Science.gov

Sample records for marbled salamander populations

  1. Temporally adaptive sampling: a case study in rare species survey design with marbled salamanders (Ambystoma opacum).

    PubMed

    Charney, Noah D; Kubel, Jacob E; Eiseman, Charles S

    2015-01-01

    Improving detection rates for elusive species with clumped distributions is often accomplished through adaptive sampling designs. This approach can be extended to include species with temporally variable detection probabilities. By concentrating survey effort in years when the focal species are most abundant or visible, overall detection rates can be improved. This requires either long-term monitoring at a few locations where the species are known to occur or models capable of predicting population trends using climatic and demographic data. For marbled salamanders (Ambystoma opacum) in Massachusetts, we demonstrate that annual variation in detection probability of larvae is regionally correlated. In our data, the difference in survey success between years was far more important than the difference among the three survey methods we employed: diurnal surveys, nocturnal surveys, and dipnet surveys. Based on these data, we simulate future surveys to locate unknown populations under a temporally adaptive sampling framework. In the simulations, when pond dynamics are correlated over the focal region, the temporally adaptive design improved mean survey success by as much as 26% over a non-adaptive sampling design. Employing a temporally adaptive strategy costs very little, is simple, and has the potential to substantially improve the efficient use of scarce conservation funds.

  2. Temporally Adaptive Sampling: A Case Study in Rare Species Survey Design with Marbled Salamanders (Ambystoma opacum)

    PubMed Central

    Charney, Noah D.; Kubel, Jacob E.; Eiseman, Charles S.

    2015-01-01

    Improving detection rates for elusive species with clumped distributions is often accomplished through adaptive sampling designs. This approach can be extended to include species with temporally variable detection probabilities. By concentrating survey effort in years when the focal species are most abundant or visible, overall detection rates can be improved. This requires either long-term monitoring at a few locations where the species are known to occur or models capable of predicting population trends using climatic and demographic data. For marbled salamanders (Ambystoma opacum) in Massachusetts, we demonstrate that annual variation in detection probability of larvae is regionally correlated. In our data, the difference in survey success between years was far more important than the difference among the three survey methods we employed: diurnal surveys, nocturnal surveys, and dipnet surveys. Based on these data, we simulate future surveys to locate unknown populations under a temporally adaptive sampling framework. In the simulations, when pond dynamics are correlated over the focal region, the temporally adaptive design improved mean survey success by as much as 26% over a non-adaptive sampling design. Employing a temporally adaptive strategy costs very little, is simple, and has the potential to substantially improve the efficient use of scarce conservation funds. PMID:25799224

  3. A New Species of Eimeria (Apicomplexa: Eimeriidae) from the marbled salamander, Ambystoma opacum (Caudata: Ambystomatidae), from northern Louisiana.

    PubMed

    McAllister, Chris T; Upton, Steve J

    2008-06-01

    Between December 2002 and June 2004, 10 marbled salamanders, Ambystoma opacum, were examined for coccidian parasites. Salamanders were collected in Bradley (n = 2), Little River (n = 1), Miller (n = 1), and Sevier (n = 1) Counties, Arkansas; Webster Parish, Louisiana (n = 2); and Bowie (n = 1) and Nacogdoches (n = 2) Counties, Texas. Two of 10 (20%) A. opacum from Louisiana harbored an undescribed species of Eimeria. Oocysts of Eimeria trauthi n. sp. were ellipsoidal, 36.6 x 33.1 (33-40 x 29-37) microm, with a thin, single-layered wall; shape index 1.1. Polar granule(s) and micropyle were absent. Oocyst residuum was composed of hundreds of loosely packed homogenous granules of various sizes enclosing a vacuole. Sporocysts were elongate-ellipsoidal, 20.8 x 8.1 (19-22 x 7-9) microm; shape index 2.6. Sporocyst residuum was spherical and composed of a cluster of granules often membrane-bound. This is the first time a coccidium has been reported from an amphibian species in Louisiana and the second time a coccidium has been described from this salamander host. In addition, the following 26 salamanders from various counties in Arkansas, Oklahoma, and Texas were surveyed during the study period and were negative for coccidia: Ambystomatidae, 4 spotted salamanders (Ambystoma maculatum) and 7 mole salamanders (Ambystoma talpoideum); Cryptobranchidae, 4 Ozark hellbenders (Cryptobranchus alleganiensis bishopi); Plethodontidae, 6 spotted dusky salamanders (Desmognathus conanti) and 3 many-ribbed salamanders (Eurycea multiplicata multiplicata); and Salamandridae, 2 central newts (Notophthalmus viridescens louisianensis).

  4. Comparing population size estimators for plethodontid salamanders

    USGS Publications Warehouse

    Bailey, L.L.; Simons, T.R.; Pollock, K.H.

    2004-01-01

    Despite concern over amphibian declines, few studies estimate absolute abundances because of logistic and economic constraints and previously poor estimator performance. Two estimation approaches recommended for amphibian studies are mark-recapture and depletion (or removal) sampling. We compared abundance estimation via various mark-recapture and depletion methods, using data from a three-year study of terrestrial salamanders in Great Smoky Mountains National Park. Our results indicate that short-term closed-population, robust design, and depletion methods estimate surface population of salamanders (i.e., those near the surface and available for capture during a given sampling occasion). In longer duration studies, temporary emigration violates assumptions of both open- and closed-population mark-recapture estimation models. However, if the temporary emigration is completely random, these models should yield unbiased estimates of the total population (superpopulation) of salamanders in the sampled area. We recommend using Pollock's robust design in mark-recapture studies because of its flexibility to incorporate variation in capture probabilities and to estimate temporary emigration probabilities.

  5. Effects of copper exposure on hatching success and early larval survival in marbled salamanders, Ambystoma opacum.

    PubMed

    Soteropoulos, Diana L; Lance, Stacey L; Flynn, R Wesley; Scott, David E

    2014-07-01

    The creation of wetlands, such as urban and industrial ponds, has increased in recent decades, and these wetlands often become enriched in pollutants over time. One metal contaminant trapped in created wetlands is copper (Cu(2+)). Copper concentrations in sediments and overlying water may affect amphibian species that breed in created wetlands. The authors analyzed the Cu concentration in dried sediments from a contaminated wetland and the levels of aqueous Cu released after flooding the sediments with different volumes of water, mimicking low, medium, and high pond-filling events. Eggs and larvae of Ambystoma opacum Gravenhorst, a salamander that lays eggs on the sediments in dry pond beds that hatch on pond-filling, were exposed to a range of Cu concentrations that bracketed potential aqueous Cu levels in created wetlands. Embryo survival varied among clutches, but increased Cu levels did not affect embryo survival. At Cu concentrations of 500 µg/L or greater, however, embryos hatched earlier, and the aquatic larvae died shortly after hatching. Because Cu concentrations in sediments increase over time in created wetlands, even relatively tolerant species such as A. opacum may be affected by Cu levels in the posthatching environment.

  6. Population dynamics and regulation in the cave salamander Speleomantes strinatii

    NASA Astrophysics Data System (ADS)

    Salvidio, Sebastiano

    2007-05-01

    Time series analysis has been used to evaluate the mechanisms regulating population dynamics of mammals and insects, but has been rarely applied to amphibian populations. In this study, the influence of endogenous (density-dependent) and exogenous (density-independent) factors regulating population dynamics of the terrestrial plethodontid salamander Speleomantes strinatii was analysed by means of time series and multiple regression analyses. During the period 1993 2005, S. strinatii population abundance, estimated by a standardised temporary removal method, displayed relatively low fluctuations, and the autocorrelation function (ACF) analysis showed that the time series had a noncyclic structure. The partial rate correlation function (PRCF) indicated that a strong first-order negative feedback dominated the endogenous dynamics. Stepwise multiple regression analysis showed that the only climatic factor influencing population growth rate was the minimum winter temperature. Thus, at least during the study period, endogenous, density-dependent negative feedback was the main factor affecting the growth rate of the salamander population, whereas stochastic environmental variables, such as temperature and rainfall, seemed to play a minor role in regulation. These results stress the importance of considering both exogenous and endogenous factors when analysing amphibian long-term population dynamics.

  7. Population genetic structure and conservation of marbled murrelets (Brachyramphus marmoratus)

    USGS Publications Warehouse

    Friesen, V.L.; Birt, T.P.; Piatt, J.F.; Golightly, R.T.; Newman, S.H.; Hebert, P.N.; Congdon, B.C.; Gissing, G.

    2005-01-01

    Marbled murrelets (Brachyramphus marmoratus) are coastal seabirds that nest from California to the Aleutian Islands. They are declining and considered threatened in several regions. We compared variation in the mitochondrial control region, four nuclear introns and three microsatellite loci among 194 murrelets from throughout their range except Washington and Oregon. Significant population genetic structure was found: nine private control region haplotypes and three private intron alleles occurred at high frequency in the Aleutians and California; global estimates of FST or ??ST and most pairwise estimates involving the Aleutians and/or California were significant; and marked isolation-by-distance was found. Given the available samples, murrelets appear to comprise five genetic management units: (1) western Aleutian Islands, (2) central Aleutian Islands, (3) mainland Alaska and British Columbia, (4) northern California, and (5) central California.

