the water quality of the Seine river: ammonium concentrations are reduced by a factor of 5 and the area of oxygen depletion in the upstream estuary is no more observed. However, nitrites, still released in the effluents, are a matter of concern for the water quality of the Seine downstream from Paris. Using measurements of potential microbial activities carried out with the same experimental protocol for the 2000-2003 and 2012-2013 periods, we here examine and model the dynamics of ammonium oxidizing and nitrite oxidizing microbial populations before and after the implementation of nitrification treatment of Paris wastewaters. We show that, although large amounts of ammonium oxidizing microbes are still released in large amounts with the treated effluents, they no longer grows up in the Seine water by lack of substrate in sufficiently high concentration. The same is true for nitrite oxidizing micro-organisms, which explains the slow disappearance of nitrites from the downstream sector of the Seine River. The maximum turbidity zone of the downstream estuary acts as a concentrator of particulate material. The concentration of nitrifying bacteria observed there is therefore a good indicator of the development of nitrifiers in the downstream sector of the Seine. Comparison of the levels observed in the 2000-2003 period and in 2012 fully confirms our interpretation. In August-September 2013, a dysfunction of the Seine-Aval treatment plant occurred, and large amounts of incompletely nitrified effluents were released, so that high ammonium concentrations were still observed in the river. Interestingly, the dynamics of nitrifying microbial populations recorded during this event, contrasted with that observed in the preceding months, and more closely resembled that observed ten year ago, before the implementation of the new treatment in the wastewater purification plant.
Golovko, Oksana; Kumar, Vimal; Fedorova, Ganna; Randak, Tomas; Grabic, Roman
2014-09-01
Seasonal changes in the concentration of 21 pharmaceuticals in a wastewater treatment plant (WWTP) in České Budějovice were investigated over 12months. The target compounds were 10 antibiotics, 4 antidepressants, 3 psychiatric drugs, 2 antihistamines and 2 lipid regulators. 272 Wastewater samples (136 influents and 136 effluents) were collected from March 2011 to February 2012 and analyzed using two-dimensional liquid chromatography coupled with tandem mass spectrometry. All studied pharmaceuticals were frequently detected in both the influent and the effluent wastewater samples, except for meclozine, which was only found in the influent. The mean concentration of pharmaceuticals varied from 0.006μgL(-1) to 1.48μgL(-1) in the influent and from 0.003μgL(-1) to 0.93μgL(-1) in the effluent. The concentration of most pharmaceuticals was higher during winter. Copyright © 2014 Elsevier Ltd. All rights reserved.
Rodríguez-Navas, Carlos; Björklund, Erland; Bak, Søren A; Hansen, Martin; Krogh, Kristine A; Maya, Fernando; Forteza, Rafael; Cerdà, Víctor
2013-07-01
This work determines the principal environmental pollution pathways of pharmaceuticals on the island of Mallorca (Spain). The evaluation was made on the basis of the quantification of pharmaceutical residues by liquid chromatography-tandem mass spectrometry in several environmental water samples, including wastewater-treatment plant effluents, municipal solid waste landfill leachates, groundwater (GW), and marine water. An overall set of 19 pharmaceuticals has been identified in the environment of the 27 human pharmaceuticals investigated in this study. WWTP effluents are the main source of discharge of the pharmaceuticals into the aquatic environment. The data indicate that reuse of treated domestic wastewater for irrigation (which supplies some 30 % of the total water demand in Mallorca) contributes to the contamination of GW. In addition, leaching from landfills is identified as another, but minor, possible source of introduction of pharmaceuticals to GW aquifers. Finally, WWTP effluents ending in the Mediterranean Sea, primarily highly urbanized coastal areas, cause pharmaceutical residues to occur in marine water bodies.
Schultz, M.M.; Furlong, E.T.
2008-01-01
Treated wastewater effluent is a potential environmental point source for antidepressant pharmaceuticals. A quantitative method was developed for the determination of trace levels of antidepressants in environmental aquatic matrixes using solid-phase extraction coupled with liquid chromatography- electrospray ionization tandem mass spectrometry. Recoveries of parent antidepressants from matrix spiking experiments for the individual antidepressants ranged from 72 to 118% at low concentrations (0.5 ng/L) and 70 to 118% at high concentrations (100 ng/L) for the solid-phase extraction method. Method detection limits for the individual antidepressant compounds ranged from 0.19 to 0.45 ng/L. The method was applied to wastewater effluent and samples collected from a wastewater-dominated stream. Venlafaxine was the predominant antidepressant observed in wastewater and river water samples. Individual antidepressant concentrations found in the wastewater effluent ranged from 3 (duloxetine) to 2190 ng/L (venlafaxine), whereas individual concentrations in the waste-dominated stream ranged from 0.72 (norfluoxetine) to 1310 ng/L (venlafaxine). ?? 2008 American Chemical Society.
Capture and release of mixed acid gasses with binding organic liquids
Heldebrant, David J.; Yonker, Clement R.
2010-09-21
Reversible acid-gas binding organic liquid systems that permit separation and capture of one or more of several acid gases from a mixed gas stream, transport of the liquid, release of the acid gases from the ionic liquid and reuse of the liquid to bind more acid gas with significant energy savings compared to current aqueous systems. These systems utilize acid gas capture compounds made up of strong bases and weak acids that form salts when reacted with a selected acid gas, and which release these gases when a preselected triggering event occurs. The various new materials that make up this system can also be included in various other applications such as chemical sensors, chemical reactants, scrubbers, and separators that allow for the specific and separate removal of desired materials from a gas stream such as flue gas.
Active suppression of vortex-driven combustion instability using controlled liquid-fuel injection
NASA Astrophysics Data System (ADS)
Pang, Bin
Combustion instabilities remain one of the most challenging problems encountered in developing propulsion and power systems. Large amplitude pressure oscillations, driven by unsteady heat release, can produce numerous detrimental effects. Most previous active control studies utilized gaseous fuels to suppress combustion instabilities. However, using liquid fuel to suppress combustion instabilities is more realistic for propulsion applications. Active instability suppression in vortex-driven combustors using a direct liquid fuel injection strategy was theoretically established and experimentally demonstrated in this dissertation work. Droplet size measurements revealed that with pulsed fuel injection management, fuel droplet size could be modulated periodically. Consequently, desired heat release fluctuation could be created. If this oscillatory heat release is coupled with the natural pressure oscillation in an out of phase manner, combustion instabilities can be suppressed. To identify proper locations of supplying additional liquid fuel for the purpose of achieving control, the natural heat release pattern in a vortex-driven combustor was characterized in this study. It was found that at high Damkohler number oscillatory heat release pattern closely followed the evolving vortex front. However, when Damkohler number became close to unity, heat release fluctuation wave no longer coincided with the coherent structures. A heat release deficit area was found near the dump plane when combustor was operated in lean premixed conditions. Active combustion instability suppression experiments were performed in a dump combustor using a controlled liquid fuel injection strategy. High-speed Schlieren results illustrated that vortex shedding plays an important role in maintaining self-sustained combustion instabilities. Complete combustion instability control requires total suppression of these large-scale coherent structures. The sound pressure level at the excited dominant frequency was reduced by more than 20 dB with controlled liquid fuel injection method. Scaling issues were also investigated in this dump combustor to test the effectiveness of using pulsed liquid fuel injection strategies to suppress instabilities at higher power output conditions. With the liquid fuel injection control method, it was possible to suppress strong instabilities with initial amplitude of +/-5 psi down to the background noise level. The stable combustor operating range was also expanded from equivalence ratio of 0.75 to beyond 0.9.
2009 EVALUATION OF TRITIUM REMOVAL AND MITIGATION TECHNOLOGIES FOR WASTEWATER TREATMENT
DOE Office of Scientific and Technical Information (OSTI.GOV)
LUECK KJ; GENESSE DJ; STEGEN GE
2009-02-26
Since 1995, a state-approved land disposal site (SALDS) has received tritium contaminated effluents from the Hanford Site Effluent Treatment Facility (ETF). Tritium in this effluent is mitigated by storage in slow moving groundwater to allow extended time for decay before the water reaches the site boundary. By this method, tritium in the SALDS is isolated from the general environment and human contact until it has decayed to acceptable levels. This report contains the 2009 update evaluation of alternative tritium mitigation techniques to control tritium in liquid effluents and groundwater at the Hanford site. A thorough literature review was completed andmore » updated information is provided on state-of-the-art technologies for control of tritium in wastewaters. This report was prepared to satisfy the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-026-07B (Ecology, EPA, and DOE 2007). Tritium separation and isolation technologies are evaluated periodically to determine their feasibility for implementation to control Hanford site liquid effluents and groundwaters to meet the Us. Code of Federal Regulations (CFR), Title 40 CFR 141.16, drinking water maximum contaminant level (MCL) for tritium of 20,000 pOll and/or DOE Order 5400.5 as low as reasonably achievable (ALARA) policy. Since the 2004 evaluation, there have been a number of developments related to tritium separation and control with potential application in mitigating tritium contaminated wastewater. These are primarily focused in the areas of: (1) tritium recycling at a commercial facility in Cardiff, UK using integrated tritium separation technologies (water distillation, palladium membrane reactor, liquid phase catalytic exchange, thermal diffusion), (2) development and demonstration of Combined Electrolysis Catalytic Exchange (CECE) using hydrogen/water exchange to separate tritium from water, (3) evaporation of tritium contaminated water for dispersion in the atmosphere, and (4) use of barriers to minimize the transport of tritium in groundwater. Continuing development efforts for tritium separations processes are primarily to support the International Thermonuclear Experimental Reactor (ITER) program, the nuclear power industry, and the production of radiochemicals. While these applications are significantly different than the Hanford application, the technology could potentially be adapted for Hanford wastewater treatment. Separations based processes to reduce tritium levels below the drinking water MCL have not been demonstrated for the scale and conditions required for treating Hanford wastewater. In addition, available cost information indicates treatment costs for such processes will be substantially higher than for discharge to SALDS or other typical pump and treat projects at Hanford. Actual mitigation projects for groundwater with very low tritium contamination similar to that found at Hanford have focused mainly on controlling migration and on evaporation for dispersion in the atmosphere.« less
Characteristics of purple nonsulfur bacteria grown under Stevia residue extractions.
Xu, J; Feng, Y; Wang, Y; Lin, X
2013-11-01
As a consequence of the large-scale cultivation of Stevia plants, releases of plant residues, the byproduct after sweetener extraction, to the environment are inevitable. Stevia residue and its effluent after batching up contain large amounts of organic matters with small molecular weight, which therefore are a potential pollution source. Meanwhile, they are favourite substrates for micro-organism growths. This investigation was aimed to utilize the simulated effluent of Stevia residue to enrich the representative purple nonsulfur bacterium (PNSB), Rhodopseudomonas palustris (Rps. palustris), which has important economic values. The growth profile and quality of Rps. palustris were characterized by spectrophotometry, compared to those grown in common PNSB mineral synthetic medium. Our results revealed that the simulated effluent of Stevia residue not only stimulated Rps. palustris growth to a greater extent, but also increased its physiologically active cytochrome concentrations and excreted indole-3-acetic acid (IAA) content. This variation in phenotype of Rps. palustris could result from the shift in its genotype, further revealed by the repetitive sequence-based PCR (rep-PCR) fingerprinting analysis. Our results showed that the effluent of Stevia residue was a promising substrate for microbial growth. © 2013 The Society for Applied Microbiology.
Effectiveness of biochar for sorption of ammonium and phosphate from dairy effluent.
Sarkhot, D V; Ghezzehei, T A; Berhe, A A
2013-09-01
The use of biochar for recovery of excess nutrients in dairy manure effluent and the use of nutrient-enriched biochar as soil amendment can offer a robust solution for multiple environmental issues. In this study we determined the capacity of biochar, produced by pyrolyzing mixed hardwood feedstock at 300°C, to adsorb and retain or release two major nutrient ions: ammonium (NH) and phosphate (PO). We conducted the experiment using a range of nutrient concentrations that represent those commonly observed in dairy manure effluent (0-50 mg L for PO and 0-1000 mg L for NH). Up to 5.3 mg g NH and 0.24 mg g PO was adsorbed from manure by biochar (18 and 50% of total amount in the manure slurry, respectively). During the desorption phase of the experiment, biochar retained 78 to 91% of the sorbed NH and 60% of the sorbed PO at reaction times <24 h. Our findings confirm that biochar can be used for recovering excess nitrogen and phosphorus from agricultural water, such as dairy manure effluent. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.
Kabiru, Lawan Mohammed; Bello, Mohammed; Kabir, Junaid; Grande, Laura; Morabito, Stefano
2015-01-01
Pathogenic Escherichia coli can be released with the wastes coming from slaughterhouses into the environment, where they can persist. We investigated the presence of diarrheagenic E. coli in specimens taken at an abattoir located in the Zaria region, Nigeria, in samples of water from the river Koreye, where the effluent from the abattoir spills in, and vegetable specimens taken at a nearby farm. All the isolated E. coli were assayed for the production of Shiga toxins (Stx) by using the Ridascreen verotoxin Immunoassay and by PCR amplification of genes associated with the diarrheagenic E. coli. Three strains from the rectal content of two slaughtered animals and a cabbage were positive for the presence of the Stx-coding genes. Additionally we have isolated one Enteroaggregative E. coli (EAggEC) from the abattoir effluent and two Subtilase-producing E. coli from the slaughterhouse’s effluent and a sample of carrots. Our results provide evidence that pathogenic E. coli can contaminate the environment as a result of the discharge into the environment of untreated abattoir effluent, representing a reservoir for STEC and other diarrheagenic E. coli favouring their spread to crops. PMID:25590145
Radionuclide speciation in effluent from La Hague reprocessing plant in France.