  8. Estimation of stream salamander (Plethodontidae, Desmognathinae and Plethodontinae) populations in Shenandoah National Park, Virginia, USA

    USGS Publications Warehouse

    Jung, R.E.; Royle, J. Andrew; Sauer, J.R.; Addison, C.; Rau, R.D.; Shirk, J.L.; Whissel, J.C.

    2005-01-01

    Stream salamanders in the family Plethodontidae constitute a large biomass in and near headwater streams in the eastern United States and are promising indicators of stream ecosystem health. Many studies of stream salamanders have relied on population indices based on counts rather than population estimates based on techniques such as capture-recapture and removal. Application of estimation procedures allows the calculation of detection probabilities (the proportion of total animals present that are detected during a survey) and their associated sampling error, and may be essential for determining salamander population sizes and trends. In 1999, we conducted capture-recapture and removal population estimation methods for Desmognathus salamanders at six streams in Shenandoah National Park, Virginia, USA. Removal sampling appeared more efficient and detection probabilities from removal data were higher than those from capture-recapture. During 2001-2004, we used removal estimation at eight streams in the park to assess the usefulness of this technique for long-term monitoring of stream salamanders. Removal detection probabilities ranged from 0.39 to 0.96 for Desmognathus, 0.27 to 0.89 for Eurycea and 0.27 to 0.75 for northern spring (Gyrinophilus porphyriticus) and northern red (Pseudotriton ruber) salamanders across stream transects. Detection probabilities did not differ across years for Desmognathus and Eurycea, but did differ among streams for Desmognathus. Population estimates of Desmognathus decreased between 2001-2002 and 2003-2004 which may be related to changes in stream flow conditions. Removal-based procedures may be a feasible approach for population estimation of salamanders, but field methods should be designed to meet the assumptions of the sampling procedures. New approaches to estimating stream salamander populations are discussed.

  9. Leaf litter bags as an index to populations of northern two-lined salamanders (Eurycea bislineata)

    USGS Publications Warehouse

    Chalmers, R.J.; Droege, S.

    2002-01-01

    Concern about recent amphibian declines has led to research on amphibian populations, but few statistically tested, standardized methods of counting amphibians exist. We tested whether counts of northern two-lined salamander larvae (Eurycea bislineata) sheltered in leaf litter bags--a relatively new, easily replicable survey technique--had a linear correlation to total number of larvae. Using experimental enclosures placed in streams, we compared number of salamanders found in artificial habitat (leaf litter bags) with total number of salamanders in each enclosure. Low numbers of the animals were found in leaf litter bags, and the relative amount of variation in the index (number of animals in leaf litter bags compared to total number of animals in stream enclosures) was high. The index of salamanders in leaf litter bags was not significantly related to total number of salamanders in enclosures for two-thirds of the replicates or with pooled replicates (P= 0.066). Consequently, we cannot recommend using leaf litter bags to index populations of northern two-lined salamanders.

  10. Three decades of urbanization: Estimating the impact of land-cover change on stream salamander populations

    USGS Publications Warehouse

    Price, S.J.; Dorcas, M.E.; Gallant, A.L.; Klaver, R.W.; Willson, J.D.

    2006-01-01

    Urbanization has become the dominant form of landscape disturbance in parts of the United States. Small streams in the Piedmont region of the eastern United States support high densities of salamanders and are often the first habitats to be affected by landscape-altering factors such as urbanization. We used US Geological Survey land cover data from 1972 to 2000 and a relation between stream salamanders and land cover, established from recent research, to estimate the impact of contemporary land-cover change on the abundance of stream salamanders near Davidson, North Carolina, a Piedmont locale that has experienced rapid urbanization during this time. Our analysis indicates that southern two-lined salamander (Eurycea cirrigera) populations have decreased from 32% to 44% while northern dusky salamanders (Desmognathus fuscus) have decreased from 21% to 30% over the last three decades. Our results suggest that the widespread conversion of forest to urban land in small catchments has likely resulted in a substantial decline of populations of stream salamanders and could have serious effects on stream ecosystems. ?? 2006 Elsevier Ltd. All rights reserved.

  11. Spatial variation in water loss predicts terrestrial salamander distribution and population dynamics.

    PubMed

    Peterman, W E; Semlitsch, R D

    2014-10-01

    Many patterns observed in ecology, such as species richness, life history variation, habitat use, and distribution, have physiological underpinnings. For many ectothermic organisms, temperature relationships shape these patterns, but for terrestrial amphibians, water balance may supersede temperature as the most critical physiologically limiting factor. Many amphibian species have little resistance to water loss, which restricts them to moist microhabitats, and may significantly affect foraging, dispersal, and courtship. Using plaster models as surrogates for terrestrial plethodontid salamanders (Plethodon albagula), we measured water loss under ecologically relevant field conditions to estimate the duration of surface activity time across the landscape. Surface activity time was significantly affected by topography, solar exposure, canopy cover, maximum air temperature, and time since rain. Spatially, surface activity times were highest in ravine habitats and lowest on ridges. Surface activity time was a significant predictor of salamander abundance, as well as a predictor of successful recruitment; the probability of a juvenile salamander occupying an area with high surface activity time was two times greater than an area with limited predicted surface activity. Our results suggest that survival, recruitment, or both are demographic processes that are affected by water loss and the ability of salamanders to be surface-active. Results from our study extend our understanding of plethodontid salamander ecology, emphasize the limitations imposed by their unique physiology, and highlight the importance of water loss to spatial population dynamics. These findings are timely for understanding the effects that fluctuating temperature and moisture conditions predicted for future climates will have on plethodontid salamanders.

  12. Salamander limb regeneration involves the activation of a multipotent skeletal muscle satellite cell population.

    PubMed

    Morrison, Jamie I; Lööf, Sara; He, Pingping; Simon, András

    2006-01-30

    In contrast to mammals, salamanders can regenerate complex structures after injury, including entire limbs. A central question is whether the generation of progenitor cells during limb regeneration and mammalian tissue repair occur via separate or overlapping mechanisms. Limb regeneration depends on the formation of a blastema, from which the new appendage develops. Dedifferentiation of stump tissues, such as skeletal muscle, precedes blastema formation, but it was not known whether dedifferentiation involves stem cell activation. We describe a multipotent Pax7+ satellite cell population located within the skeletal muscle of the salamander limb. We demonstrate that skeletal muscle dedifferentiation involves satellite cell activation and that these cells can contribute to new limb tissues. Activation of salamander satellite cells occurs in an analogous manner to how the mammalian myofiber mobilizes stem cells during skeletal muscle tissue repair. Thus, limb regeneration and mammalian tissue repair share common cellular and molecular programs. Our findings also identify satellite cells as potential targets in promoting mammalian blastema formation.

  13. Lagged influence of North Atlantic Oscillation on population dynamics of a Mediterranean terrestrial salamander.

    PubMed

    Salvidio, Sebastiano; Oneto, Fabrizio; Ottonello, Dario; Pastorino, Mauro V

    2016-04-01

    The North Atlantic Oscillation (NAO) is a large-scale climatic pattern that strongly influences the atmospheric circulation in the northern Hemisphere and by consequence the long-term variability of marine and terrestrial ecosystem over great part of northern Europe and western Mediterranean. In the Mediterranean, the effects of the NAO on vertebrates has been studied mainly on bird populations but was rarely analysed in ectothermic animals, and in particular in amphibians. In this study, we investigated the relationships between winter, spring and summer NAO indexes and the long-term population dynamics of the plethodontid salamander Speleomantes strinatii. This terrestrial salamander was monitored inside an artificial cave in NW Italy for 24 consecutive years. The relationships between seasonal NAO indexes and the salamander dynamics were assessed by cross-correlation function (CCF) analysis, after prewhitening the time series by autoregressive moving average statistical modelling. Results of CCF analyses indicated that the salamander abundance varied in relation to the one-year ahead winter NAO (P = 0.018), while no relationships were found with spring and summer indexes. These results strengthen some previous findings that suggested a high sensitivity of temperate terrestrial amphibians to wintertime climatic conditions.

  14. Lagged influence of North Atlantic Oscillation on population dynamics of a Mediterranean terrestrial salamander

    NASA Astrophysics Data System (ADS)

    Salvidio, Sebastiano; Oneto, Fabrizio; Ottonello, Dario; Pastorino, Mauro V.

    2016-04-01

    The North Atlantic Oscillation (NAO) is a large-scale climatic pattern that strongly influences the atmospheric circulation in the northern Hemisphere and by consequence the long-term variability of marine and terrestrial ecosystem over great part of northern Europe and western Mediterranean. In the Mediterranean, the effects of the NAO on vertebrates has been studied mainly on bird populations but was rarely analysed in ectothermic animals, and in particular in amphibians. In this study, we investigated the relationships between winter, spring and summer NAO indexes and the long-term population dynamics of the plethodontid salamander Speleomantes strinatii. This terrestrial salamander was monitored inside an artificial cave in NW Italy for 24 consecutive years. The relationships between seasonal NAO indexes and the salamander dynamics were assessed by cross-correlation function (CCF) analysis, after prewhitening the time series by autoregressive moving average statistical modelling. Results of CCF analyses indicated that the salamander abundance varied in relation to the one-year ahead winter NAO ( P = 0.018), while no relationships were found with spring and summer indexes. These results strengthen some previous findings that suggested a high sensitivity of temperate terrestrial amphibians to wintertime climatic conditions.

  15. Decline of disjunct green salamander (Aneides aeneus) populations in the southern appalachians

    USGS Publications Warehouse

    Corser, J.D.

    2001-01-01

    Coincident with other amphibians around the world Aneides aeneus, a terrestrial plethodontid salamander, suffered a population collapse in a disjunct portion of its range in the mid-late 1970s. Long-term monitoring of seven historical green salamander populations throughout the 1990s showed a 98% decline in relative abundance since 1970. Three out of six populations first discovered in 1991 also crashed in 1996-1997. The synchronized suddenness of the declines, their region-wide impact, and effects on both small and larger populations, suggest the role of a novel agent of mortality beginning in the mid-late 1970s. Acting alone, but more likely in concert, habitat loss, overcollecting, epidemic disease and climate change could account for this region-wide decline.

  16. Fine-scale spatial genetic structure and dispersal among spotted salamander (Ambystoma maculatum) breeding populations.

    PubMed

    Zamudio, Kelly R; Wieczorek, Ania M

    2007-01-01

    We examined fine-scale genetic variation among breeding aggregations of the spotted salamander (Ambystoma maculatum) to quantify dispersal, interpopulation connectivity and population genetic structure. Spotted salamanders rely on temporary ponds or wetlands for aggregate breeding. Adequate breeding sites are relatively isolated from one another and field studies suggest considerable adult site fidelity; therefore, we expected to find population structure and differentiation at small spatial scales. We used microsatellites to estimate population structure and dispersal among 29 breeding aggregations in Tompkins County, New York, USA, an area encompassing 1272 km(2). Bayesian and frequency-based analyses revealed fine-scale genetic structure with two genetically defined demes: the North deme included seven breeding ponds, and the South deme included 13 ponds. Nine ponds showed evidence of admixture between these two genetic pools. Bayesian assignment tests for detection of interpopulation dispersal indicate that immigration among ponds is common within demes, and that certain populations serve as sources of immigrants to neighbouring ponds. Likewise, spatial genetic correlation analyses showed that populations < or = 4.8 km distant from each other show significant genetic correlation that is not evident at higher scales. Within-population levels of relatedness are consistently larger than expected if mating were completely random across ponds, and in the case of a few ponds, within-population processes such as inbreeding or reproductive skew contribute significantly to differentiation from neighbouring ponds. Our data underscore the importance of these within-population processes as a source of genetic diversity across the landscape, despite considerable population connectivity. Our data further suggest that spotted salamander breeding groups behave as metapopulations, with population clusters as functional units, but sufficient migration among demes to allow for

  17. Comparing Population Patterns to Processes: Abundance and Survival of a Forest Salamander following Habitat Degradation

    PubMed Central

    Otto, Clint R. V.; Roloff, Gary J.; Thames, Rachael E.

    2014-01-01

    Habitat degradation resulting from anthropogenic activities poses immediate and prolonged threats to biodiversity, particularly among declining amphibians. Many studies infer amphibian response to habitat degradation by correlating patterns in species occupancy or abundance with environmental effects, often without regard to the demographic processes underlying these patterns. We evaluated how retention of vertical green trees (CANOPY) and coarse woody debris (CWD) influenced terrestrial salamander abundance and apparent survival in recently clearcut forests. Estimated abundance of unmarked salamanders was positively related to CANOPY (Canopy  = 0.21 (0.02–1.19; 95% CI), but not CWD (CWD  = 0.11 (−0.13–0.35) within 3,600 m2 sites, whereas estimated abundance of unmarked salamanders was not related to CANOPY (Canopy  = −0.01 (−0.21–0.18) or CWD (CWD  = −0.02 (−0.23–0.19) for 9 m2 enclosures. In contrast, apparent survival of marked salamanders within our enclosures over 1 month was positively influenced by both CANOPY and CWD retention (Canopy  = 0.73 (0.27–1.19; 95% CI) and CWD  = 1.01 (0.53–1.50). Our results indicate that environmental correlates to abundance are scale dependent reflecting habitat selection processes and organism movements after a habitat disturbance event. Our study also provides a cautionary example of how scientific inference is conditional on the response variable(s), and scale(s) of measure chosen by the investigator, which can have important implications for species conservation and management. Our research highlights the need for joint evaluation of population state variables, such as abundance, and population-level process, such as survival, when assessing anthropogenic impacts on forest biodiversity. PMID:24718498

  18. Comparing population patterns to processes: abundance and survival of a forest salamander following habitat degradation.

    PubMed

    Otto, Clint R V; Roloff, Gary J; Thames, Rachael E

    2014-01-01

    Habitat degradation resulting from anthropogenic activities poses immediate and prolonged threats to biodiversity, particularly among declining amphibians. Many studies infer amphibian response to habitat degradation by correlating patterns in species occupancy or abundance with environmental effects, often without regard to the demographic processes underlying these patterns. We evaluated how retention of vertical green trees (CANOPY) and coarse woody debris (CWD) influenced terrestrial salamander abundance and apparent survival in recently clearcut forests. Estimated abundance of unmarked salamanders was positively related to CANOPY (β Canopy  = 0.21 (0.02-1.19; 95% CI), but not CWD (β CWD  = 0.11 (-0.13-0.35) within 3,600 m2 sites, whereas estimated abundance of unmarked salamanders was not related to CANOPY (β Canopy  = -0.01 (-0.21-0.18) or CWD (β CWD  = -0.02 (-0.23-0.19) for 9 m2 enclosures. In contrast, apparent survival of marked salamanders within our enclosures over 1 month was positively influenced by both CANOPY and CWD retention (β Canopy  = 0.73 (0.27-1.19; 95% CI) and β CWD  = 1.01 (0.53-1.50). Our results indicate that environmental correlates to abundance are scale dependent reflecting habitat selection processes and organism movements after a habitat disturbance event. Our study also provides a cautionary example of how scientific inference is conditional on the response variable(s), and scale(s) of measure chosen by the investigator, which can have important implications for species conservation and management. Our research highlights the need for joint evaluation of population state variables, such as abundance, and population-level process, such as survival, when assessing anthropogenic impacts on forest biodiversity.

  19. Population Structure and Evolution after Speciation of the Hokkaido Salamander (Hynobius retardatus)

    PubMed Central

    Matsunami, Masatoshi; Igawa, Takeshi; Michimae, Hirofumi; Miura, Toru; Nishimura, Kinya

    2016-01-01

    The Hokkaido salamander (Hynobius retardatus) is endemic to Hokkaido Island, Japan, and shows intriguing flexible phenotypic plasticity and regional morphological diversity. However, to date, allozymes and partial mitochondria DNA sequences have provided only an outline of its demographic histories and the pattern of its genetic diversification. To understand the finer details of the population structure of this species and its evolution since speciation, we genotyped five regional populations by using 12 recently developed microsatellite polymorphic markers. We found a clear population structure with low gene flow among the five populations, but a close genetic relationship between the Teshio and Kitami populations. Our demographic analysis suggested that Teshio and Erimo had the largest effective population sizes among the five populations. These findings regarding the population structure and demography of H. retardatus improve our understanding of the faunal phylogeography on Hokkaido Island and also provide fundamental genetic information that will be useful for future studies. PMID:27257807

  20. Elevational differences in trait response to UV-B radiation by long-toed salamander populations.

    PubMed

    Thurman, Lindsey L; Garcia, Tiffany S; Hoffman, Peter D

    2014-07-01

    Amphibian species capable of optimizing trait response to environmental stressors may develop complex strategies for defending against rapid environmental change. Trait responses may differ between populations, particularly if stressor strength varies across spatial or temporal gradients. Ultraviolet-B (UV-B) radiation is one such stressor that poses a significant threat to amphibian species. We examined the ability of long-toed salamanders (Ambystoma macrodactylum) at high- and low-elevation breeding sites to cooperatively employ behavioral and physiological trait responses to mediate UV-B damage. We performed a microhabitat survey to examine differences in oviposition behavior and UV-B conditions among breeding populations at high- (n = 3; >1,500 m) and low-elevation (n = 3; <100 m) sites. We found significant differences in oviposition behavior across populations, with females at high-elevation sites selecting oviposition substrates in UV-B protected microhabitats. We also collected eggs (n = 633) from each of the breeding sites for analysis of photolyase activity, a photoreactivating enzyme that repairs UV-B damage to the DNA, using a photoproduct immunoassay. Our results revealed no significant differences in photolyase activity between long-toed salamander populations at high and low elevations. For high-elevation salamander populations, relatively low physiological repair capabilities in embryos appear to be buffered by extensive behavioral modifications to reduce UV-B exposure and standardize developmental temperatures. This study provides valuable insight into environmental stress responses via the assessment of multiple traits in allowing sensitive species to persist in rapidly changing landscapes.