Salbu, B; Skipperud, L; Germain, P; Guéguéniat, P; Strand, P; Lind, O C; Christensen, G
2003-09-01
Effluent from the La Hague nuclear fuel reprocessing plant was mixed with seawater in order to investigate the fate of the various radionuclides. Thus, a major objective of the present work is to characterize the effluent from La Hague reprocessing plant and to study how the radionuclide speciation changes with time when discharged into the marine environment. Discharges from the La Hague nuclear reprocessing plant represent an important source of artificially produced radionuclides to the North Sea. The transport, distribution, and biological uptake of radionuclides in the marine environment depends, however, on the physicochemical forms of radionuclides in the discharged effluents and on transformation processes that occur after entering the coastal waters. Information of these processes is needed to understand the transport and long-term distribution of the radionuclides. In the present work, a weekly discharged effluent from the nuclear fuel reprocessing plant at Cap La Hague in France was mixed with coastal water and fractionated with respect to particle size and charged species using ultra centrifugation and hollow fiber ultrafiltration with on line ion exchange. The size distribution pattern of gamma-emitting radionuclides was followed during a 62-h period after mixing the effluent with seawater. 54Mn was present as particulate material in the effluent, while other investigated radionuclides were discharged in a more mobile form or were mobilized after mixing with sea water (e.g., 60Co) and can be transported long distances in the sea. Sediments can act as a sink for less mobile discharged radionuclides (Skipperud et al. 2000). A kinetic model experiment was performed to provide information of the time-dependent distribution coefficients, Kd (t). The retention of the effluent radionuclides in sediments was surprisingly low (Kd 20-50), and the sediments acted as a poor sink for the released radionuclides. Due to the presence of non-reacting radionuclide species in the effluent, a major fraction of the radionuclides, such as Cs-isotopes, 106Ru and 125Sb, in the effluent will be subjected to marine transport to the Northern Seas (i.e., the North Sea, Norwegian Sea and the Barents Sea). The La Hague effluent may, therefore, contribute to enriched levels of radionuclides found in the English Channel, including 90Sr, 60Co and Pu-isotopes, and also 106Ru and 125Sb.
Availability of environmental radioactivity to honey bee colonies at Los Alamos
DOE Office of Scientific and Technical Information (OSTI.GOV)
Hakonson, T.E.; Bostick, K.V.
Data are presented on the availability of tritium, cesium 137, and plutonium to honey bee colonies foraging in the environment surrounding the Los Alamos Scientific Laboratory. Sources of these radionuclides in the laboratory environs include liquid and atmospheric effluents and buried solid waste. Honey bee colonies were placed in three canyon liquid waste disposal areas and were sampled frequently, along with honey, surface water, and surrounding vegetation, to qualitatively determine the availability of these radionuclides to bees (Apis mellifera) and to identify potential food chain sources of the elements. Tritium concentrations in bee and honey samples from the canyons increasedmore » rapidly from initial values of <1 pCi/ml moisture to as much as 9.2 nCi/ml in 75 days after placement of the hives in the canyons. Seasonal patterns in foraging activities as influenced by weather and food availability were apparent in the data. It appears that several sources of tritium were utilized by the colonies, including surface water in the canyons and vegetation receiving tritium from atmospheric effluents and buried solid waste. Concentrations of cesium 137 and plutonium were generally low or undetectable in bees throughout the study. However, levels of both nuclides increased by factors of 10 to 20 in bees from two of the canyon study areas during a 3-month period in 1973. It was speculated that the liquid effluents in the two canyons were the source of the increased concentrations in bee samples, since this water was the only significant source of /sup 137/Cs in the environs. The existence of at least three radionuclide sources in the Los Alamos Scientific Laboratory (LASL) environs complicates the interpretation of the data. However, it is apparent that honey bees can acquire /sup 3/H, /sup 137/Cs, and Pu from multiple sources in the environs.« less
Sepúlveda, M S; Ruessler, D S; Denslow, N D; Holm, S E; Schoeb, T R; Gross, T S
2001-11-01
This study evaluated the potential effects of different concentrations of bleached/unbleached kraft mill effluent (B/UKME) on several reproductive endpoints in adult largemouth bass (Micropterus salmoides). The kraft mill studied produces a 50/50 mix of bleached/unbleached market pulp with an estimated release of 36 million gal of effluent/day. Bleaching sequences were C90d10EopHDp and CEHD for softwood (pines) and hardwoods (mainly tupelo, gums, magnolia, and water oaks), respectively. Bass were exposed to different effluent concentrations (0 [controls, exposed to well water], 10, 20, 40, or 80%) for either 28 or 56 days. At the end of each exposure period, fish were euthanized, gonads collected for histological evaluation and determination of gonadosomatic index (GSI), and plasma was analyzed for 17beta-estradiol, 11-ketotestosterone, and vitellogenin (VTG). Largemouth bass exposed to B/UKME responded with changes at the biochemical level (decline in sex steroids in both sexes and VTG in females) that were usually translated into tissue/organ-level responses (declines in GSI in both sexes and in ovarian development in females). Although most of these responses occurred after exposing fish to 40% B/UKME concentrations or greater, some were observed after exposures to 20% B/UKME. These threshold concentrations fall within the 60% average yearly concentration of effluent that exists in the stream near the point of discharge (Rice Creek), but are above the <10% effluent concentration present in the St. Johns River. The chemical(s) responsible for such changes as well as their mode(s) of action remain unknown at this time.
Wang, Lei; Gong, Xinying; Wang, Ruonan; Gan, Zhiwei; Lu, Yuan; Sun, Hongwen
2017-09-15
Ionic liquids have been used to efficiently extract a wide range of polar and nonpolar organic contaminants from water. In this study, imidazole ionic liquids immobilized on silica gel were synthesized through a chemical bonding method, and the immobilized dodecylimidazolium ionic liquid was selected as the receiving phase material in a POCIS (polar organic chemical integrative sampler) like passive sampler to monitor five perfluoroalkyl substances (PFASs) in water. Twenty-one days of integrative accumulation was conducted in laboratory scale experiments, and the accumulated PFASs in the samplers were eluted and analyzed by high performance liquid chromatography coupled with tandem mass spectrometry (HPLC-MS/MS). The partitioning coefficients of most PFASs between sampler sorbents and water in the immobilized ionic liquid (IIL)-sampler were higher than those in the HLB-sampler, especially for compounds with shorter alkyl chains. The effects of flow velocity, temperature, dissolved organic matter (DOM) and pH on the uptake of these analytes were also evaluated. Under the experimental conditions, the uptake of PFASs in the IIL-sampler slightly increased with the flow velocity and temperature, while different influences of DOM and pH on the uptake of PFAS homologues with short or long chains were observed. The designed IIL-samplers were applied in the influent and effluent of a wastewater treatment plant. All five PFASs could be accumulated in the samplers, with concentrations ranging from 6.5×10 -3 -3.6×10 -1 nmol/L in the influent and from 1.3×10 -2 -2.2×10 -1 nmol/L in the effluent. The calculated time-weighted average concentrations of most PFASs fit well with the detected concentrations of the active sampling, indicating the applicability of the IIL-sampler in monitoring these compounds in water. Copyright © 2017 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Warner, N. R.; Menio, E. C.; Landis, J. D.; Vengosh, A.; Lauer, N.; Harkness, J.; Kondash, A.
2014-12-01
Recent public interest in high volume slickwater hydraulic fracturing (HVHF) has drawn increased interest in wastewater management practices by the public, researchers, industry, and regulators. The management of wastes, including both fluids and solids, poses many engineering challenges, including elevated total dissolved solids and elevated activities of naturally occurring radioactive materials (NORM). One management option for wastewater in particular, which is used in western Pennsylvania, USA, is treatment at centralized waste treatment facilities [1]. Previous studies conducted from 2010-2012 indicated that one centralized facility, the Josephine Brine Treatment facility, removed the majority of radium from produced water and hydraulic fracturing flowback fluid (HFFF) during treatment, but low activities of radium remained in treated effluent and were discharged to surface water [2]. Despite the treatment process and radium reduction, high activities (200 times higher than upstream/background) accumulated in stream sediments at the point of effluent discharge. Here we present new results from sampling conducted at two additional centralized waste treatment facilities (Franklin Brine Treatment and Hart Brine Treatment facilities) and Josephine Brine Treatment facility conducted in June 2014. Preliminary results indicate radium is released to surface water at very low (<50 pCi/L) to non-detectable activities, however; radium continues to accumulate in sediments surrounding the area of effluent release. Combined, the data indicate that 1) radium continues to be released to surface water streams in western Pennsylvania despite oil and gas operators voluntary ban on treatment and disposal of HFFF in centralized waste treatment facilities, 2) radium accumulation in sediments occurred at multiple brine treatment facilities and is not isolated to a single accidental release of contaminants or a single facility. [1] Wilson, J. M. and J. M. VanBriesen (2012). "Oil and Gas Produced Water Management and Surface Drinking Water Sources in Pennsylvania." Environmental Practice 14(04): 288-300. [2] Warner, N. R., C. A. Christie, R. B. Jackson and A. Vengosh (2013). "Impacts of Shale Gas Wastewater Disposal on Water Quality in Western Pennsylvania." ES&T 47(20): 11849-11857.
Plasma Jet (V)UV-Radiation Impact on Biologically Relevant Liquids and Cell Suspension
NASA Astrophysics Data System (ADS)
Tresp, H.; Bussiahn, R.; Bundscherer, L.; Monden, A.; Hammer, M. U.; Masur, K.; Weltmann, K.-D.; Woedtke, Th. V.; Reuter, S.
2014-10-01
In this study the generation of radicals in plasma treated liquids has been investigated. To quantify the contribution of plasma vacuum ultraviolet (VUV) and ultraviolet (UV) radiation on the species investigated, three cases have been studied: UV of plasma jet only, UV and VUV of plasma jet combined, and the plasma effluent including all reactive components. The emitted VUV has been observed by optical emission spectroscopy and its effect on radical formation in liquids has been analyzed by electron spin resonance spectroscopy. Radicals have been determined in ultrapure water (dH2O), as well as in more complex, biorelevant solutions like phosphate buffered saline (PBS) solution, and two different cell culture media. Various compositions lead to different reactive species formation, e.g. in PBS superoxide anion and hydroxyl radicals have been detected, in cell suspension also glutathione thiyl radicals have been found. This study highlights that UV has no impact on radical generation, whereas VUV is relevant for producing radicals. VUV treatment of dH2O generates one third of the radical concentration produced by plasma-effluent treatment. It is relevant for plasma medicine because although plasma sources are operated in open air atmosphere, still VUV can lead to formation of biorelevant radicals. This work is funded by German Federal Ministry of Education a Research (BMBF) (Grant # 03Z2DN12+11).
Wenzel, J; Fuentes, L; Cabezas, A; Etchebehere, C
2017-06-01
An important pollutant produced during the cheese making process is cheese whey which is a liquid by-product with high content of organic matter, composed mainly by lactose and proteins. Hydrogen can be produced from cheese whey by dark fermentation but, organic matter is not completely removed producing an effluent rich in volatile fatty acids. Here we demonstrate that this effluent can be further used to produce energy in microbial fuel cells. Moreover, current production was not feasible when using raw cheese whey directly to feed the microbial fuel cell. A maximal power density of 439 mW/m 2 was obtained from the reactor effluent which was 1000 times more than when using raw cheese whey as substrate. 16S rRNA gene amplicon sequencing showed that potential electroactive populations (Geobacter, Pseudomonas and Thauera) were enriched on anodes of MFCs fed with reactor effluent while fermentative populations (Clostridium and Lactobacillus) were predominant on the MFC anode fed directly with raw cheese whey. This result was further demonstrated using culture techniques. A total of 45 strains were isolated belonging to 10 different genera including known electrogenic populations like Geobacter (in MFC with reactor effluent) and known fermentative populations like Lactobacillus (in MFC with cheese whey). Our results show that microbial fuel cells are an attractive technology to gain extra energy from cheese whey as a second stage process during raw cheese whey treatment by dark fermentation process.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Chassery, A.; Universite de Toulouse, Laboratoire de Genie Chimique, Toulouse; CNRS, Laboratoire de Genie Chimique, Toulouse
Within the framework of the dismantling of fast breeder reactors in France several processes are under investigation regarding sodium disposal. One of them, called ELA (radioactive sodium waste treatment process), is based on the implementation of the sodium-water reaction, in a controlled and progressive way, to remove residual sodium. This sodium contains impurities such as sodium hydride, sodium oxide and tritiated sodium hydride. The hydrolysis of these various chemical species leads to the production of a liquid effluent, mainly composed of an aqueous solution of sodium hydroxide, and a gaseous effluent, mainly composed of nitrogen (inert gas), hydrogen and steam.more » The tritium is distributed between these effluents, and, within the gaseous effluent, according to its forms HT and HTO (tritiated water). HTO being 10,000 times more radio-toxic than HT, a precise knowledge of the mechanisms governing the phase distribution of tritium is necessary. This paper presents the first experimental results from a parametric study on the tritium distribution between the various effluents generated during hydrolysis operations. A series of experiments have been performed in order to study the influence of water flow rate, argon flow rate, initial mass and specific activity of the hydrolyzed sodium sample. An important influence of the total tritium concentration in the hydrolyzed sample has been highlighted. As for the phenomena suspected to be responsible for the phase change of tritiated water, in the studied range of parameters, vaporization induced by the heat of reactions seems to be dominant over the evaporation induced by the inert gas flow rate.« less
Code of Federal Regulations, 2010 CFR
2010-07-01
... scrubber, maintain the daily average pressure drop across the venturi within the operating range value... . . . You must . . . 1. Scrubber a. Maintain the daily average scrubber inlet liquid flow rate above the minimum value established during the performance test. b. Maintain the daily average scrubber effluent pH...
Code of Federal Regulations, 2011 CFR
2011-07-01
... . . . You must . . . 1. Scrubber a. Maintain the daily average scrubber inlet liquid flow rate above the minimum value established during the performance test. b. Maintain the daily average scrubber effluent pH... scrubber, maintain the daily average pressure drop across the venturi within the operating range value...
The effect of temperature on experimental and natural chemical weathering rates of granitoid rocks
White, A.F.; Blum, A.E.; Bullen, T.D.; Vivit, D.V.; Schulz, M.; Fitzpatrick, J.