  1. Population level differences in thermal sensitivity of energy assimilation in terrestrial salamanders.

    PubMed

    Clay, Timothy A; Gifford, Matthew E

    2017-02-01

    Thermal adaptation predicts that thermal sensitivity of physiological traits should be optimized to thermal conditions most frequently experienced. Furthermore, thermodynamic constraints predict that species with higher thermal optima should have higher performance maxima and narrower performance breadths. We tested these predictions by examining the thermal sensitivity of energy assimilation between populations within two species of terrestrial-lungless salamanders, Plethodon albagula and P. montanus. Within P. albagula, we examined populations that were latitudinally separated by >450km. Within P. montanus, we examined populations that were elevationally separated by >900m. Thermal sensitivity of energy assimilation varied substantially between populations of P. albagula separated latitudinally, but did not vary between populations of P. montanus separated elevationally. Specifically, in P. albagula, the lower latitude population had a higher thermal optimum, higher maximal performance, and narrower performance breadth compared to the higher latitude population. Furthermore, across all individuals as thermal optima increased, performance maxima also increased, providing support for the theory that "hotter is better".

  2. Mechanisms of population differentiation in marbled murrelets: historical versus contemporary processes

    USGS Publications Warehouse

    Congdon, B.C.; Piatt, J.F.; Martin, K.; Friesen, V.L.

    2000-01-01

    Mechanisms of population differentiation in highly vagile species such as seabirds are poorly understood. Previous studies of marbled murrelets (Brachyramphus marmoratus; Charadriiformes: Alcidae) found significant population genetic structure, but could not determine whether this structure is due to historical vicariance (e.g., due to Pleistocene glaciers), isolation by distance, drift or selection in peripheral populations, or nesting habitat selection. To discriminate among these possibilities, we analyzed sequence variation in nine nuclear introns from 120 marbled murrelets sampled from British Columbia to the western Aleutian Islands. Mismatch distributions indicated that murrelets underwent at least one population expansion during the Pleistocene and probably are not in genetic equilibrium. Maximum-likelihood analysis of allele frequencies suggested that murrelets from 'mainland' sites (from the Alaskan Peninsula east) are genetically different from those in the Aleutians and that these two lineages diverged prior to the last glaciation. Analyses of molecular variance, as well as estimates of gene flow derived using coalescent theory, indicate that population genetic structure is best explained by peripheral isolation of murrelets in the Aleutian Islands, rather than by selection associated with different nesting habitats. No isolation-by-distance effects could be detected. Our results are consistent with a rapid expansion of murrelets from a single refugium during the early-mid Pleistocene, subsequent isolation and divergence in two or more refugia during the final Pleistocene glacial advance, and secondary contact following retreat of the ice sheets. Population genetic structure now appears to be maintained by distance effects combined with small populations and a highly fragmented habitat in the Aleutian Islands.

  3. Population structure of spotted salamanders (Ambystoma maculatum) in a fragmented landscape.

    PubMed

    Purrenhage, J L; Niewiarowski, P H; Moore, F B-G

    2009-01-01

    Understanding the impacts of landscape-level processes on the population biology of amphibians is critical, especially for species inhabiting anthropogenically modified landscapes. Many pond-breeding amphibians are presumed to exist as metapopulations, but few studies demonstrate the extent and consequences of this metapopulation structure. Gene flow measures may facilitate the construction of more realistic models of population structure than direct measures of migration. This is especially true for species that are cryptic, such as many amphibians. We used eight polymorphic microsatellite loci to determine the genetic population structure of spotted salamanders (Ambystoma maculatum) breeding at 17 ponds in northeastern Ohio, a landscape fragmented by roads, agriculture, urban areas and the Cuyahoga River. Using a variety of analyses (Bayesian clustering, F-statistics, AMOVA) we generated a model of salamander population genetic structure. Our data revealed patterns of genetic connectivity that were not predicted by geographical distances between ponds (no isolation by distance). We also tested for a relationship between population structure and several indices of landscape resistance, but found no effect of potential barriers to dispersal on genetic connectivity. Strong overall connectivity among ponds, despite the hostile habitat matrix, may be facilitated by a network of riparian corridors associated with the Cuyahoga River; however, high gene flow in this system may indicate a general ability to disperse and colonize beyond particular corridors.

  4. Conservation genetics of extremely isolated urban populations of the northern dusky salamander (Desmognathus fuscus) in New York City.

    PubMed

    Munshi-South, Jason; Zak, Yana; Pehek, Ellen

    2013-01-01

    Urbanization is a major cause of amphibian decline. Stream-dwelling plethodontid salamanders are particularly susceptible to urbanization due to declining water quality and hydrological changes, but few studies have examined these taxa in cities. The northern dusky salamander (Desmognathus fuscus) was once common in the New York City metropolitan area, but has substantially declined throughout the region in recent decades. We used five tetranucleotide microsatellite loci to examine population differentiation, genetic variation, and bottlenecks among five remnant urban populations of dusky salamanders in NYC. These genetic measures provide information on isolation, prevalence of inbreeding, long-term prospects for population persistence, and potential for evolutionary responses to future environmental change. All populations were genetically differentiated from each other, and the most isolated populations in Manhattan have maintained very little genetic variation (i.e. <20% heterozygosity). A majority of the populations also exhibited evidence of genetic bottlenecks. These findings contrast with published estimates of high genetic variation within and lack of structure between populations of other desmognathine salamanders sampled over similar or larger spatial scales. Declines in genetic variation likely resulted from population extirpations and the degradation of stream and terrestrial paths for dispersal in NYC. Loss of genetic variability in populations isolated by human development may be an underappreciated cause and/or consequence of the decline of this species in urbanized areas of the northeast USA.

  5. Conservation genetics of extremely isolated urban populations of the northern dusky salamander (Desmognathus fuscus) in New York City

    PubMed Central

    Zak, Yana; Pehek, Ellen

    2013-01-01

    Urbanization is a major cause of amphibian decline. Stream-dwelling plethodontid salamanders are particularly susceptible to urbanization due to declining water quality and hydrological changes, but few studies have examined these taxa in cities. The northern dusky salamander (Desmognathus fuscus) was once common in the New York City metropolitan area, but has substantially declined throughout the region in recent decades. We used five tetranucleotide microsatellite loci to examine population differentiation, genetic variation, and bottlenecks among five remnant urban populations of dusky salamanders in NYC. These genetic measures provide information on isolation, prevalence of inbreeding, long-term prospects for population persistence, and potential for evolutionary responses to future environmental change. All populations were genetically differentiated from each other, and the most isolated populations in Manhattan have maintained very little genetic variation (i.e. <20% heterozygosity). A majority of the populations also exhibited evidence of genetic bottlenecks. These findings contrast with published estimates of high genetic variation within and lack of structure between populations of other desmognathine salamanders sampled over similar or larger spatial scales. Declines in genetic variation likely resulted from population extirpations and the degradation of stream and terrestrial paths for dispersal in NYC. Loss of genetic variability in populations isolated by human development may be an underappreciated cause and/or consequence of the decline of this species in urbanized areas of the northeast USA. PMID:23646283

  6. DEMOGRAPHY AND SPATIAL POPULATION STRUCTURE IN CALIFORNIA TIGER SALAMANDER

    EPA Science Inventory

    Although the causes of many amphibian declines remain mysterious, there is general agreement that human habitat alteration represents the greatest threat to amphibian populations. In January 2000 the US Fish and Wildlife Service proposed listing Santa Barbara County California Ti...

  7. The First Estimates of Marbled Cat Pardofelis marmorata Population Density from Bornean Primary and Selectively Logged Forest.

    PubMed

    Hearn, Andrew J; Ross, Joanna; Bernard, Henry; Bakar, Soffian Abu; Hunter, Luke T B; Macdonald, David W

    2016-01-01

    The marbled cat Pardofelis marmorata is a poorly known wild cat that has a broad distribution across much of the Indomalayan ecorealm. This felid is thought to exist at low population densities throughout its range, yet no estimates of its abundance exist, hampering assessment of its conservation status. To investigate the distribution and abundance of marbled cats we conducted intensive, felid-focused camera trap surveys of eight forest areas and two oil palm plantations in Sabah, Malaysian Borneo. Study sites were broadly representative of the range of habitat types and the gradient of anthropogenic disturbance and fragmentation present in contemporary Sabah. We recorded marbled cats from all forest study areas apart from a small, relatively isolated forest patch, although photographic detection frequency varied greatly between areas. No marbled cats were recorded within the plantations, but a single individual was recorded walking along the forest/plantation boundary. We collected sufficient numbers of marbled cat photographic captures at three study areas to permit density estimation based on spatially explicit capture-recapture analyses. Estimates of population density from the primary, lowland Danum Valley Conservation Area and primary upland, Tawau Hills Park, were 19.57 (SD: 8.36) and 7.10 (SD: 1.90) individuals per 100 km2, respectively, and the selectively logged, lowland Tabin Wildlife Reserve yielded an estimated density of 10.45 (SD: 3.38) individuals per 100 km2. The low detection frequencies recorded in our other survey sites and from published studies elsewhere in its range, and the absence of previous density estimates for this felid suggest that our density estimates may be from the higher end of their abundance spectrum. We provide recommendations for future marbled cat survey approaches.

  8. The First Estimates of Marbled Cat Pardofelis marmorata Population Density from Bornean Primary and Selectively Logged Forest

    PubMed Central

    Hearn, Andrew J.; Ross, Joanna; Bernard, Henry; Bakar, Soffian Abu; Hunter, Luke T. B.; Macdonald, David W.

    2016-01-01

    The marbled cat Pardofelis marmorata is a poorly known wild cat that has a broad distribution across much of the Indomalayan ecorealm. This felid is thought to exist at low population densities throughout its range, yet no estimates of its abundance exist, hampering assessment of its conservation status. To investigate the distribution and abundance of marbled cats we conducted intensive, felid-focused camera trap surveys of eight forest areas and two oil palm plantations in Sabah, Malaysian Borneo. Study sites were broadly representative of the range of habitat types and the gradient of anthropogenic disturbance and fragmentation present in contemporary Sabah. We recorded marbled cats from all forest study areas apart from a small, relatively isolated forest patch, although photographic detection frequency varied greatly between areas. No marbled cats were recorded within the plantations, but a single individual was recorded walking along the forest/plantation boundary. We collected sufficient numbers of marbled cat photographic captures at three study areas to permit density estimation based on spatially explicit capture-recapture analyses. Estimates of population density from the primary, lowland Danum Valley Conservation Area and primary upland, Tawau Hills Park, were 19.57 (SD: 8.36) and 7.10 (SD: 1.90) individuals per 100 km2, respectively, and the selectively logged, lowland Tabin Wildlife Reserve yielded an estimated density of 10.45 (SD: 3.38) individuals per 100 km2. The low detection frequencies recorded in our other survey sites and from published studies elsewhere in its range, and the absence of previous density estimates for this felid suggest that our density estimates may be from the higher end of their abundance spectrum. We provide recommendations for future marbled cat survey approaches. PMID:27007219

  9. The effect of recurrent floods on genetic composition of marble trout populations.

    PubMed

    Pujolar, José Martin; Vincenzi, Simone; Zane, Lorenzo; Jesensek, Dusan; De Leo, Giulio A; Crivelli, Alain J

    2011-01-01

    A changing global climate can threaten the diversity of species and ecosystems. We explore the consequences of catastrophic disturbances in determining the evolutionary and demographic histories of secluded marble trout populations in Slovenian streams subjected to weather extremes, in particular recurrent flash floods and debris flows causing massive mortalities. Using microsatellite data, a pattern of extreme genetic differentiation was found among populations (global F(ST) of 0.716), which exceeds the highest values reported in freshwater fish. All locations showed low levels of genetic diversity as evidenced by low heterozygosities and a mean of only 2 alleles per locus, with few or no rare alleles. Many loci showed a discontinuous allele distribution, with missing alleles across the allele size range, suggestive of a population contraction. Accordingly, bottleneck episodes were inferred for all samples with a reduction in population size of 3-4 orders of magnitude. The reduced level of genetic diversity observed in all populations implies a strong impact of genetic drift, and suggests that along with limited gene flow, genetic differentiation might have been exacerbated by recurrent mortalities likely caused by flash flood and debris flows. Due to its low evolutionary potential the species might fail to cope with an intensification and altered frequency of flash flood events predicted to occur with climate change.

  10. The Effect of Recurrent Floods on Genetic Composition of Marble Trout Populations

    PubMed Central

    Pujolar, José Martin; Vincenzi, Simone; Zane, Lorenzo; Jesensek, Dusan; De Leo, Giulio A.; Crivelli, Alain J.

    2011-01-01

    A changing global climate can threaten the diversity of species and ecosystems. We explore the consequences of catastrophic disturbances in determining the evolutionary and demographic histories of secluded marble trout populations in Slovenian streams subjected to weather extremes, in particular recurrent flash floods and debris flows causing massive mortalities. Using microsatellite data, a pattern of extreme genetic differentiation was found among populations (global FST of 0.716), which exceeds the highest values reported in freshwater fish. All locations showed low levels of genetic diversity as evidenced by low heterozygosities and a mean of only 2 alleles per locus, with few or no rare alleles. Many loci showed a discontinuous allele distribution, with missing alleles across the allele size range, suggestive of a population contraction. Accordingly, bottleneck episodes were inferred for all samples with a reduction in population size of 3–4 orders of magnitude. The reduced level of genetic diversity observed in all populations implies a strong impact of genetic drift, and suggests that along with limited gene flow, genetic differentiation might have been exacerbated by recurrent mortalities likely caused by flash flood and debris flows. Due to its low evolutionary potential the species might fail to cope with an intensification and altered frequency of flash flood events predicted to occur with climate change. PMID:21931617

  11. Population genetic structure of critically endangered salamander (Hynobius amjiensis) in China: recommendations for conservation.

    PubMed

    Yang, J; Chen, C S; Chen, S H; Ding, P; Fan, Z Y; Lu, Y W; Yu, L P; Lin, H D

    2016-06-10

    Amji's salamander (Hynobius amjiensis) is a critically endangered species (IUCN Red List), which is endemic to mainland China. In the present study, five haplotypes were genotyped for the mtDNA cyt b gene in 45 specimens from three populations. Relatively low levels of haplotype diversity (h = 0.524) and nucleotide diversity (π = 0.00532) were detected. Analyses of the phylogenic structure of H. amjiensis showed no evidence of major geographic partitions or substantial barriers to historical gene flow throughout the species' range. Two major phylogenetic haplotype groups were revealed, and were estimated to have diverged about 1.262 million years ago. Mismatch distribution analysis, neutrality tests, and Bayesian skyline plots revealed no evidence of dramatic changes in the effective population size. According to the SAMOVA and STRUCTURE analyses, H. amjiensis should be regarded as two different management units.

  12. Ecological connectivity assessment in a strongly structured fire salamander (Salamandra salamandra) population

    PubMed Central

    Bani, Luciano; Pisa, Giulia; Luppi, Massimiliano; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Orioli, Valerio

    2015-01-01

    Small populations are more prone to extinction if the dispersal among them is not adequately maintained by ecological connections. The degree of isolation between populations could be evaluated measuring their genetic distance, which depends on the respective geographic (isolation by distance, IBD) and/or ecological (isolation by resistance, IBR) distances. The aim of this study was to assess the ecological connectivity of fire salamander Salamandra salamandra populations by means of a landscape genetic approach. The species lives in broad-leaved forest ecosystems and is particularly affected by fragmentation due to its habitat selectivity and low dispersal capability. We analyzed 477 biological samples collected in 47 sampling locations (SLs) in the mainly continuous populations of the Prealpine and Eastern foothill lowland (PEF) and 10 SLs in the fragmented populations of the Western foothill (WF) lowland of Lombardy (northern Italy). Pairwise genetic distances (Chord distance, DC) were estimated from allele frequencies of 16 microsatellites loci. Ecological distances were calculated using one of the most promising methodology in landscape genetics studies, the circuit theory, applied to habitat suitability maps. We realized two habitat suitability models: one without barriers (EcoD) and a second one accounting for the possible barrier effect of main roads (EcoDb). Mantel tests between distance matrices highlighted how the Log-DC in PEF populations was related to log-transformed geographic distance (confirming a prevalence of IBD), while it was explained by the Log-EcoD, and particularly by the Log-EcoDb, in WF populations, even when accounting for the confounding effect of geographic distance (highlighting a prevalence of IBR). Moreover, we also demonstrated how considering the overall population, the effect of Euclidean or ecological distances on genetic distances acting at the level of a single group (PEF or WF populations) could not be detected, when

  13. Ecological connectivity assessment in a strongly structured fire salamander (Salamandra salamandra) population.

    PubMed

    Bani, Luciano; Pisa, Giulia; Luppi, Massimiliano; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Orioli, Valerio