1999-01-01
The effects of climatic temperature variations (5-35??C) on chemical weathering are investigated both experimentally using flow-through columns containing fresh and weathered granitoid rocks and for natural granitoid weathering in watersheds based on annual solute discharge. Although experimental Na and Si effluent concentrations are significantly higher in the fresh relative to the weathered granitoids, the proportional increases in concentration with increasing temperature are similar. Si and Na exhibit comparable average apparent activation energies (E(a)) of 56 and 61 kJ/mol, respectively, which are similar to those reported for experimental feldspar dissolution measured over larger temperature ranges. A coupled temperature-precipitation model, using an expanded database for solute discharge fluxes from a global distribution of 86 granitoid watersheds, produces an apparent activation energy for Si (51 kJ/mol), which is also comparable to those derived from the experimental study. This correlation reinforces evidence that temperature does significantly impact natural silicate weathering rates. Effluent K concentrations in the column study are elevated with respect to other cations compared to watershed discharge due to the rapid oxidation/dissolution of biotite. K concentrations are less sensitive to temperature, resulting in a lower average E(a) value (27 kJ/mol) indicative of K loss from lower energy interlayer sites in biotite. At lower temperatures, initial cation release from biotite is significantly faster than cation release from plagioclase. This agrees with reported higher K/Na ratios in cold glacial watersheds relative to warmer temperate environments. Increased release of less radiogenic Sr from plagioclase relative to biotite at increasing temperature produces corresponding decreases in 87Sr/86Sr ratios in the column effluents. A simple mixing calculation using effluent K/Na ratios, Sr concentrations and 87Sr/86Sr ratios for biotite and plagioclase approximates stoichiometric cation ratios from biotite/plagioclase dissolution at warmer temperatures (35??C), but progressively overestimates the relative proportion of biotite with decreasing temperature. Ca, Mg, and Sr concentrations closely correlate, exhibit no consistent trends with temperature, and are controlled by trace amounts of calcite or exchange within weathered biotite. The inability of the watershed model to differentiate a climate signal for such species correlates with the lower temperature dependence observed in the experimental studies.
Laboratory experiments were conducted to simulate radiopollutant effluents released to the atmosphere from two standard-design nuclear power plants. The main objective of the study was to compare the dispersion in the wakes of the plants with that in a simulated atmospheric bound...
Incorporation of copper nanoparticles into paper for point-of-use water purification
Smith, James A.
2014-01-01
As a cost-effective alternative to silver nanoparticles, we have investigated the use of copper nanoparticles in paper filters for point-of-use water purification. This work reports an environmentally benign method for the direct in situ preparation of copper nanoparticles (CuNPs) in paper by reducing sorbed copper ions with ascorbic acid. Copper nanoparticles were quickly formed in less than 10 minutes and were well distributed on the paper fiber surfaces. Paper sheets were characterized by x-ray diffraction, scanning electron microscopy, energy dispersive x-ray spectroscopy, and atomic absorption spectroscopy. Antibacterial activity of the CuNP sheets was assessed for by passing Escherichia coli bacteria suspensions through the papers. The effluent was analyzed for viable bacteria and copper release. The CuNP papers with higher copper content showed a high bacteria reduction of log 8.8 for E. coli. The paper sheets containing copper nanoparticles were effective in inactivating the test bacteria as they passed through the paper. The copper levels released in the effluent water were below the recommended limit for copper in drinking water (1 ppm). PMID:25014431
Groundwater impact assessment report for the 216-S-26 Crib, 200 West Area
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lindberg, J.W.; Evelo, S.D.; Alexander, D.J.
1993-11-01
This report assesses the impact of wastewater discharged to the 216-S-26 Crib on groundwater quality. The 216-S-26 Crib, located in the southern 200 West Area, has been in use since 1984 to dispose of liquid effluents from the 222-S Laboratory Complex. The 222-S Laboratory Complex effluent stream includes wastewater from four sources: the 222-S Laboratory, the 219-S Waste Storage Facility, the 222-SA Chemical Standards Laboratory, and the 291-S Exhaust Fan Control House and Stack. Based on assessment of groundwater chemistry and flow data, contaminant transport predictions, and groundwater chemistry data, the 216-S-26 Crib has minimal influence on groundwater contamination inmore » the southern 200 West Area.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
Not Available
1994-08-01
As part of the original Hanford Federal Facility Agreement and Concent Order negotiations, US DOE, US EPA and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground to the Hanford Site are subject to permitting in the State Waste Discharge Permit Program (SWDP). This document constitutes the SWDP Application for the 200 Area TEDF stream which includes the following streams discharged into the area: Plutonium Finishing Plant waste water; 222-S laboratory Complex waste water; T Plant waste water; 284-W Power Plant waste water; PUREX chemical Sewer; B Plant chemical sewer, process condensate, steam condensate; 242-A-81more » Water Services waste water.« less
Cáceres, Rafaela; Magrí, Albert; Marfà, Oriol
2015-10-01
This work aimed to demonstrate the feasibility of nitrification applied to the treatment of leachates formed during composting of cattle and pig manure in order to promote their further use as liquid fertilizer in horticulture. Nitrification trials were successfully conducted in summer and winter seasons under Mediterranean climate conditions. Subsequently, effect of using the nitrified effluents as nutritive solution in the fertigation of lettuce (Lactuca sativa L.) was assessed in terms of productivity and nutrient uptake. Similar productivities were obtained when using the nitrified effluents and a standard nutritive solution. However, results also evidenced high nutrient uptake, which indicates that dosage should be adjusted to culture requirements. Copyright © 2015 Elsevier Ltd. All rights reserved.
Midorikawa, I; Aoki, H; Omori, A; Shimizu, T; Kawaguchi, Y; Kassai, K; Murakami, T
2008-01-01
High purity phosphorus was recovered from municipal wastewater secondary effluent as phosphate, using a newly developed phosphorus adsorption and recovery system. A high-speed adsorbent having a unique porous structure was used in this system. The secondary effluent, showing total phosphorus (TP) of 0.1-2.1 mg P/L, was passed through an adsorbent packed column at high space velocity (SV) of 15 h(-1). The TP of the treated water was as low as 0.02-0.04 mg P/L, indicating that 97% of phosphorus in the secondary effluent was removed. The removed phosphorus was desorbed from the adsorbent by passing a sodium hydroxide aqueous solution through the column. Calcium hydroxide was added to this solution to precipitate the phosphorus as calcium phosphate. This precipitate was neutralized with hydrochloric acid aqueous solution, washed with water, and then solid-liquid separation was performed for the phosphorus recovery. The main constituent of the recovered phosphorus was apatite-type calcium phosphate, with 16% phosphorus content, which matched that of high-grade phosphorus ore. The hazardous elements content of the recovered phosphorus was exceedingly low. Therefore the recovered phosphorus can be applied to an alternative for phosphorus ore, or to a phosphate fertilizer. IWA Publishing 2008.
Prieto-Rodríguez, L; Oller, I; Klamerth, N; Agüera, A; Rodríguez, E M; Malato, S
2013-03-15
Conventional municipal wastewater treatment plants are not able to entirely degrade some organic pollutants that end up in the environment. Within this group of contaminants, Emerging Contaminants are mostly unregulated compounds that may be candidates for future regulation. In this work, different advanced technologies: solar heterogeneous photocatalysis with TiO(2), solar photo-Fenton and ozonation, are studied as tertiary treatments for the remediation of micropollutants present in real municipal wastewater treatment plants effluents at pilot plant scale. Contaminants elimination was followed by Liquid Chromatography/Quadrupole ion trap Mass Spectrometry analysis after a pre-concentration 100:1 by automatic solid phase extraction. 66 target micropollutants were identified and quantified. 16 of those contaminants at initial concentrations over 1000 ng L(-1), made up over 88% of the initial total effluent pollutant load. The order of micropollutants elimination efficiency under the experimental conditions evaluated was solar photo-Fenton > ozonation > solar heterogeneous photocatalysis with TiO(2). Toxicity analyses by Vibrio fischeri and respirometric tests showed no significant changes in the effluent toxicity after the three tertiary treatments application. Solar photo-Fenton and ozonation treatments were also compared from an economical point of view. Copyright © 2012 Elsevier Ltd. All rights reserved.
Brienza, M; Mahdi Ahmed, M; Escande, A; Plantard, G; Scrano, L; Chiron, S; Bufo, S A; Goetz, V
2016-04-01
Wastewater tertiary treatment by advanced oxidation processes is thought to produce a treated effluent with lower toxicity than the initial influent. Here we performed tertiary treatment of a secondary effluent collected from a Waste Water Treatment Plant via homogeneous (solar/HSO5(-)/Fe(2+)) and heterogeneous (solar/TiO2) solar advanced oxidation aiming at the assessment of their effectiveness in terms of contaminants' and toxicity abatement in a plain solar reactor. A total of 53 organic contaminants were qualitatively identified by liquid chromatography coupled to high-resolution mass spectrometry after solid phase extraction. Solar advanced oxidation totally or partially removed the major part of contaminants detected within 4.5 h. Standard toxicity tests were performed using Vibrio fischeri, Daphnia magna, Pseudokirchneriella subcapitata and Brachionus calyciflorus organisms to evaluate acute and chronic toxicity in the secondary or tertiary effluents, and the EC50% was calculated. Estrogenic and genotoxic tests were carried out in an attempt to obtain an even sharper evaluation of potential hazardous effects due to micropollutants or their degradation by-products in wastewater. Genotoxic effects were not detected in effluent before or after treatment. However, we observed relevant estrogenic activity due to the high sensitivity of the HELN ERα cell line. Copyright © 2016 Elsevier Ltd. All rights reserved.
Water recycle as a must: decolorization of textile wastewaters by plant-associated fungi.
Tegli, Stefania; Cerboneschi, Matteo; Corsi, Massimo; Bonnanni, Marco; Bianchini, Roberto
2014-02-01
Textile dye effluents are among the most problematic pollutants because of their toxicity on several organisms and ecosystems. Low cost and ecocompatible bioremediation processes offer a promising alternative to the conventional and aspecific physico-chemical procedures adopted so far. Here, microorganisms resident on three real textile dyeing effluent were isolated, characterized, and tested for their decolorizing performances. Although able to survive on these real textile-dyeing wastewaters, they always showed a very low decolorizing activity. On the contrary, several plant-associated fungi (Bjerkandera adusta, Funalia trogii, Irpex lacteus, Pleurotus ostreatus, Trametes hirsuta, Trichoderma viride, and Aspergillus nidulans) were also assayed and demonstrated to be able both to survive and to decolorize to various extents the three effluents, used as such in liquid cultures. The decolorizing potential of these fungi was demonstrated to be influenced by nutrient availability and pH. Best performances were constantly obtained using B. adusta and A. nidulans, relying on two strongly different mechanisms for their decolorizing activities: degradation for B. adusta and biosorption for A. nidulans. Acute toxicity tests using Daphnia magna showed a substantial reduction in toxicity of the three textile dyeing effluents when treated with B. adusta and A. nidulans, as suggested by mass spectrometric analysis as well. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Schultz, Melissa M.; Barofsky, Douglas F.; Field, Jennifer A.
2008-01-01
A quantitative method was developed for the determination of fluorinated alkyl substances in municipal wastewater influents and effluents. The method consisted of centrifugation followed by large-volume injection (500 μL) of the supernatant onto a liquid chromatograph with a reverse-phase column and detection by electrospray ionization, and tandem mass spectrometry (LC/MS/MS). The fluorinated analytes studied include perfluoroalkyl sulfonates, fluorotelomer sulfonates, perfluorocarboxylates, and select fluorinated alkyl sulfonamides. Recoveries of the fluorinated analytes from wastewater treatment plant (WWTP) raw influents and final effluent ranged from 77% – 96% and 80% – 99%, respectively. The lower limit of quantitation ranged from 0.5 to 3.0 ng/L depending on the analyte. The method was applied to flow-proportional composites of raw influent and final effluent collected over a 24 hr period from ten WWTPs nationwide. Fluorinated alkyl substances were observed in wastewater at all treatment plants and each plant exhibited unique distributions of fluorinated alkyl substances despite similarities in treatment processes. In nine out of the ten plants sampled, at least one class of fluorinated alkyl substances exhibited increased concentrations in the effluent as compared to the influent concentrations. In some instances, decreases in certain fluorinated analyte concentrations were observed and attributed to sorption to sludge. PMID:16433363
Deguchi, Yuki; Kohno, Yuki; Ohno, Hiroyuki
2015-06-07
Thermoresponsive polyelectrolyte hydrogels, derived from tetra-n-alkylphosphonium 3-sulfopropyl methacrylate-type ionic liquid monomers, show reversible water uptake/release, in which the gels absorb/desorb water for at least ten cycles via a lower critical solution temperature-type phase transition.
High pressure liquid chromatographic gradient mixer
Daughton, Christian G.; Sakaji, Richard H.
1985-01-01
A gradient mixer which effects the continuous mixing of any two miscible solvents without excessive decay or dispersion of the resultant isocratic effluent or of a linear or exponential gradient. The two solvents are fed under low or high pressure by means of two high performance liquid chromatographic pumps. The mixer comprises a series of ultra-low dead volume stainless steel tubes and low dead volume chambers. The two solvent streams impinge head-on at high fluxes. This initial nonhomogeneous mixture is then passed through a chamber packed with spirally-wound wires which cause turbulent mixing thereby homogenizing the mixture with minimum "band-broadening".
High-pressure liquid chromatographic gradient mixer
Daughton, C.G.; Sakaji, R.H.
1982-09-08
A gradient mixer effects the continuous mixing of any two miscible solvents without excessive decay or dispersion of the resultant isocratic effluent or of a linear or exponential gradient. The two solvents are fed under low or high pressure by means of two high performance liquid chromatographic pumps. The mixer comprises a series of ultra-low dead volume stainless steel tubes and low dead volume chambers. The two solvent streams impinge head-on at high fluxes. This initial nonhomogeneous mixture is then passed through a chamber packed with spirally-wound wires which cause turbulent mixing thereby homogenizing the mixture with minimum band-broadening.