    2015-08-01

    Small populations are more prone to extinction if the dispersal among them is not adequately maintained by ecological connections. The degree of isolation between populations could be evaluated measuring their genetic distance, which depends on the respective geographic (isolation by distance, IBD) and/or ecological (isolation by resistance, IBR) distances. The aim of this study was to assess the ecological connectivity of fire salamander Salamandra salamandra populations by means of a landscape genetic approach. The species lives in broad-leaved forest ecosystems and is particularly affected by fragmentation due to its habitat selectivity and low dispersal capability. We analyzed 477 biological samples collected in 47 sampling locations (SLs) in the mainly continuous populations of the Prealpine and Eastern foothill lowland (PEF) and 10 SLs in the fragmented populations of the Western foothill (WF) lowland of Lombardy (northern Italy). Pairwise genetic distances (Chord distance, DC) were estimated from allele frequencies of 16 microsatellites loci. Ecological distances were calculated using one of the most promising methodology in landscape genetics studies, the circuit theory, applied to habitat suitability maps. We realized two habitat suitability models: one without barriers (EcoD) and a second one accounting for the possible barrier effect of main roads (EcoDb). Mantel tests between distance matrices highlighted how the Log-DC in PEF populations was related to log-transformed geographic distance (confirming a prevalence of IBD), while it was explained by the Log-EcoD, and particularly by the Log-EcoDb, in WF populations, even when accounting for the confounding effect of geographic distance (highlighting a prevalence of IBR). Moreover, we also demonstrated how considering the overall population, the effect of Euclidean or ecological distances on genetic distances acting at the level of a single group (PEF or WF populations) could not be detected, when

  14. Effects of structural complexity enhancement on eastern red-backed salamander (Plethodon cinereus) populations in northern hardwood forests

    USGS Publications Warehouse

    McKenny, H.C.; Keeton, W.S.; Donovan, T.M.

    2006-01-01

    Managing for stand structural complexity in northern hardwood forests has been proposed as a method for promoting microhabitat characteristics important to eastern red-backed salamanders (Plethodon cinereus). We evaluated the effects of alternate, structure-based silvicultural systems on red-backed salamander populations at two research sites in northwestern Vermont. Treatments included two uneven-aged approaches (single-tree selection and group-selection) and one unconventional approach, termed "structural complexity enhancement" (SCE), that promotes development of late-successional structure, including elevated levels of coarse woody debris (CWD). Treatments were applied to 2 ha units and were replicated two to four times depending on treatment. We surveyed red-backed salamanders with a natural cover search method of transects nested within vegetation plots 1 year after logging. Abundance estimates corrected for detection probability were calculated from survey data with a binomial mixture model. Abundance estimates differed between study areas and were influenced by forest structural characteristics. Model selection was conducted using Akaike Information Criteria, corrected for over-dispersed data and small sample size (QAICc). We found no difference in abundance as a response to treatment as a whole, suggesting that all of the uneven-aged silvicultural systems evaluated can maintain salamander populations after harvest. However, abundance was tied to specific structural habitat attributes associated with study plots within treatments. The most parsimonious model of habitat covariates included site, relative density of overstory trees, and density of more-decayed and less-decayed downed CWD. Abundance responded positively to the density of downed, well-decayed CWD and negatively to the density of poorly decayed CWD and to overstory relative density. CWD volume was not a strong predictor of salamander abundance. We conclude that structural complexity enhancement

  15. Ancient DNA Assessment of Tiger Salamander Population in Yellowstone National Park

    PubMed Central

    McMenamin, Sarah K.; Hadly, Elizabeth A.

    2012-01-01

    Recent data indicates that blotched tiger salamanders (Ambystoma tigrinum melanostictum) in northern regions of Yellowstone National Park are declining due to climate-related habitat changes. In this study, we used ancient and modern mitochondrial haplotype diversity to model the effective size of this amphibian population through recent geological time and to assess past responses to climatic changes in the region. Using subfossils collected from a cave in northern Yellowstone, we analyzed >700 base pairs of mitochondrial sequence from 16 samples ranging in age from 100 to 3300 years old and found that all shared an identical haplotype. Although mitochondrial diversity was extremely low within the living population, we still were able to detect geographic subdivision within the local area. Using serial coalescent modelling with Bayesian priors from both modern and ancient genetic data we simulated a range of probable population sizes and mutation rates through time. Our simulations suggest that regional mitochondrial diversity has remained relatively constant even through climatic fluctuations of recent millennia. PMID:22427878

  16. Ancient DNA assessment of tiger salamander population in Yellowstone National Park.

    PubMed

    McMenamin, Sarah K; Hadly, Elizabeth A

    2012-01-01

    Recent data indicates that blotched tiger salamanders (Ambystoma tigrinum melanostictum) in northern regions of Yellowstone National Park are declining due to climate-related habitat changes. In this study, we used ancient and modern mitochondrial haplotype diversity to model the effective size of this amphibian population through recent geological time and to assess past responses to climatic changes in the region. Using subfossils collected from a cave in northern Yellowstone, we analyzed >700 base pairs of mitochondrial sequence from 16 samples ranging in age from 100 to 3300 years old and found that all shared an identical haplotype. Although mitochondrial diversity was extremely low within the living population, we still were able to detect geographic subdivision within the local area. Using serial coalescent modelling with Bayesian priors from both modern and ancient genetic data we simulated a range of probable population sizes and mutation rates through time. Our simulations suggest that regional mitochondrial diversity has remained relatively constant even through climatic fluctuations of recent millennia.

  17. Dramatic declines in neotropical salamander populations are an important part of the global amphibian crisis

    PubMed Central

    Rovito, Sean M.; Parra-Olea, Gabriela; Vásquez-Almazán, Carlos R.; Papenfuss, Theodore J.; Wake, David B.

    2009-01-01

    We document major declines of many species of salamanders at several sites in Central America and Mexico, with emphasis on the San Marcos region of Guatemala, one of the best studied and most diverse salamander communities in the Neotropics. Profound declines of several formerly abundant species, including 2 apparent extinctions, are revealed. Terrestrial microhabitat specialists at mid- to high elevations have declined more than microhabitat generalists. These terrestrial microhabitat specialists have largely disappeared from multiple sites in western Guatemala, including in well-protected areas, suggesting that the phenomenon cannot be explained solely by localized habitat destruction. Major declines in southern Mexican plethodontid salamanders occurred in the late 1970s to early 1980s, concurrent with or preceding many reported frog declines. The species in decline comprise several major evolutionary lineages of tropical salamanders, underscoring that significant portions of the phylogenetic diversity of Neotropical salamanders are at risk. Our results highlight the urgent need to document and understand Neotropical salamander declines as part of the larger effort to conserve global amphibian diversity. PMID:19204286

  18. Abundance and phenology patterns of two pond-breeding salamanders determine species interactions in natural populations.

    PubMed

    Anderson, Thomas L; Hocking, Daniel J; Conner, Christopher A; Earl, Julia E; Harper, Elizabeth B; Osbourn, Michael S; Peterman, William E; Rittenhouse, Tracy A G; Semlitsch, Raymond D

    2015-03-01

    Phenology often determines the outcome of interspecific interactions, where early-arriving species often dominate interactions over those arriving later. The effects of phenology on species interactions are especially pronounced in aquatic systems, but the evidence is largely derived from experimental studies. We examined whether differences in breeding phenology between two pond-breeding salamanders (Ambystoma annulatum and A. maculatum) affected metamorph recruitment and demographic traits within natural populations, with the expectation that the fall-breeding A. annulatum would negatively affect the spring-breeding A. maculatum. We monitored populations of each species at five ponds over 4 years using drift fences. Metamorph abundance and survival of A. annulatum were affected by intra- and interspecific processes, whereas metamorph size and date of emigration were primarily influenced by intraspecific effects. Metamorph abundance, snout-vent length, date of emigration and survival for A. maculatum were all predicted by combinations of intra- and interspecific effects, but often showed negative relationships with A. annulatum metamorph traits and abundance. Size and date of metamorphosis were strongly correlated within each species, but in opposite patterns (negative for A. annulatum and positive for A. maculatum), suggesting that the two species use alternative strategies to enhance terrestrial survival and that these factors may influence their interactions. Our results match predictions from experimental studies that suggest recruitment is influenced by intra- and interspecific processes which are determined by phenological differences between species. Incorporating spatiotemporal variability when modeling population dynamics is necessary to understand the importance of phenology in species interactions, especially as shifts in phenology occur under climate change.