Waste Management Project fiscal year 1998 multi-year work plan, WBS 1.2
DOE Office of Scientific and Technical Information (OSTI.GOV)
Jacobsen, P.H.
The Waste Management Project manages and integrates (non-TWRS) waste management activities at the site. Activities include management of Hanford wastes as well as waste transferred to Hanford from other DOE, Department of Defense, or other facilities. This work includes handling, treatment, storage, and disposal of radioactive, nonradioactive, hazardous, and mixed solid and liquid wastes. Major Waste Management Projects are the Solid Waste Project, Liquid Effluents Project, and Analytical Services. Existing facilities (e.g., grout vaults and canyons) shall be evaluated for reuse for these purposes to the maximum extent possible.
Comparative drug release measurements in limited amounts of liquid: a suppository formulation study.
Welch, Ken; Ek, Ragnar; Strømme, Maria
2006-07-01
A novel method for the investigation of drug formulations in limited liquid volumes is presented. The experimental setup consists of a measurement cell containing an absorbent sponge cloth placed between two parallel electrodes. Conductivity measurements are used to monitor the drug release from the dosage form. By varying the amount of water contained in the absorbent cloth surrounding the dosage form, it is possible to measure the drug release performance of the dosage form in very limited amounts of water. The method was employed to test four different tablet formulations consisting of the model drug NaCl incorporated in excipient matrices of hard fat, polyethylene glycol, microcrystalline cellulose and a mixture of microcrystalline cellulose and croscarmellose sodium (Ac-Di-Sol). The drug release rates of the different formulations in limited water volumes differed markedly from the release rates in an excess of water. Whereas the release rates from all tablet types in an excess of water showed only minor differences among the tablet types, the release rates from the tablets formulated with disintegrating excipients were clearly superior in limited water volumes. The developed method for drug release in limited volumes of liquid should be suitable for evaluation of rectal dosage forms.
Senta, Ivan; Krizman-Matasic, Ivona; Terzic, Senka; Ahel, Marijan
2017-08-04
Macrolide antibiotics are a prominent group of emerging contaminants frequently found in wastewater effluents and wastewater-impacted aquatic environments. In this work, a novel analytical method for simultaneous determination of parent macrolide antibiotics (azithromycin, erythromycin, clarithromycin and roxithromycin), along with their synthesis intermediates, byproducts, metabolites and transformation products in wastewater and surface water was developed and validated. Samples were enriched using solid-phase extraction on Oasis HLB cartridges and analyzed by reversed-phase liquid chromatography coupled to electrospray ionization tandem mass spectrometry. The target macrolide compounds were separated on an ACE C18 PFP column and detected using multiple reaction monitoring in positive ionization polarity. The optimized method, which included an additional extract clean-up on strong anion-exchange cartridges (SAX), resulted in high recoveries and accuracies, low matrix effects and improved chromatographic separation of the target compounds, even in highly complex matrices, such as raw wastewater. The developed method was applied to the analysis of macrolide compounds in wastewater and river water samples from Croatia. In addition to parent antibiotics, several previously unreported macrolide transformation products and/or synthesis intermediates were detected in municipal wastewater, some of them reaching μg/L levels. Moreover, extremely high concentrations of macrolides up to mg/L level were found in pharmaceutical industry effluents, indicating possible importance of this source to the total loads into ambient waters. The results revealed a significant contribution of synthesis intermediates and transformation products to the overall mass balance of macrolides in the aquatic environment. Copyright © 2017. Published by Elsevier B.V.
Parrott, Joanne L.; Tillitt, Donald E.
1997-01-01
Semipermeable membrane devices (SPMDs) are sampling and concentrating devices comprised of a thin polyethylene membrane containing a small quantity of triolein. They have previously been used to sample air, water and sediments and have concentrated fish tainting compounds from pulp mill effluents. The ability to induce mixed function oxygenases (MFOs) is a property of a variety of organic effluents, but the compound(s) responsible for induction have not been identified. We wanted to see if SPMDs would accumulate the MFO-inducing chemical(s) from pulp mill effluents and oil refinery effluents. Dialysates of effluent-exposed SPMDs induced ethoxyresorufin-O-deethylase (EROD) activity in a fish (Poeciliopsis lucida) hepatoma cell line, PLHC-1. In pulp mill effluents and oil sands mining and refining wastewaters, potencies varied greatly, from a few to thousands of pg TCDD-EQ/g SPMD. Low levels of inducers were seen in four pulp mills on the Athabasca R., and higher levels at one New Brunswick bleached sulphite and two Ontario bleached kraft pulp mills. The highest levels of MFO inducers were in SPMDs deployed for 14 days in wastewater from an oil sands upgrading facility, as well as SPMDs deployed at two sites on Athabasca River tributaries in the oil sands area. This suggests that natural erosion and weathering, as well as industrial processing of the oil sands, can release potent MFO inducers. Background (reference) induction by SPMD extracts ranged from non-detectable (<1) to 20 pg TCDD-EQ/g SPMD. Reactive clean-up of one of the bleached kraft mill effluent-exposed SPMD extracts on a sulfuric acid/silica gel column resulted in loss of the inducer(s), which suggested a polyaromatic hydrocarbon-type of inducing chemical(s), rather than a dioxin or furan inducer. SPMD deployments proved useful in the detection of inducers within the pulp mill process streams as extracts of SPMDs exposed to untreated bleached sulphite effluent were ten to twenty times as potent as those from secondary-treated effluent. Little is known about the nature and identity of the MFO inducers from pulp mill and refinery effluents, but the use of SPMDs as concentrators of MFO-inducing substances appears a promising avenue for future research.
Aymerich, I; Acuña, V; Barceló, D; García, M J; Petrovic, M; Poch, M; Rodriguez-Mozaz, S; Rodríguez-Roda, I; Sabater, S; von Schiller, D; Corominas, Ll
2016-09-01
Pharmaceuticals are designed to improve human and animal health, but may also be a threat to freshwater ecosystems, particularly after receiving urban or wastewater treatment plant (WWTP) effluents. Knowledge on the fate and attenuation of pharmaceuticals in engineered and natural ecosystems is rather fragmented, and comparable methods are needed to facilitate the comprehension of those processes amongst systems. In this study the dynamics of 8 pharmaceuticals (acetaminophen, sulfapyridine, sulfamethoxazole, carbamazepine, venlafaxine, ibuprofen, diclofenac, diazepam) and 11 of their transformation products were investigated in a WWTP and the associated receiving river ecosystem. During 3 days, concentrations of these compounds were quantified at the influents, effluents, and wastage of the WWTP, and at different distances downstream the effluent at the river. Attenuation (net balance between removal and release from and to the water column) was estimated in both engineered and natural systems using a comparable model-based approach by considering different uncertainty sources (e.g. chemical analysis, sampling, and flow measurements). Results showed that pharmaceuticals load reduction was higher in the WWTP, but attenuation efficiencies (as half-life times) were higher in the river. In particular, the load of only 5 out of the 19 pharmaceuticals was reduced by more than 90% at the WWTP, while the rest were only partially or non-attenuated (or released) and discharged into the receiving river. At the river, only the load of ibuprofen was reduced by more than 50% (out of the 6 parent compounds present in the river), while partial and non-attenuation (or release) was observed for some of their transformation products. Linkages in the routing of some pharmaceuticals (venlafaxine, carbamazepine, ibuprofen and diclofenac) and their corresponding transformation products were also identified at both WWTP and river. Finally, the followed procedure showed that dynamic attenuation in the coupled WWTP-river system could be successfully predicted with simple first order attenuation kinetics for most modeled compounds. Copyright © 2016 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Lettmann, K.; Kirchner, J.; Schnetger, B.; Wolff, J. O.; Brumsack, H. J.
2016-12-01
Rising CO2-emissions accompanying the industrial revolution are the main drivers for climate change and ocean acidification. Several methods have been developed to capture CO2 from effluents and reduce emission. Here, we consider a promising approach that mimics natural limestone weathering: CO2 in effluent gas streams reacts with calcium carbonate in a limestone suspension. The resulting bicarbonate-rich solution can be released into natural systems. In comparison to classical carbon capture and storage (CCS) methods this artificial limestone weathering is cheaper and does not involve using toxic chemical compounds. Additionally there is no need for the controversially discussed storage of CO2 underground. The reduction of CO2-emissions becomes more important for European industries as the EU introduced a system that limits the amount of allowable CO2-emissions. Therefore, large CO2 emitters are forced to find cheap methods for emission reduction, as they often cannot circumvent CO2-production. The method mentioned above is especially of interest for power plants located close to the coast that are already using seawater for cooling purposes. Thus, it is important to estimate the environmental effects if several coastal power plants will release high amounts of bicarbonate-rich waters into coastal waters, e.g. the North Sea. In a first pilot study, the unstructured-grid finite-volume community ocean model (FVCOM) was combined with a chemical submodul (mocsy 2.0) to model the hydrodynamic circulation and mixing of bicarbonate-rich effluents from a gas power plant located at the German North Sea coast. Here, we present the first preliminary results of this project, which include modelled changes of the North Sea carbonate system and changes in pH value after the introduction of these bicarbonate-rich waters on short time scales up to one year.
Changes in metal mobility associated with bark beetle-induced tree mortality.
Mikkelson, Kristin M; Bearup, Lindsay A; Navarre-Sitchler, Alexis K; McCray, John E; Sharp, Jonathan O
2014-05-01
Recent large-scale beetle infestations have caused extensive mortality to conifer forests resulting in alterations to dissolved organic carbon (DOC) cycling, which in turn can impact metal mobility through complexation. This study analyzed soil-water samples beneath impacted trees in concert with laboratory flow-through soil column experiments to explore possible impacts of the bark beetle infestation on metal release and transport. The columns mimicked field conditions by introducing pine needle leachate and artificial rainwater through duplicate homogenized soil columns and measuring effluent metal (focusing on Al, Cu, and Zn) and DOC concentrations. All three metals were consistently found in higher concentrations in the effluent of columns receiving pine needle leachate. In both the field and laboratory, aluminum mobility was largely correlated with the hydrophobic fraction of the DOC, while copper had the largest correlation with total DOC concentrations. Geochemical speciation modeling supported the presence of DOC-metal complexes in column experiments. Copper soil water concentrations in field samples supported laboratory column results, as they were almost twice as high under grey phase trees than under red phase trees further signifying the importance of needle drop. Pine needle leachate contained high concentrations of Zn (0.1 mg l(-1)), which led to high effluent zinc concentrations and sorption of zinc to the soil matrix representing a future potential source for release. In support, field soil-water samples underneath beetle-impacted trees where the needles had recently fallen contained approximately 50% more zinc as samples from under beetle-impacted trees that still held their needles. The high concentrations of carbon in the pine needle leachate also led to increased sorption in the soil matrix creating the potential for subsequent carbon release. While unclear if manifested in adjacent surface waters, these results demonstrate an increased potential for Zn, Cu, and Al mobility, along with increased deposition of metals and carbon beneath beetle-impacted trees.
Wu, Desheng; Song, Yu; Xie, Kefan; Zhang, Baofeng
2018-04-25
Chemical accidents are major causes of environmental losses and have been debated due to the potential threat to human beings and environment. Compared with the single statistical analysis, co-word analysis of chemical accidents illustrates significant traits at various levels and presents data into a visual network. This study utilizes a co-word analysis of the keywords extracted from the Web crawling texts of environmental loss-related chemical accidents and uses the Pearson's correlation coefficient to examine the internal attributes. To visualize the keywords of the accidents, this study carries out a multidimensional scaling analysis applying PROXSCAL and centrality identification. The research results show that an enormous environmental cost is exacted, especially given the expected environmental loss-related chemical accidents with geographical features. Meanwhile, each event often brings more than one environmental impact. Large number of chemical substances are released in the form of solid, liquid, and gas, leading to serious results. Eight clusters that represent the traits of these accidents are formed, including "leakage," "poisoning," "explosion," "pipeline crack," "river pollution," "dust pollution," "emission," and "industrial effluent." "Explosion" and "gas" possess a strong correlation with "poisoning," located at the center of visualization map.
Characterizing shipboard bilgewater effluent before and after treatment.
McLaughlin, Christine; Falatko, Debra; Danesi, Robin; Albert, Ryan
2014-04-01
Operational discharges from oceangoing vessels, including discharges of bilgewater, release oil into marine ecosystems that can potentially damage marine life, terrestrial life, human health, and the environment. Bilgewater is a mix of oily fluids and other pollutants from a variety of sources onboard a vessel. If bilgewater cannot be retained onboard, it must be treated by an oily water separator before discharge for larger ocean-going vessels. We evaluated the effectiveness of bilgewater treatment systems by analyzing land-based type approval data, collecting and analyzing shipboard bilgewater effluent data, assessing bilgewater effluent concentrations compared to regulatory standards, evaluating the accuracy of shipboard oil content monitors relative to analytical results, and assessing additional pollution reduction benefits of treatment systems. Land-based type approval data were gathered for 20 treatment systems. Additionally, multiple samples of influent and effluent from operational bilgewater treatment systems onboard three vessels were collected and analyzed, and compared to the land-based type approval data. Based on type approval data, 15 treatment systems were performing below 5 ppm oil. Shipboard performance measurements verified land-based type approval data for the three systems that were sampled. However, oil content monitor readings were more variable than actual oil concentration measurements from effluent samples, resulting in false negatives and positives. The treatment systems sampled onboard for this study generally reduced the majority of other potentially harmful pollutants, which are not currently regulated, with the exception of some heavy metal analytes.