  19. Detecting a hierarchical genetic population structure: the case study of the Fire Salamander (Salamandra salamandra) in Northern Italy

    PubMed Central

    Pisa, Giulia; Orioli, Valerio; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Bani, Luciano

    2015-01-01

    The multistep method here applied in studying the genetic structure of a low dispersal and philopatric species, such as the Fire Salamander Salamandra salamandra, was proved to be effective in identifying the hierarchical structure of populations living in broad-leaved forest ecosystems in Northern Italy. In this study, 477 salamander larvae, collected in 28 sampling populations (SPs) in the Prealpine and in the foothill areas of Northern Italy, were genotyped at 16 specie-specific microsatellites. SPs showed a significant overall genetic variation (Global FST = 0.032, P < 0.001). The genetic population structure was assessed by using STRUCTURE 2.3.4. We found two main genetic groups, one represented by SPs inhabiting the Prealpine belt, which maintain connections with those of the Eastern foothill lowland (PEF), and a second group with the SPs of the Western foothill lowland (WF). The two groups were significantly distinct with a Global FST of 0.010 (P < 0.001). While the first group showed a moderate structure, with only one divergent SP (Global FST = 0.006, P < 0.001), the second group proved more structured being divided in four clusters (Global FST = 0.017, P = 0.058). This genetic population structure should be due to the large conurbations and main roads that separate the WF group from the Prealpine belt and the Eastern foothill lowland. The adopted methods allowed the analysis of the genetic population structure of Fire Salamander from wide to local scale, identifying different degrees of genetic divergence of their populations derived from forest fragmentation induced by urban and infrastructure sprawl. PMID:25691995

  20. Detecting a hierarchical genetic population structure: the case study of the Fire Salamander (Salamandra salamandra) in Northern Italy.

    PubMed

    Pisa, Giulia; Orioli, Valerio; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Bani, Luciano

    2015-02-01

    The multistep method here applied in studying the genetic structure of a low dispersal and philopatric species, such as the Fire Salamander Salamandra salamandra, was proved to be effective in identifying the hierarchical structure of populations living in broad-leaved forest ecosystems in Northern Italy. In this study, 477 salamander larvae, collected in 28 sampling populations (SPs) in the Prealpine and in the foothill areas of Northern Italy, were genotyped at 16 specie-specific microsatellites. SPs showed a significant overall genetic variation (Global F ST = 0.032, P < 0.001). The genetic population structure was assessed by using STRUCTURE 2.3.4. We found two main genetic groups, one represented by SPs inhabiting the Prealpine belt, which maintain connections with those of the Eastern foothill lowland (PEF), and a second group with the SPs of the Western foothill lowland (WF). The two groups were significantly distinct with a Global F ST of 0.010 (P < 0.001). While the first group showed a moderate structure, with only one divergent SP (Global F ST = 0.006, P < 0.001), the second group proved more structured being divided in four clusters (Global F ST = 0.017, P = 0.058). This genetic population structure should be due to the large conurbations and main roads that separate the WF group from the Prealpine belt and the Eastern foothill lowland. The adopted methods allowed the analysis of the genetic population structure of Fire Salamander from wide to local scale, identifying different degrees of genetic divergence of their populations derived from forest fragmentation induced by urban and infrastructure sprawl.

  1. Estimation of Coast-Wide Population Trends of Marbled Murrelets in Canada Using a Bayesian Hierarchical Model.

    PubMed

    Bertram, Douglas F; Drever, Mark C; McAllister, Murdoch K; Schroeder, Bernard K; Lindsay, David J; Faust, Deborah A

    2015-01-01

    Species at risk with secretive breeding behaviours, low densities, and wide geographic range pose a significant challenge to conservation actions because population trends are difficult to detect. Such is the case with the Marbled Murrelet (Brachyramphus marmoratus), a seabird listed as 'Threatened' by the Species at Risk Act in Canada largely due to the loss of its old growth forest nesting habitat. We report the first estimates of population trend of Marbled Murrelets in Canada derived from a monitoring program that uses marine radar to detect birds as they enter forest watersheds during 923 dawn surveys at 58 radar monitoring stations within the six Marbled Murrelet Conservation Regions on coastal British Columbia, Canada, 1996-2013. Temporal trends in radar counts were analyzed with a hierarchical Bayesian multivariate modeling approach that controlled for variation in tilt of the radar unit and day of year, included year-specific deviations from the overall trend ('year effects'), and allowed for trends to be estimated at three spatial scales. A negative overall trend of -1.6%/yr (95% credibility interval: -3.2%, 0.01%) indicated moderate evidence for a coast-wide decline, although trends varied strongly among the six conservation regions. Negative annual trends were detected in East Vancouver Island (-9%/yr) and South Mainland Coast (-3%/yr) Conservation Regions. Over a quarter of the year effects were significantly different from zero, and the estimated standard deviation in common-shared year effects between sites within each region was about 50% per year. This large common-shared interannual variation in counts may have been caused by regional movements of birds related to changes in marine conditions that affect the availability of prey.

  2. Estimation of Coast-Wide Population Trends of Marbled Murrelets in Canada Using a Bayesian Hierarchical Model

    PubMed Central

    Schroeder, Bernard K.; Lindsay, David J.; Faust, Deborah A.

    2015-01-01

    Species at risk with secretive breeding behaviours, low densities, and wide geographic range pose a significant challenge to conservation actions because population trends are difficult to detect. Such is the case with the Marbled Murrelet (Brachyramphus marmoratus), a seabird listed as ‘Threatened’ by the Species at Risk Act in Canada largely due to the loss of its old growth forest nesting habitat. We report the first estimates of population trend of Marbled Murrelets in Canada derived from a monitoring program that uses marine radar to detect birds as they enter forest watersheds during 923 dawn surveys at 58 radar monitoring stations within the six Marbled Murrelet Conservation Regions on coastal British Columbia, Canada, 1996–2013. Temporal trends in radar counts were analyzed with a hierarchical Bayesian multivariate modeling approach that controlled for variation in tilt of the radar unit and day of year, included year-specific deviations from the overall trend (‘year effects’), and allowed for trends to be estimated at three spatial scales. A negative overall trend of -1.6%/yr (95% credibility interval: -3.2%, 0.01%) indicated moderate evidence for a coast-wide decline, although trends varied strongly among the six conservation regions. Negative annual trends were detected in East Vancouver Island (-9%/yr) and South Mainland Coast (-3%/yr) Conservation Regions. Over a quarter of the year effects were significantly different from zero, and the estimated standard deviation in common-shared year effects between sites within each region was about 50% per year. This large common-shared interannual variation in counts may have been caused by regional movements of birds related to changes in marine conditions that affect the availability of prey. PMID:26258803

  3. Calibrating abundance indices with population size estimators of red back salamanders (Plethodon cinereus) in a New England forest

    PubMed Central

    Ellison, Aaron M.; Jackson, Scott

    2015-01-01

    Herpetologists and conservation biologists frequently use convenient and cost-effective, but less accurate, abundance indices (e.g., number of individuals collected under artificial cover boards or during natural objects surveys) in lieu of more accurate, but costly and destructive, population size estimators to detect and monitor size, state, and trends of amphibian populations. Although there are advantages and disadvantages to each approach, reliable use of abundance indices requires that they be calibrated with accurate population estimators. Such calibrations, however, are rare. The red back salamander, Plethodon cinereus, is an ecologically useful indicator species of forest dynamics, and accurate calibration of indices of salamander abundance could increase the reliability of abundance indices used in monitoring programs. We calibrated abundance indices derived from surveys of P. cinereus under artificial cover boards or natural objects with a more accurate estimator of their population size in a New England forest. Average densities/m2 and capture probabilities of P. cinereus under natural objects or cover boards in independent, replicate sites at the Harvard Forest (Petersham, Massachusetts, USA) were similar in stands dominated by Tsuga canadensis (eastern hemlock) and deciduous hardwood species (predominantly Quercus rubra [red oak] and Acer rubrum [red maple]). The abundance index based on salamanders surveyed under natural objects was significantly associated with density estimates of P. cinereus derived from depletion (removal) surveys, but underestimated true density by 50%. In contrast, the abundance index based on cover-board surveys overestimated true density by a factor of 8 and the association between the cover-board index and the density estimates was not statistically significant. We conclude that when calibrated and used appropriately, some abundance indices may provide cost-effective and reliable measures of P. cinereus abundance that could

  4. Calibrating abundance indices with population size estimators of red back salamanders (Plethodon cinereus) in a New England forest.