NASA Astrophysics Data System (ADS)
Picó, Yolanda; Andres-Costa, M. Jesus; Andreu, Vicente
2014-05-01
Drugs of abuse are continuously discharged into wastewaters due to human excretion as parent compounds and/or secondary metabolites after consumption or accidental disposal into the toilets. (Boles and Wells,2010). Incomplete removal of these compounds during wastewater treatment results in their release to the environment. Pollution by illicit drug residues at very low concentrations is generalized in populated areas, with potential risks for human health and the environment. The impact of treated wastewater effluent on the quality of receiving waters can be evaluated performing an investigated performing an ecotoxicological risk assessment calculating the risk quotient (RQ) of the drugs of abuse level observed. In addition, back-calculation from the concentration of illicit drug in the influents of wastewater treatment plants (WWTPs) provides an important tool for estimating its local consumption (Daughton 2001). Sampling campaigns were in three years, 2011 (March 9th to 15th), 2012 (April 17th to May 1st) and 2013 (March 6th to 12th) in influents and effluents from 3 Wastewater Treatment Plants (WWTPs), Pinedo I, Pinedo II and Quart-Benàger, that treats most of the wastewater of Valencia City and its surrounding towns. Cocaine (COC), amphetamine (AMP), methamphetamine (MAMP), ecstasy (MDMA) and ketamine (KET), Benzoylecgonine (BE), 6-acethylmorphine (6-MAM), and 11-nor-9-carboxy-delta9-tetrahydrocannabinol (THC-COOH) were analyzed using mass spectrometry techniques such as liquid chromatography triple quadrupole mass spectrometry (LC-QqQ-MS/MS) Illicit drugs were extracted using solid phase extraction (SPE) and determined by liquid chromatography tandem mass spectrometry (LC-MS/MS) in positive ionization with an electrospray ionization source (ESI). The determination of drugs of abuse in the influent of the selected WWTP shows that all compounds were detected in 100% of influents from Pinedo I, Pinedo II and Quart-Benàger in samples analyzed during three years of monitoring period, with the exception of 6-ACMOR. Regarding the determination of drugs of abuse in the effluent, the compounds with the highest removals (100%) were AMP, MAMP, THC-COOH and COC. BECG values of removal efficiency ranged from 93.4% in Quart-Benàger to 98.5% in Pinedo II. MDMA removal efficiency is variable depending on the WWTPs while ketamine removal efficiency was negligible. Ecotoxicological risk were calculated for drugs of abuse founded in the effluents of the WWTPs. MDMA could pose a medium risk, KET could pose low risk to the aquatic organisms while BECG couldn't pose environmental risk. Acknowledgements This work has been supported by the Spanish Ministry of Economy and Competitiveness trough the project SCARCE-CDS 2009-0065, CGL 2011-29703-C02-01 and GCL CGL 2011-29703-C02-02. MJ Andrés Costa also acknowledges to this Ministry the FPI grant to perform her PhD. References Boles TH., Wells MJM. Analysis of amphetamine and methamphetamine as emerging pollutants in wastewater and wastewater-impacted streams. Journal of Chromatography A 2010; 1217: 2561-2568. Daughton CG In: Daughton CG., Jones-Lepp TL., editors Pharmaceuticals and personal care products in the environment. Scientific and regulatory issues. Washington: Americal Chemical Society (2001) , 348-164.
Houtz, Erika F; Sutton, Rebecca; Park, June-Soo; Sedlak, Margaret
2016-05-15
In late 2014, wastewater effluent samples were collected from eight treatment plants that discharge to San Francisco (SF) Bay in order to assess poly- and perfluoroalkyl substances (PFASs) currently released from municipal and industrial sources. In addition to direct measurement of twenty specific PFAS analytes, the total concentration of perfluoroalkyl acid (PFAA) precursors was also indirectly measured by adapting a previously developed oxidation assay. Effluent from six municipal treatment plants contained similar amounts of total PFASs, with highest median concentrations of PFHxA (24 ng/L), followed by PFOA (23 ng/L), PFBA (19 ng/L), and PFOS (15 ng/L). Compared to SF Bay municipal wastewater samples collected in 2009, the short chain perfluorinated carboxylates PFBA and PFHxA rose significantly in concentration. Effluent samples from two treatment plants contained much higher levels of PFASs: over two samplings, wastewater from one municipal plant contained an average of 420 ng/L PFOS and wastewater from an airport industrial treatment plant contained 560 ng/L PFOS, 390 ng/L 6:2 FtS, 570 ng/L PFPeA, and 500 ng/L PFHxA. The elevated levels observed in effluent samples from these two plants are likely related to aqueous film forming foam (AFFF) sources impacting their influent; PFASs attributable to both current use and discontinued AFFF formulations were observed. Indirectly measured PFAA precursor compounds accounted for 33%-63% of the total molar concentration of PFASs across all effluent samples and the PFAA precursors indicated by the oxidation assay were predominately short-chained. PFAS levels in SF Bay effluent samples reflect the manufacturing shifts towards shorter chained PFASs while also demonstrating significant impacts from localized usage of AFFF. Copyright © 2016 Elsevier Ltd. All rights reserved.
Mantilla-Calderon, David
2017-01-01
ABSTRACT The presence of emerging biological pollutants in treated wastewater effluents has gained attention due to increased interest in water reuse. To evaluate the effectiveness of the removal of such contaminants by the conventional wastewater treatment process, the fate and decay kinetics of NDM-1-positive Escherichia coli strain PI7 and its plasmid-encoded antibiotic resistance genes (ARGs) were assessed in microcosms of anaerobic and aerobic sludge. Results showed that E. coli PI7 decayed at a significantly lower rate under anaerobic conditions. Approximate half-lives were 32.4 ± 1.4 h and 5.9 ± 0.9 h in the anaerobic and aerobic microcosms, respectively. In the aerobic microcosms, after 72 h of operation, E. coli PI7 remained detectable, but no further decay was observed. Instead, 1 in every 10,000 E. coli cells was identified to be recalcitrant to decay and persist indefinitely in the sludge. ARGs associated with the E. coli PI7 strain were detected to have transferred to other native microorganisms in the sludge or were released to the liquid fraction upon host decay. Extracellular DNA quickly degraded in the liquid fraction of the aerobic sludge. In contrast, no DNA decay was detected in the anaerobic sludge water matrix throughout the 24-h sampling period. This study suggests an increased likelihood of environmental dispersion of ARGs associated with anaerobically treated wastewater effluents and highlights the potential importance of persister cells in the dissemination of E. coli in the environment during reuse events of treated wastewater. IMPORTANCE This study examines the decay kinetics of a pathogenic and antibiotic resistant strain of Escherichia coli in microcosms simulating biological treatment units of aerobic and anaerobic sludge. The results of this study point at a significantly prolonged persistence of the E. coli and the associated antibiotic resistance gene in the anaerobic sludge. However, horizontal transfer of the plasmid encoding the antibiotic resistance gene was detected in the aerobic sludge by a cultivation method. A subpopulation of persister E. coli cells was also detected in the aerobic sludge. The findings of this study suggest potential areas of concern arising from pathogenic and antibiotic-resistant E. coli during both anaerobic and aerobic sludge treatment processes. PMID:28411227
Mantilla-Calderon, David; Hong, Pei-Ying
2017-07-01
The presence of emerging biological pollutants in treated wastewater effluents has gained attention due to increased interest in water reuse. To evaluate the effectiveness of the removal of such contaminants by the conventional wastewater treatment process, the fate and decay kinetics of NDM-1-positive Escherichia coli strain PI7 and its plasmid-encoded antibiotic resistance genes (ARGs) were assessed in microcosms of anaerobic and aerobic sludge. Results showed that E. coli PI7 decayed at a significantly lower rate under anaerobic conditions. Approximate half-lives were 32.4 ± 1.4 h and 5.9 ± 0.9 h in the anaerobic and aerobic microcosms, respectively. In the aerobic microcosms, after 72 h of operation, E. coli PI7 remained detectable, but no further decay was observed. Instead, 1 in every 10,000 E. coli cells was identified to be recalcitrant to decay and persist indefinitely in the sludge. ARGs associated with the E. coli PI7 strain were detected to have transferred to other native microorganisms in the sludge or were released to the liquid fraction upon host decay. Extracellular DNA quickly degraded in the liquid fraction of the aerobic sludge. In contrast, no DNA decay was detected in the anaerobic sludge water matrix throughout the 24-h sampling period. This study suggests an increased likelihood of environmental dispersion of ARGs associated with anaerobically treated wastewater effluents and highlights the potential importance of persister cells in the dissemination of E. coli in the environment during reuse events of treated wastewater. IMPORTANCE This study examines the decay kinetics of a pathogenic and antibiotic resistant strain of Escherichia coli in microcosms simulating biological treatment units of aerobic and anaerobic sludge. The results of this study point at a significantly prolonged persistence of the E. coli and the associated antibiotic resistance gene in the anaerobic sludge. However, horizontal transfer of the plasmid encoding the antibiotic resistance gene was detected in the aerobic sludge by a cultivation method. A subpopulation of persister E. coli cells was also detected in the aerobic sludge. The findings of this study suggest potential areas of concern arising from pathogenic and antibiotic-resistant E. coli during both anaerobic and aerobic sludge treatment processes. Copyright © 2017 Mantilla-Calderon and Hong.
Vishwakarma, V K; Goyal, A; Gupta, J K; Upadhyay, P K; Yadav, H N
2018-07-01
Nitric oxide (NO) is an effective mediator of ischemic preconditioning (IPC)-induced cardioprotection. Atrial natriuretic peptide (ANP) is downregulated after ovariectomy, which results in reduction in the level of NO. The present study deals with the investigation of the role of ANP in abrogated cardioprotective effect of IPC in the ovariectomized rat heart. Heart was isolated from ovariectomized rat and mounted on Langendorff's apparatus, subjected to 30 min of ischemia and 120 min of reperfusion. IPC was given by four cycles of 5 min of ischemia and 5 min of reperfusion with Krebs-Henseleit solution. The myocardial infract size was estimated employing triphenyltetrazolium chloride stain, and coronary effluent was analyzed for creatine kinase-MB (CK-MB) and lactate dehydrogenase (LDH) release to consider the degree of myocardial injury. The cardiac release of NO was estimated by measuring the level of nitrite in coronary effluent. IPC-mediated cardioprotection was significantly attenuated in ovariectomized rat as compared to normal rat, which was restored by perfusion with ANP. However, this observed cardioprotection was significantly attenuated by perfusion with L-NAME, an endothelial nitric oxide synthase inhibitor, and Glibenclamide, a K ATP channel blocker, alone or in combination noted in terms of increase in myocardial infract size, release of CK-MB and LDH, and also decrease in release of NO. Thus, it is suggested that ANP restores the attenuated cardioprotective effect of IPC in the ovariectomized rat heart which may be due to increase in the availability of NO and consequent increase activation of mitochondrial K ATP channels.
Deycard, Victoria N; Schäfer, Jörg; Petit, Jérôme C J; Coynel, Alexandra; Lanceleur, Laurent; Dutruch, Lionel; Bossy, Cécile; Ventura, Alexandre; Blanc, Gérard
2017-01-01
Although silver (Ag) has been listed as a priority pollutant for the aquatic environment by the European Union (Directive 2006/11/EC), the use of Ag-based products with antimicrobial effects is increasing in Europe, as well as North America and Asia. This study investigates personal care products (PCP) as a potential source of Ag in wastewater, as well as the dynamics and fate of Ag in the influent and effluent of a major urban wastewater treatment plant (WWTP) located on the fluvial part of the Gironde Estuary. Typical household PCPs marked as using Ag contained concentrations of up to 0.4 mg kg -1 making them likely contributors to urban Ag released into the aquatic environment. Silver concentrations in influent wastewater generally occurred during mid-week working hours and decreased during the night and on weekends clearly indicating the dominance of urban sources. Up to 90% of the total Ag in wastewater was bound to particles and efficiently (>80%) removed by the treatment process, whereas 20% of Ag was released into the fluvial estuary. Silver concentrations in wastewater effluents clearly exceeded estuarine concentrations and may strongly amplify the local Ag concentrations and fluxes, especially during summer rainstorms in low river discharge conditions. Further work should focus on environmental effects and fate of urban Ag release due to immediate localized outfall and/or the adsorption on estuarine particles and subsequent release as dissolved Ag chloro-complexes within the estuarine salinity gradient. Copyright © 2016 Elsevier Ltd. All rights reserved.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Ramsdell, J.V.; Athey, G.F.; Glantz, C.S.
1983-11-01
MESOI Version 2.0 is an interactive Lagrangian puff model for estimating the transport, diffusion, deposition and decay of effluents released to the atmosphere. The model is capable of treating simultaneous releases from as many as four release points, which may be elevated or at ground-level. The puffs are advected by a horizontal wind field that is defined in three dimensions. The wind field may be adjusted for expected topographic effects. The concentration distribution within the puffs is initially assumed to be Gaussian in the horizontal and vertical. However, the vertical concentration distribution is modified by assuming reflection at the groundmore » and the top of the atmospheric mixing layer. Material is deposited on the surface using a source depletion, dry deposition model and a washout coefficient model. The model also treats the decay of a primary effluent species and the ingrowth and decay of a single daughter species using a first order decay process. This report is divided into two parts. The first part discusses the theoretical and mathematical bases upon which MESOI Version 2.0 is based. The second part contains the MESOI computer code. The programs were written in the ANSI standard FORTRAN 77 and were developed on a VAX 11/780 computer. 43 references, 14 figures, 13 tables.« less
Silver Dissolution and Release from Ceramic Water Filters.
Mittelman, Anjuliee M; Lantagne, Daniele S; Rayner, Justine; Pennell, Kurt D
2015-07-21
Application of silver nanoparticles (nAg) or silver nitrate (AgNO3) has been shown to improve the microbiological efficacy of ceramic water filters used for household water treatment. Silver release, however, can lead to undesirable health effects and reduced filter effectiveness over time. The objectives of this study were to evaluate the contribution of nanoparticle detachment, dissolution, and cation exchange to silver elution, and to estimate silver retention under different influent water chemistries. Dissolved silver (Ag(+)) and nAg release from filter disks painted with 0.03 mg/g casein-coated nAg or AgNO3 were measured as a function of pH (5-9), ionic strength (1-50 mM), and cation species (Na(+), Ca(2+), Mg(2+)). Silver elution was controlled by dissolution as Ag(+) and subsequent cation exchange reactions regardless of the applied silver form. Effluent silver levels fell below the drinking water standard (0.1 mg/L) after flushing with 30-42 pore volumes of pH 7, 10 mM NaNO3 at pH 7. When the influent water was at pH 5, contained divalent cations or 50 mM NaNO3, silver concentrations were 5-10 times above the standard. Our findings support regular filter replacement and indicate that saline, hard, or acidic waters should be avoided to minimize effluent silver concentrations and preserve silver treatment integrity.
19 CFR 12.3 - Release under bond; liquidated damages.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 19 Customs Duties 1 2014-04-01 2014-04-01 false Release under bond; liquidated damages. 12.3 Section 12.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Food, Drugs, and Cosmetics, Economic Poisons...
19 CFR 12.3 - Release under bond; liquidated damages.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 19 Customs Duties 1 2013-04-01 2013-04-01 false Release under bond; liquidated damages. 12.3 Section 12.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Food, Drugs, and Cosmetics, Economic Poisons...
19 CFR 12.3 - Release under bond; liquidated damages.
Code of Federal Regulations, 2012 CFR
2012-04-01
... 19 Customs Duties 1 2012-04-01 2012-04-01 false Release under bond; liquidated damages. 12.3 Section 12.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Food, Drugs, and Cosmetics, Economic Poisons...
19 CFR 12.3 - Release under bond; liquidated damages.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 19 Customs Duties 1 2011-04-01 2011-04-01 false Release under bond; liquidated damages. 12.3 Section 12.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Food, Drugs, and Cosmetics, Economic Poisons...
19 CFR 12.3 - Release under bond; liquidated damages.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Release under bond; liquidated damages. 12.3 Section 12.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Food, Drugs, and Cosmetics, Economic Poisons...
Ogbi, Mourad; Obi, Ijeoma; Johnson, John A.
2013-01-01
We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n = 5) percentage of maximal cTnI release was 30±7 and 60±17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60–150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts. PMID:23936451
Predicting the physical effects of relocating Boston's sewage outfall
Signell, R.P.; Jenter, H.L.; Blumberg, A.F.
2000-01-01
Boston is scheduled to cease discharge of sewage effluent in Boston Harbor in Spring 2000 and begin discharge at a site 14 km offshore in Massachusetts Bay in a water depth of about 30 m. The effects of this outfall relocation on effluent dilution, salinity and circulation are predicted with a three-dimensional hydrodynamic model. The simulations predict that the new bay outfall will greatly decrease effluent concentrations in Boston Harbor (relative to the harbour outfall) and will not significantly change mean effluent concentrations over most of Massachusetts Bay. With the harbour outfall, previous observations and these simulations show that effluent concentrations exceed 0??5% throughout the harbour, with a harbour wide average of 1-2%. With the bay outfall, effluent concentrations exceed 0??5% only within a few km of the new outfall, and harbour concentrations drop to 0??1-0??2%, a 10-fold reduction. During unstratified winter conditions, the local increase in effluent concentration at the bay outfall site is predicted to exist throughout the water column. During stratified summer conditions, however, effluent released at the sea bed rises and is trapped beneath the pycnocline. The local increase in effluent concentration is limited to the lower layer, and as a result, surface layer effluent concentrations in the vicinity of the new outfall site are predicted to decrease (relative to the harbour outfall) during the summer. Slight changes are predicted for the salinity and circulation fields. Removing the fresh water associated with the effluent discharge in Boston Harbor is predicted to increase the mean salinity of the harbour by 0??5 and decrease the mean salinity by 0??10-0??15 within 2-3 km of the outfall. Relative to the existing mean flow, the buoyant discharge at the new outfall is predicted to generate density-driven mean currents of 2-4 cm s-1 that spiral out in a clockwise motion at the surface during winter and at the pycnocline (15-20 m depth) during summer. Compensating counterclockwise currents are predicted to spiral in toward the source at the bottom. Because the scale of the residual current structure induced by the new discharge is comparable to or smaller than typical subtidal water parcel excursions, Lagrangian trajectories will not follow the Eulerian residual flow. Thus, mean currents measured from moorings within 5 km of the bay outfall site will be more useful for model comparison than to indicate net transport pathways.
Siegrist, H; Hunziker, W; Hofer, H
2005-01-01
Anaerobic digestion can adapt to free ammonia to a certain extent. During the anaerobic digestion of slaughterhouse waste, however, an ammonia concentration of up to 15 g Nl(-1) can be reached in the sludge liquid and this will even inhibit adapted sludge. To lower this concentration, a fraction of the digester liquid must therefore be continuously separated from the digested sludge and the free ammonia stripped before the liquid is recycled to the digester. A mesophilic laboratory digester was successfully operated with an ammonium concentration of 4-5g l(-1) and a pH of 8.0-8.4. After free ammonia stripping, the excess liquid was treated in a laboratory SBR for nitrogen and phosphorus removal before being added to the receiving water. The effluent had no toxic effect on daphnia and algae.
Determination of Pyrethroids through Liquid-Liquid Extraction and GC-ECD
NASA Astrophysics Data System (ADS)
Ding, B.
2010-12-01
Storm water samples from various locations in San Diego Creek and Newport Bay watershed, southern California, were taken to study the occurrence and fate of pyrethroids. This study focused on four commonly used pyrethroids: bifenthrin, cypermethrin, permethrin, and fenpropathrin. Since the ban of DDT, usage of pyrethroids became an effective second choice. However, pyrethroids are extremely toxic to fish and aquatic organisms. They can pass through secondary wastewater treatment system, causing the final effluent to be in lethal doses to aquatic invertebrates and some insects such as mayflies. Hence, it is necessary to monitor the amount of pyrethroid concentration in storm water. As a part of this study, I attended the RISE internship program at Stanford University in this summer. In the seven weeks, I learned liquid-liquid extraction, water-bath evaporation, nitrogen evaporation, and gas chromatography-electron capture detector techniques to extract and detect the pyrethroid residues in the water sample.
Summary and evaluation of the Strategic Defense Initiative Space Power Architecture Study
NASA Technical Reports Server (NTRS)
Edenburn, M. (Editor); Smith, J. M. (Editor)
1989-01-01
The Space Power Architecture Study (SPAS) identified and evaluated power subsystem options for multimegawatt electric (MMWE) space based weapons and surveillance platforms for the Strategic Defense Initiative (SDI) applications. Steady state requirements of less than 1 MMWE are adequately covered by the SP-100 nuclear space power program and hence were not addressed in the SPAS. Four steady state power systems less than 1 MMWE were investigated with little difference between them on a mass basis. The majority of the burst power systems utilized H(2) from the weapons and were either closed (no effluent), open (effluent release) or steady state with storage (no effluent). Closed systems used nuclear or combustion heat source with thermionic, Rankine, turboalternator, fuel cell and battery conversion devices. Open systems included nuclear or combustion heat sources using turboalternator, magnetohydrodynamic, fuel cell or battery power conversion devices. The steady state systems with storage used the SP-100 or Star-M reactors as energy sources and flywheels, fuel cells or batteries to store energy for burst applications. As with other studies the open systems are by far the lightest, most compact and simplist (most reliable) systems. However, unlike other studies the SPAS studied potential platform operational problems caused by effluents or vibration.
Molinos-Senante, M; Reif, R; Garrido-Baserba, M; Hernández-Sancho, F; Omil, F; Poch, M; Sala-Garrido, R
2013-09-01
Continuous release of pharmaceutical and personal care products (PPCPs) present in effluents from wastewater treatment plants (WWTPs) is nowadays leading to the adoption of specific measures within the framework of the Directive 2000/60/EC (Water Framework Directive). The ozonation process, normally employed for drinking water production, has also proven its potential to eliminate PPCPs from secondary effluents in spite of their low concentrations. However, there is a significant drawback related with the costs associated with its implementation. This lack of studies is especially pronounced regarding the economic valuation of the environmental benefits associated to avoid the discharge of these pollutants into water bodies. For the first time the shadow prices of 5 PPCPs which are ethynilestradiol, sulfamethoxazole, diclofenac, tonalide and galaxolide from treated effluent using a pilot-scale ozonation reactor have been estimated. From non-sensitive areas their values are -73.73; -34.95; -42.20; -10.98; and -8.67 respectively and expressed in €/kg. They represent a proxy to the economic value of the environmental benefits arisen from undischarged pollutants. This paper contributes to value the environmental benefits of implementing post-treatment processes aimed to achieve the quality standards required by the Priority Substances Directive. Copyright © 2013 Elsevier B.V. All rights reserved.
Reif, R; Besancon, A; Le Corre, K; Jefferson, B; Lema, J M; Omil, F
2011-01-01
The presence in the aquatic environment of xenobiotics such as Pharmaceutical and Personal Care Products (PPCPs) has emerged as an issue of concern. Upgrading sewage treatment quality with modern technologies such as Membrane Bioreactors (MBRs) and/or implementing a further posttreatment might mitigate the release of xenobiotics into surface waters. The performance of two processes treating municipal sewage, a MBR and an Activated Sludge (AS) unit, have been compared in terms of PPCPs removal. Moreover, their effluents were treated using vertical flow reed beds. Both systems were operated under similar conditions, more specifically Hydraulic Retention Time (HRT), maintained at 8 hours, and Sludge Retention Time (SRT) set at 6 and 20 days. Pharmaceuticals belong to therapeutic groups such as antiepileptics (carbamazepine) and analgesics (ibuprofen, naproxen, diclofenac), whereas the personal care products are musk fragrances (galaxolide and tonalide). Xenobiotics removals achieved in the MBR showed better results, particularly for the acidic drugs ibuprofen (87% vs. 50%) and naproxen (56% vs. 6%) operating at low SRT. After filtration through vertical flow reed-beds, PPCPs content in effluents was decreased, below 1 ppb in most cases, improving the effluent quality and confirming reed-beds as an interesting low cost alternative in order to attenuate xenobiotics contamination.
Ziajahromi, Shima; Neale, Peta A; Rintoul, Llew; Leusch, Frederic D L
2017-04-01
Wastewater effluent is expected to be a pathway for microplastics to enter the aquatic environment, with microbeads from cosmetic products and polymer fibres from clothes likely to enter wastewater treatment plants (WWTP). To date, few studies have quantified microplastics in wastewater. Moreover, the lack of a standardized and applicable method to identify microplastics in complex samples, such as wastewater, has limited the accurate assessment of microplastics and may lead to an incorrect estimation. This study aimed to develop a validated method to sample and process microplastics from wastewater effluent and to apply the developed method to quantify and characterise wastewater-based microplastics in effluent from three WWTPs that use primary, secondary and tertiary treatment processes. We applied a high-volume sampling device that fractionated microplastics in situ and an efficient sample processing procedure to improve the sampling of microplastics in wastewater and to minimize the false detection of non-plastic particles. The sampling device captured between 92% and 99% of polystyrene microplastics using 25 μm-500 μm mesh screens in laboratory tests. Microplastic type, size and suspected origin in all studied WWTPs, along with the removal efficiency during the secondary and tertiary treatment stages, was investigated. Suspected microplastics were characterised using Fourier Transform Infrared spectroscopy, with between 22 and 90% of the suspected microplastics found to be non-plastic particles. An average of 0.28, 0.48 and 1.54 microplastics per litre of final effluent was found in tertiary, secondary and primary treated effluent, respectively. This study suggests that although low concentrations of microplastics are detected in wastewater effluent, WWTPs still have the potential to act as a pathway to release microplastics given the large volumes of effluent discharged to the aquatic environment. This study focused on a single sampling campaign, with long-term monitoring recommended to further characterise microplastics in wastewater. Copyright © 2017 Elsevier Ltd. All rights reserved.
Ciprofloxacin residue and antibiotic-resistant biofilm bacteria in hospital effluent.
Ory, Jérôme; Bricheux, Geneviève; Togola, Anne; Bonnet, Jean Louis; Donnadieu-Bernard, Florence; Nakusi, Laurence; Forestier, Christiane; Traore, Ousmane
2016-07-01
Discharge of antimicrobial residues and resistant bacteria in hospital effluents is supposed to have strong impacts on the spread of antibiotic resistant bacteria in the environment. This study aimed to characterize the effluents of the Gabriel Montpied teaching hospital, Clermont-Ferrand, France, by simultaneously measuring the concentration of ciprofloxacin and of biological indicators resistant to this molecule in biofilms formed in the hospital effluent and by comparing these data to ciprofloxacin consumption and resistant bacterial isolates of the hospital. Determination of the measured environmental concentration of ciprofloxacin by spot sampling and polar organic chemical integrative (POCIS) sampling over 2 weeks, and comparison with predicted environmental concentrations produced a hazard quotient >1, indicating a potential ecotoxicological risk. A negative impact was also observed with whole hospital effluent samples using the Tetrahymena pyriformis biological model. During the same period, biofilms were formed within the hospital effluent, and analysis of ciprofloxacin-resistant isolates indicated that Gamma-Proteobacteria were numerous, predominantly Aeromonadaceae (69.56%) and Enterobacteriaceae (22.61%). Among the 115 isolates collected, plasmid-mediated fluoroquinolone-resistant genes were detected, with mostly aac(6')-lb-cr and qnrS. In addition, 60% of the isolates were resistant to up to six antibiotics, including molecules mostly used in the hospital (aminosides and third-generation cephalosporins). In parallel, 1247 bacteria isolated from hospitalized patients and resistant to at least one of the fluoroquinolones were collected. Only 5 of the 14 species identified in the effluent biofilm were also found in the clinical isolates, but PFGE typing of the Gram-negative isolates found in both compartments showed there was no clonality among the strains. Altogether, these data confirm the role of hospital loads as sources of pollution for wastewater and question the role of environmental biofilms communities as efficient shelters for hospital-released resistance genes. Copyright © 2016 Elsevier Ltd. All rights reserved.
Goethite Bench-scale and Large-scale Preparation Tests
DOE Office of Scientific and Technical Information (OSTI.GOV)
Josephson, Gary B.; Westsik, Joseph H.
2011-10-23
The Hanford Waste Treatment and Immobilization Plant (WTP) is the keystone for cleanup of high-level radioactive waste from our nation's nuclear defense program. The WTP will process high-level waste from the Hanford tanks and produce immobilized high-level waste glass for disposal at a national repository, low activity waste (LAW) glass, and liquid effluent from the vitrification off-gas scrubbers. The liquid effluent will be stabilized into a secondary waste form (e.g. grout-like material) and disposed on the Hanford site in the Integrated Disposal Facility (IDF) along with the low-activity waste glass. The major long-term environmental impact at Hanford results from technetiummore » that volatilizes from the WTP melters and finally resides in the secondary waste. Laboratory studies have indicated that pertechnetate ({sup 99}TcO{sub 4}{sup -}) can be reduced and captured into a solid solution of {alpha}-FeOOH, goethite (Um 2010). Goethite is a stable mineral and can significantly retard the release of technetium to the environment from the IDF. The laboratory studies were conducted using reaction times of many days, which is typical of environmental subsurface reactions that were the genesis of this new process. This study was the first step in considering adaptation of the slow laboratory steps to a larger-scale and faster process that could be conducted either within the WTP or within the effluent treatment facility (ETF). Two levels of scale-up tests were conducted (25x and 400x). The largest scale-up produced slurries of Fe-rich precipitates that contained rhenium as a nonradioactive surrogate for {sup 99}Tc. The slurries were used in melter tests at Vitreous State Laboratory (VSL) to determine whether captured rhenium was less volatile in the vitrification process than rhenium in an unmodified feed. A critical step in the technetium immobilization process is to chemically reduce Tc(VII) in the pertechnetate (TcO{sub 4}{sup -}) to Tc(Iv)by reaction with the ferrous ion, Fe{sup 2+}-Fe{sup 2+} is oxidized to Fe{sup 3+} - in the presence of goethite seed particles. Rhenium does not mimic that process; it is not a strong enough reducing agent to duplicate the TcO{sub 4}{sup -}/Fe{sup 2+} redox reactions. Laboratory tests conducted in parallel with these scaled tests identified modifications to the liquid chemistry necessary to reduce ReO{sub 4}{sup -} and capture rhenium in the solids at levels similar to those achieved by Um (2010) for inclusion of Tc into goethite. By implementing these changes, Re was incorporated into Fe-rich solids for testing at VSL. The changes also changed the phase of iron that was in the slurry product: rather than forming goethite ({alpha}-FeOOH), the process produced magnetite (Fe{sub 3}O{sub 4}). Magnetite was considered by Pacific Northwest National Laboratory (PNNL) and VSL to probably be a better product to improve Re retention in the melter because it decomposes at a higher temperature than goethite (1538 C vs. 136 C). The feasibility tests at VSL were conducted using Re-rich magnetite. The tests did not indicate an improved retention of Re in the glass during vitrification, but they did indicate an improved melting rate (+60%), which could have significant impact on HLW processing. It is still to be shown whether the Re is a solid solution in the magnetite as {sup 99}Tc was determined to be in goethite.« less
Kujawa-Roeleveld, K; Elmitwalli, T; Zeeman, G
2006-01-01
Anaerobic digestion of concentrated domestic wastewater streams--black or brown water, and solid fraction of kitchen waste is considered as a core technology in a source separation based sanitation concept (DESAR--decentralised sanitation and reuse). A simple anaerobic digester can be implemented for an enhanced primary treatment or, in some situations, as a main treatment. Two reactor configurations were extensively studied; accumulation system (AC) and UASB septic tank at 15, 20 and 25 degrees C. Due to long retention times in an AC reactor, far stabilisation of treated medium can be accomplished with methanisation up to 60%. The AC systems are the most suitable to apply when the volume of waste to be treated is minimal and when a direct reuse of a treated medium in agriculture is possible. Digested effluent contains both liquid and solids. In a UASB septic tank, efficient separation of solids and liquid is accomplished. The total COD removal was above 80% at 25 degrees C. The effluent contains COD and nutrients, mainly in a soluble form. The frequency of excess sludge removal is low and sludge is well stabilised due to a long accumulation time.
Rajamani, Sengodagounder
2016-03-01
Conventional industrial effluent treatment systems are designed to reduce biochemical oxygen demand (BOD), chemical oxygen demand (COD) but not total dissolved solids (TDS), mainly contributed by chlorides. In addition to the removal of TDS, it is necessary to recover water for reuse to meet the challenges of shortage of quality water. To recover water, the wastewater needs to be further treated by adopting treatment systems including microfilters, low pressure membrane units such as ultrafiltration (UF), membrane bioreactors (MBR), etc., for the application of reverse osmosis (RO) systems. By adopting the RO system, 75%-80% of quality water with <500 mg/L of TDS is recovered from treated effluent. The management of 20%-25% of the saline water rejected from the RO system with high TDS concentration is being addressed by methods such as forced evaporation systems. The recovery of water from domestic and industrial waste for reuse has become a reality. The membrane system has been used for different applications. It has become mandatory to achieve zero liquid discharge (ZLD) in many states in India and other countries such as Spain, China, etc., and resulted in development of new treatment technologies to suit the local conditions.
Rubirola, Adrià; Boleda, Mª Rosa; Galceran, Mª Teresa
2017-04-14
This paper reports the development of a fully multiresidue and automated on-line solid phase extraction (SPE) - liquid chromatography tandem mass spectrometry (LC-MS/MS) method for the determination of 24 priority substances (PS) belonging to different classes (pesticides, hormones or pharmaceuticals) included in the Directive 2013/39/UE and the recent Watch List (Decision 2015/495) in water samples (drinking water, surface water, and effluent wastewaters). LC-MS/MS conditions and on-line SPE parameters such as sorbent type, sample and wash volumes were optimized. The developed method is highly sensitive (limits of detection between 0.1 and 1.4ngL -1 ) and precise (relative standard deviations lower than 8%). As part of the method validation studies, linearity, accuracy and matrix effects were assessed. The main advantage of this method over traditional off-line procedures is the minimization of tedious sample preparation increasing productivity and sample throughput. The optimized method was applied to the analysis of water samples and the results revealed the presence of 16 PS in river water and effluent water of wastewater treatment plants. Copyright © 2017 Elsevier B.V. All rights reserved.
Bacaloni, Alessandro; Callipo, Luciano; Corradini, Eleonora; Giansanti, Piero; Gubbiotti, Riccardo; Samperi, Roberto; Laganà, Aldo
2009-09-04
We describe the development of a liquid chromatography with negative-ion atmospheric pressure photoionization tandem mass spectrometric (LC/NI-APPI/MS/MS) method for the simultaneous determination of tetrabromobisphenol A (TBBP-A) and five polybrominated diphenyl ethers (BDE-47, BDE-99, BDE-100, BDE-153 and BDE-154) in water. A mobile phase methanol/acetone/water was used, where acetone acts also as dopant. NI-APPI produced precursor ions corresponding to [M-H](-) for TBBP-A, [M-Br+O](-), and [M-2Br+O](-) for the BDE congeners studied. Each compound was quantified operating in multiple reaction monitoring mode. Linearity was observed in the range 0.025-10 ng injected for all compounds. Coefficients of determination R(2) ranged from 0.9934 to 0.9982. BDEs were poorly retained by solid-phase extraction (SPE) from river water and sewage treatment plant effluent, thus liquid-liquid extraction (LLE) by n-hexane should be used for these samples. The recoveries of TBBP-A and PBDEs from tap water (SPE), river water and industrial wastewater (LLE) were in the range of 81-88%, 78-92%, and 43-99%, respectively, with relative standard deviations below 17%. The limits of detection, based on signal-to-noise ratio of 3, ranged from 0.004 to 0.1 ng injected, and method quantification limits were 0.2-3.3 ng L(-1) but BDE47 (20.3 ng L(-1)). Only TBBP-A was found in a treated industrial sewage at 4 ng L(-1), while BDE-99 and BDE-100 were detected on suspended solids.
Homem, Vera; Alves, Alice; Alves, Arminda; Santos, Lúcia
2016-01-01
A rapid and simple method for the simultaneous determination of twelve synthetic musks in water samples, using ultrasound-assisted dispersive liquid-liquid microextraction (UA-DLLME) coupled with gas chromatography-mass spectrometry (GC-MS) was successfully developed. The influence of seven factors (volume of the extraction solvent and disperser solvent, sample volume, extraction time, ionic strength, type of extraction and disperser solvent) affecting the UA-DLLME extraction efficiency was investigated using a screening design. The significant factors were selected and optimised employing a central composite design: 80 μL of chloroform, 880 μL of acetonitrile, 6 mL of sample volume, 3.5% (wt) of NaCl and 2 min of extraction time. Under the optimised conditions, this methodology was successfully validated for the analysis of 12 synthetic musk compounds in different aqueous samples (tap, sea and river water, effluent and influent wastewater). The proposed method showed enrichment factors between 101 and 115 depending on the analyte, limits of detection in the range of 0.004-54 ng L(-1) and good repeatability (most relative standard deviation values below 10%). No significant matrix effects were found, since recoveries ranged between 71% and 118%. Finally, the method was satisfactorily applied to the analysis of five different aqueous samples. Results demonstrated the existence of a larger amount of synthetic musks in wastewaters than in other water samples (average concentrations of 2800 ng L(-1) in influent and 850 ng L(-1) in effluent). Galaxolide, tonalide and exaltolide were the compounds most detected. Copyright © 2015 Elsevier B.V. All rights reserved.
Biomedically relevant chemical and physical properties of coal combustion products.
Fisher, G L
1983-01-01
The evaluation of the potential public and occupational health hazards of developing and existing combustion processes requires a detailed understanding of the physical and chemical properties of effluents available for human and environmental exposures. These processes produce complex mixtures of gases and aerosols which may interact synergistically or antagonistically with biological systems. Because of the physicochemical complexity of the effluents, the biomedically relevant properties of these materials must be carefully assessed. Subsequent to release from combustion sources, environmental interactions further complicate assessment of the toxicity of combustion products. This report provides an overview of the biomedically relevant physical and chemical properties of coal fly ash. Coal fly ash is presented as a model complex mixture for health and safety evaluation of combustion processes. PMID:6337824
Development of anaerobic digestion methods for palm oil mill effluent (POME) treatment.
Poh, P E; Chong, M F
2009-01-01
Palm oil mill effluent (POME) is a highly polluting wastewater that pollutes the environment if discharged directly due to its high chemical oxygen demand (COD) and biochemical oxygen demand (BOD) concentration. Anaerobic digestion has been widely used for POME treatment with large emphasis placed on capturing the methane gas released as a product of this biodegradation treatment method. The anaerobic digestion method is recognized as a clean development mechanism (CDM) under the Kyoto protocol. Certified emission reduction (CER) can be obtained by using methane gas as a renewable energy. This review aims to discuss the various anaerobic treatments of POME and factors that influence the operation of anaerobic treatment. The POME treatment at both mesophilic and thermophilic temperature ranges are also analyzed.
Neutralization and Biodegradation of Sulfur Mustard.
1997-02-01
public release; distribution is unlimited. 13. ABSTRACT (Maximum 200 words) The chemical warfare agent sulfur mustard was hydrolyzed to products that...scale bioreactors processing hydrolyzed munitions-grade sulfur mustard obtained directly from the U.S. Chemical Stockpile. The bioreactor effluent was...Hydrolysis has been previously utili ed for the detoxification of Canadian HD stockpiles (Reichert, 1975). Biodegradation has widespread application in
Sathyavathi, S; Manjula, A; Rajendhran, J; Gunasekaran, P
2014-08-01
In the present study, a nickel resistant bacterium MRS-1 was isolated from nickel electroplating industrial effluent, capable of converting soluble NiSO4 into insoluble NiO nanoparticles and identified as Microbacterium sp. The formation of NiO nanoparticles in the form of pale green powder was observed on the bottom of the flask upon prolonged incubation of liquid nutrient medium containing high concentration of 2000ppm NiSO4. The properties of the produced NiO nanoparticles were characterized. NiO nanoparticles exhibited a maximum absorbance at 400nm. The NiO nanoparticles were 100-500nm in size with unique flower like structure. The elemental composition of the NiO nanoparticles was 44:39. The cells of MRS-1 were utilized for the treatment of nickel electroplating industrial effluent and showed nickel removal efficiency of 95%. Application of Microbacterium sp. MRS-1 would be a potential bacterium for bioremediation of nickel electroplating industrial waste water and simultaneous synthesis of NiO nanoparticles. Copyright © 2014 Elsevier Ltd. All rights reserved.
NASA Technical Reports Server (NTRS)
Mackowiak, C. L.; Garland, J. L.; Strayer, R. F.; Finger, B. W.; Wheeler, R. M.
1996-01-01
This study compared the growth of potato plants on nutrients recycled from inedible potato biomass. Plants were grown for 105 days in recirculating, thin-film hydroponic systems containing four separate nutrient solution treatments: (1) modified half-strength Hoagland's (control), 2) liquid effluent from a bioreactor containing inedible potato biomass, 3) filtered (0.2 micrometer) effluent, and 4) the water soluble fraction of inedible potato biomass (leachate). Approximately 50% of the total nutrient requirement in treatments 2-4 were provided (recycled) from the potato biomass. Leachate had an inhibitory effect on leaf conductance, photosynthetic rate, and growth (50% reduction in plant height and 60% reduction in tuber yield). Plants grown on bioreactor effluent (filtered or unfiltered) were similar to the control plants. These results indicated that rapidly degraded, water soluble organic material contained in the inedible biomass, i.e., material in leachate, brought about phytotoxicity in the hydroponic culture of potato. Recalcitrant, water soluble organic material accumulated in all nutrient recycling treatments (650% increase after 105 days), but no increase in rhizosphere microbial numbers was observed.
Oleskowicz-Popiel, Piotr; Kádár, Zsófia; Heiske, Stefan; Klein-Marcuschamer, Daniel; Simmons, Blake A; Blanch, Harvey W; Schmidt, Jens Ejbye
2012-01-01
The addition of a biorefinery to an organic farm was investigated, where ethanol was produced from germinated rye grains and whey, and the effluent was separated into two streams: the protein-rich solid fraction, to be used as animal feed, and the liquid fraction, which can be co-digested with clover grass silage to produce biogas. A method for ethanol production from rye was applied by utilizing inherent amylase activity from germination of the seed. Biogas potential of ethanol fermentation effluent was measured through anaerobic digestion trials. The effluent from the trials was assumed to serve as natural fertilizer. A technoeconomic analysis was also performed; total capital investment was estimated to be approximately 4 M USD. Setting a methane selling price according to available incentives for "green electricity" (0.72 USD/m(3)) led to a minimum ethanol selling price of 1.89 USD/L (project lifetime 25 yr, at a discount rate 10%). Copyright © 2011 Elsevier Ltd. All rights reserved.
Toxicity evaluation of the process effluent streams of a petrochemical industry.
Reis, J L R; Dezotti, M; Sant'Anna, G L
2007-02-01
The physico-chemical characteristics and the acute toxicity of several wastewater streams, generated in the industrial production of synthetic rubber, were determined. The acute toxicity was evaluated in bioassays using different organisms: Danio rerio (fish), Lactuca sativa (lettuce) and Brachionus calyciflorus (rotifer). The removal of toxicity attained in the industrial wastewater treatment plant was also determined upstream and downstream of the activated sludge process. The results obtained indicate that the critical streams in terms of acute toxicity are the effluents from the liquid polymer unit and the spent caustic butadiene washing stage. The biological treatment was able to partially remove the toxicity of the industrial wastewater. However, a residual toxicity level persisted in the biotreated wastewater. The results obtained with Lactuca sativa showed a high degree of reproducibility, using root length or germination index as evaluation parameters. The effect of volatile pollutants on the toxicity results obtained with lettuce seeds was assessed, using ethanol as a model compound. Modifications on the assay procedure were proposed. A strong correlation between the toxic responses of Lactuca sativa and Danio rerio was observed for most industrial effluent streams.
Lyotropic liquid crystal preconcentrates for the treatment of periodontal disease.
Fehér, A; Urbán, E; Eros, I; Szabó-Révész, P; Csányi, E
2008-06-24
The aim of our study was to develop water-free lyotropic liquid crystalline preconcentrates, which consist of oils and surfactants with good physiological tolerance and spontaneously form lyotropic liquid crystalline phase in aqueous environment. In this way these preconcentrates having low viscosity can be injected into the periodontal pocket, where they are transformed into highly viscous liquid crystalline phase, so that the preparation is prevented from flowing out of the pocket due to its great viscosity, while drug release is controlled by the liquid crystalline texture. In order to follow the structure alteration upon water absorption polarization microscopical and rheological examinations were performed. The water absorption mechanism of the samples was examined by the Enslin-method. Metronidazole-benzoate was used as active agent the release of which was characterized via in vitro investigations performed by means of modified Kirby-Bauer disk diffusion method. On the grounds of the results it can be stated that the 4:1 mixture of the investigated surfactants (Cremophor EL, Cremophor RH40) and oil (Miglyol 810) formed lyotopic liquid crystalline phases upon water addition. Polarization microscopic examinations showed that samples with 10-40% water content possessed anisotropic properties. On the basis of water absorption, rheological and drug release studies it can be concluded that the amount of absorbed water and stiffness of lyotropic structure influenced by the chemical entity of the surfactant exerted major effect on the drug release.
Chang, Chia-Yu; Chung, Wu-Hsun; Ding, Wang-Hsien
2016-01-01
The rapid screening of trace levels of short-chain chlorinated paraffins in various aqueous samples was performed by a simple and reliable procedure based on vortex-assisted liquid-liquid microextraction combined with gas chromatography and electron capture negative ionization mass spectrometry. The optimal vortex-assisted liquid-liquid microextraction conditions for 20 mL water sample were as follows: extractant 400 μL of dichloromethane; vortex extraction time of 1 min at 2500 × g; centrifugation of 3 min at 5000 × g; and no ionic strength adjustment. Under the optimum conditions, the limit of quantitation was 0.05 μg/L. Precision, as indicated by relative standard deviations, was less than 9% for both intra- and inter-day analysis. Accuracy, expressed as the mean extraction recovery, was above 91%. The vortex-assisted liquid-liquid microextraction with gas chromatography and electron capture negative ionization mass spectrometry method was successfully applied to quantitatively extract short-chain chlorinated paraffins from samples of river water and the effluent of a wastewater treatment plant, and the concentrations ranged from 0.8 to 1.6 μg/L. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
NASA Technical Reports Server (NTRS)
Stokes, C. S.; Smith, E. W.; Murphy, W. J.
1972-01-01
A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).
Hasanudin, U; Sugiharto, R; Haryanto, A; Setiadi, T; Fujie, K
2015-01-01
The purpose of this study was to evaluate the current condition of palm oil mill effluent (POME) treatment and utilization and to propose alternative scenarios to improve the sustainability of palm oil industries. The research was conducted through field survey at some palm oil mills in Indonesia, in which different waste management systems were used. Laboratory experiment was also carried out using a 5 m(3) pilot-scale wet anaerobic digester. Currently, POME is treated through anaerobic digestion without or with methane capture followed by utilization of treated POME as liquid fertilizer or further treatment (aerobic process) to fulfill the wastewater quality standard. A methane capturing system was estimated to successfully produce renewable energy of about 25.4-40.7 kWh/ton of fresh fruit bunches (FFBs) and reduce greenhouse gas (GHG) emissions by about 109.41-175.35 kgCO2e/tonFFB (CO2e: carbon dioxide equivalent). Utilization of treated POME as liquid fertilizer increased FFB production by about 13%. A palm oil mill with 45 ton FFB/hour capacity has potential to generate about 0.95-1.52 MW of electricity. Coupling the POME-based biogas digester and anaerobic co-composting of empty fruit bunches (EFBs) is capable of adding another 0.93 MW. The utilization of POME and EFB not only increases the added value of POME and EFB by producing renewable energy, compost, and liquid fertilizer, but also lowers environmental burden.
Kruppke, Benjamin; Hose, Dirk; Schnettler, Reinhard; Seckinger, Anja; Rößler, Sina; Hanke, Thomas; Heinemann, Sascha
2018-04-01
The ability of silica-/collagen-based composite xerogels to act as drug delivery systems was evaluated by taking into account the initial drug concentration, bioactivity of the xerogels, liquid, and incubation regime. The proteasome inhibitor bortezomib was chosen as a model drug, used for the systemic treatment of multiple myeloma. Incubation during 14 days in phosphate-buffered saline (PBS) or simulated body fluid (SBF) showed a weak initial burst and was identified to be of first order with subsequent release being independent from the initial load of 0.1 or 0.2 mg bortezomib per 60 mg monolithic sample. Faster drug release occurred during incubation in SBF compared to PBS, and during static incubation without changing the liquid, compared to dynamic incubation with daily liquid changes. Drug-loaded xerogels with hydroxyapatite as a third component exhibited enhanced bioactivity retarding drug release, explained by formation of a surface calcium phosphate layer. The fastest release of 50% of the total drug load was observed for biphasic xerogels after 7 days during dynamic incubation in SBF. As a result, the presented concept is suitable for the intended combination of the advantageous bone substitution properties of xerogels and local application of drugs exemplified by bortezomib. © 2017 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 106B: 1165-1173, 2018. © 2017 Wiley Periodicals, Inc.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Murata, Tomonori; Yamauchi, Kiyoshi
2008-02-01
Thyroid system-disrupting activity in effluents from municipal domestic sewage treatment plants was detected using three in vitro assays and one in vivo assay. Contaminants in the effluents were extracted by solid-phase extraction (SPE) and eluted stepwise with different organic solvents. The majority of the thyroid system-disrupting activity was detected in the dichloromethane/methanol (1/1) fraction after SPE in all three in vitro assays: competitive assays of 3,3',5-[{sup 125}I]triiodo-L-thyronine ([{sup 125}I]T{sub 3}) binding to the plasma protein transthyretin (TTR assay) and thyroid hormone receptor (TR assay) and T{sub 3}-dependent luciferase assay (Luc assay). Subsequent reverse-phase high-performance liquid chromatography (RP-HPLC) of the dichloromethane/methanolmore » (1/1) fraction separated contaminants potent in the TR and Luc assays from those potent in the TTR assay. The contaminants potent in the TR and Luc assays were also potent in an in vivo short-term gene expression assay in Xenopus laevis (Tadpole assay). The present study demonstrated that the effluents from domestic sewage treatment plants contain contaminants with T{sub 3}-like activity of {approx} 10{sup -10} M T{sub 3}-equivalent concentration (T{sub 3}EQ) and that the TR and Luc assays are powerful in vitro bioassays for detecting thyroid system-disrupting activity in effluents. The availability and applicability of these bioassays for screening contaminants with thyroid system-disrupting activity in the water environment are discussed.« less
Hong, K i-Ho; Chang, Duk; Hur, Joon-Moo; Han, Sang-Bae
2003-01-01
Phased isolation ditch system with intrachannel clarifier is a simplified novel oxidation ditch system enhancing simultaneous removal of biological nitrogen and phosphorus in municipal wastewater. The system employs two ditches with intra-clarifier, and eliminates external final clarifier, additional preanaerobic reactor, and recycle of sludge and nitrified effluent. Separation of anoxic, anaerobic, and aerobic phases can be accomplished by alternating flow and intermittent aeration. Its pilot-scale system operated at HRTs of 10-21 h, SRTs of 15-41 days, and a cycle times of 2-8 h showed removals of BOD, TN, and TP in the range of mixed liquor temperature above 10 degrees C as high as 88-97, 70-84, and 65-90%, respectively. As the SRTs became longer, the effluent TN decreased dramatically, whereas the effluent TP increased. Higher nitrogen removal was accomplished at shorter cycle times, while better phosphorus removal was achieved in longer cycle times. Optimal system operating strategies maximizing the performance and satisfying both the best nitrogen and phosphorus removals included HRTs ranged 10-14 h, SRTs ranged 25-30 days, and a cycle time of 4 h at the mixed liquor temperature above 10 degrees C. Thus, complete phase separation in a cycle maximizing phosphorus release and uptake as well as nitrification and denitrification was accomplished by scheduling of alternating flow and intermittent aeration in the simplified process scheme. Especially, temporal phase separation for phosphorus release without additional anaerobic reactor was successfully accomplished during anaerobic period without any nitrate interference and carbon-limiting.
Hocquet, D; Muller, A; Bertrand, X
2016-08-01
Hospitals are hotspots for antimicrobial-resistant bacteria (ARB) and play a major role in both their emergence and spread. Large numbers of these ARB will be ejected from hospitals via wastewater systems. In this review, we present quantitative and qualitative data of extended-spectrum β-lactamase (ESBL)-producing Escherichia coli, vancomycin-resistant enterococci and Pseudomonas aeruginosa in hospital wastewaters compared to community wastewaters. We also discuss the fate of these ARB in wastewater treatment plants and in the downstream environment. Published studies have shown that hospital effluents contain ARB, the burden of these bacteria being dependent on their local prevalence. The large amounts of antimicrobials rejected in wastewater exert a continuous selective pressure. Only a few countries recommend the primary treatment of hospital effluents before their discharge into the main wastewater flow for treatment in municipal wastewater treatment plants. Despite the lack of conclusive data, some studies suggest that treatment could favour the ARB, notably ESBL-producing E. coli. Moreover, treatment plants are described as hotspots for the transfer of antibiotic resistance genes between bacterial species. Consequently, large amounts of ARB are released in the environment, but it is unclear whether this release contributes to the global epidemiology of these pathogens. It is reasonable, nevertheless, to postulate that it plays a role in the worldwide progression of antibiotic resistance. Antimicrobial resistance should now be seen as an 'environmental pollutant', and new wastewater treatment processes must be assessed for their capability in eliminating ARB, especially from hospital effluents. Copyright © 2016. Published by Elsevier Ltd.
El Maghraby, Gamal M; Elzayat, Ehab M; Alanazi, Fars K
2012-08-01
Alternative strategies are being employed to develop liquid oral sustained release formulation. These included ion exchange resin, sustained release suspensions and in situ gelling systems. The later mainly utilizes alginate solutions that form gels upon contact with calcium which may be administered separately or included in the alginate solution as citrate complex. This complex liberates calcium in the stomach with subsequent gellation. The formed gel can break after gastric emptying leading to dose dumping. Development of modified in situ gelling system which sustain dextromethorphan release in the stomach and intestine. Solutions containing alginate with calcium chloride and sodium citrate were initially prepared to select the formulation sustaining the release in the stomach. The best formulation was combined with chitosan. All formulations were characterized with respect to flow, gelling capacity, gelling strength and drug release. Increasing the concentration of alginate increased the gelling capacity and strength and reduced the rate of drug release in gastric conditions with 2% w/v alginate being the best formulation. However, these formulations failed to sustain the release in the intestinal conditions. Incorporation of chitosan with alginate increased the gelling capacity and strength and reduced the rate of drug release compared to alginate only system. The effect was optimum in formulation containing 1.5% w/v chitosan. The sustained release pattern was maintained both in the gastric and intestinal conditions and was comparable to that obtained from the marketed product. Alginate-chitosan based in situ gelling system is promising for developing liquid oral sustained release.
12 CFR 23.4 - Investment in personal property.
Code of Federal Regulations, 2012 CFR
2012-01-01
... business or for entry into the leasing business; and (2) The bank's aggregate investment in property held... shall either liquidate the off-lease property or re-lease it under a conforming lease as soon as practicable. Liquidation or re-lease must occur not later than five years from the date that the bank acquires...
12 CFR 23.4 - Investment in personal property.
Code of Federal Regulations, 2014 CFR
2014-01-01
... business or for entry into the leasing business; and (2) The bank's aggregate investment in property held... shall either liquidate the off-lease property or re-lease it under a conforming lease as soon as practicable. Liquidation or re-lease must occur not later than five years from the date that the bank acquires...