    PubMed

    Siddig, Ahmed A; Ellison, Aaron M; Jackson, Scott

    2015-01-01

    Herpetologists and conservation biologists frequently use convenient and cost-effective, but less accurate, abundance indices (e.g., number of individuals collected under artificial cover boards or during natural objects surveys) in lieu of more accurate, but costly and destructive, population size estimators to detect and monitor size, state, and trends of amphibian populations. Although there are advantages and disadvantages to each approach, reliable use of abundance indices requires that they be calibrated with accurate population estimators. Such calibrations, however, are rare. The red back salamander, Plethodon cinereus, is an ecologically useful indicator species of forest dynamics, and accurate calibration of indices of salamander abundance could increase the reliability of abundance indices used in monitoring programs. We calibrated abundance indices derived from surveys of P. cinereus under artificial cover boards or natural objects with a more accurate estimator of their population size in a New England forest. Average densities/m(2) and capture probabilities of P. cinereus under natural objects or cover boards in independent, replicate sites at the Harvard Forest (Petersham, Massachusetts, USA) were similar in stands dominated by Tsuga canadensis (eastern hemlock) and deciduous hardwood species (predominantly Quercus rubra [red oak] and Acer rubrum [red maple]). The abundance index based on salamanders surveyed under natural objects was significantly associated with density estimates of P. cinereus derived from depletion (removal) surveys, but underestimated true density by 50%. In contrast, the abundance index based on cover-board surveys overestimated true density by a factor of 8 and the association between the cover-board index and the density estimates was not statistically significant. We conclude that when calibrated and used appropriately, some abundance indices may provide cost-effective and reliable measures of P. cinereus abundance that

  5. Genetic structure and diversity in an isolated population of an endemic mole salamander (Ambystoma rivulare Taylor, 1940) of central Mexico.

    PubMed

    Heredia-Bobadilla, Rosa-Laura; Monroy-Vilchis, Octavio; Zarco-González, Martha M; Martínez-Gómez, Daniel; Mendoza-Martínez, Germán David; Sunny, Armando

    2016-12-01

    Human activities are affecting the distribution of species worldwide by causing fragmentation and isolation of populations. Isolation and fragmentation lead to populations with lower genetic variability and an increased chance of inbreeding and genetic drift, which results in a loss of biological fitness over time. Studies of the genetic structure of small and isolated populations are critically important for management and conservation decisions. Ambystoma rivulare is a micro-endemic Mexican mole salamander from central Mexico. It is found in the most ecologically disturbed region in Mexico, the Trans-Mexican Volcanic Belt. The goal of this study of the population genetics of the micro-endemic mole salamander was to provide information to be used as a basis for future research and conservation planning of this species and other species of the Ambystoma genus in Mexico. The structural analysis found two subpopulations, one for each river sampled, with no signs of admixture and very high levels of genetic differentiation. Medium to high levels of heterozygosity and few alleles and genotypes were observed. Evidence of an ancestral genetic bottleneck, low values of effective population size, small inbreeding coefficients, and low gene flow were also found.

  6. Patch occupancy, number of individuals and population density of the Marbled White in a changing agricultural landscape

    NASA Astrophysics Data System (ADS)

    Lenda, Magdalena; Skórka, Piotr

    2010-09-01

    Metapopulation theory predicts the occurrence of animals in habitat patches. In this paper, we tested predictions based on this theory, including effects of spatial autocorrelation, to describe factors affecting the presence, local number of individuals and density of the Marbled White butterfly Melanargia galathea in habitat patches spread across the agricultural landscape of southern Poland. This agricultural landscape has undergone significant changes in recent decades due to the country's political transformation and is currently characterized by a large proportion of fallow (abandoned) land. We compared 48 occupied habitat patches with 60 unoccupied ones. Positive spatial autocorrelation was found in the number and density of individuals in habitat patches. The probability of patch occupancy was higher for patches that were larger, had a higher proportion of edges, were located closer to the nearest neighbouring local population and to the nearest piece of fallow, contained a smaller area of cut grass, and also had more nectar resources. The number of Marbled Whites in habitat patches was positively related to the patch area, the distance to the nearest fallow and the abundance of nectar resources, but was negatively related to the density of shrubs. The density of individuals was positively related to abundance of flowers, proportion of edge in a patch and distance to the nearest fallow, but it was negatively related to patch area, vegetation height and grass cover. These results indicate that recent land-use changes in agricultural landscapes have had both positive and negative effects on the presence and local number of individuals and density of the Marbled White. These changes affect the metapopulation of the species through changes in habitat quality and landscape connectivity in the area surrounding habitat patches.

  7. Temporal changes in allele frequencies in a small marble trout Salmo marmoratus population threatened by extreme flood events.

    PubMed

    Pujolar, J M; Vincenzi, S; Zane, L; Crivelli, A J

    2016-03-01

    The effect of extreme floods on the genetic composition of marble trout Salmo marmoratus living in Lipovscek, a tributary of the Soca River in Slovenia, which has been affected by multiple destructive flood events for centuries was investigated. By monitoring genetic variability during the period 2004-2011, apparent signatures of genetic erosion including a decline in observed and expected heterozygosities and allelic richness were observed. Contemporary effective population size was estimated between 11 and 55 individuals, which is congruent with census data. The data suggest asymmetric gene flow between the two sections of the river. The existence of substantial downstream migration (15-19%) was confirmed by paternity analysis. A small (1-3%) upstream migration was also suggested, which was confirmed by tagging data. Overall, low genetic diversity has not prevented the survival of the Lipovscek population, which might be a common feature of salmonid freshwater populations.

  8. Fine-Scale Habitat Associations of a Terrestrial Salamander: The Role of Environmental Gradients and Implications for Population Dynamics

    PubMed Central

    Peterman, William E.; Semlitsch, Raymond D.

    2013-01-01

    Environmental gradients are instrumental in shaping the distribution and local abundance of species because at the most fundamental level, an organism’s performance is constrained by the environment it inhabits. In topographically complex landscapes, slope, aspect, and vegetative cover interact to affect solar exposure, creating temperature-moisture gradients and unique microclimates. The significance of the interaction of abiotic gradients and biotic factors such as competition, movement, or physiology has long been recognized, but the scale at which these factors vary on the landscape has generally precluded their inclusion in spatial abundance models. We used fine-scale spatial data relating to surface-soil moisture, temperature, and canopy cover to describe the spatial distribution of abundance of a terrestrial salamander, Plethodon albagula, across the landscape. Abundance was greatest in dense-canopy ravine habitats with high moisture and low solar exposure, resulting in a patchy distribution of abundance. We hypothesize that these patterns reflect the physiological constraints of Plethodontid salamanders. Furthermore, demographic cohorts were not uniformly distributed among occupied plots on the landscape. The probability of gravid female occurrence was nearly uniform among occupied plots, but juveniles were much more likely to occur on plots with lower surface temperatures. The disconnect between reproductive effort and recruitment suggests that survival differs across the landscape and that local population dynamics vary spatially. Our study demonstrates a connection between abundance, fine-scale environmental gradients, and population dynamics, providing a foundation for future research concerning movement, population connectivity, and physiology. PMID:23671586

  9. Effects of hatching time for larval ambystomatid salamanders

    USGS Publications Warehouse

    Boone, M.D.; Scott, D.E.; Niewiarowski, P.H.

    2002-01-01

    In aquatic communities, the phenology of breeding may influence species interactions. In the early-breeding marbled salamander, Ambystoma opacum, timing of pond filling may determine whether interactions among larvae are competitive or predatory. The objectives of our studies were to determine how time of egg hatching affected size, larval period, and survival to metamorphosis in A. opacum, and if early-hatching in A. opacum influenced the competitive and predator-prey relationships with smaller larvae of the mole salamander, Ambystoma talpoideum. Salamander larvae were reared from hatching through metamorphosis in large, outdoor enclosures located in a natural temporary pond in Aiken County, South Carolina, in two experiments. In study 1, we reared early- and late-hatching A. opacum larvae separately from hatching through metamorphosis. In study 2, we examined how early- versus late-hatching A. opacum affected a syntopic species, A. talpoideum. In general, early-hatching A. opacum were larger and older at metamorphosis, had greater survival, and left the pond earlier than late-hatching larvae. Ambystoma talpoideum reared in the presence of early-hatching A. opacum had lower survival than in controls, suggesting that A. opacum may predate upon A. talpoideum when they gain a growth advantage over later-hatching larvae. Our studies demonstrate that time of pond filling and phenology of breeding may influence population dynamics and alter the nature of relationships that develop among species.

  10. Bayesian salamanders: analysing the demography of an underground population of the European plethodontid Speleomantes strinatii with state-space modelling

    PubMed Central

    2010-01-01

    Background It has been suggested that Plethodontid salamanders are excellent candidates for indicating ecosystem health. However, detailed, long-term data sets of their populations are rare, limiting our understanding of the demographic processes underlying their population fluctuations. Here we present a demographic analysis based on a 1996 - 2008 data set on an underground population of Speleomantes strinatii (Aellen) in NW Italy. We utilised a Bayesian state-space approach allowing us to parameterise a stage-structured Lefkovitch model. We used all the available population data from annual temporary removal experiments to provide us with the baseline data on the numbers of juveniles, subadults and adult males and females present at any given time. Results Sampling the posterior chains of the converged state-space model gives us the likelihood distributions of the state-specific demographic rates and the associated uncertainty of these estimates. Analysing the resulting parameterised Lefkovitch matrices shows that the population growth is very close to 1, and that at population equilibrium we expect half of the individuals present to be adults of reproductive age which is what we also observe in the data. Elasticity analysis shows that adult survival is the key determinant for population growth. Conclusion This analysis demonstrates how an understanding of population demography can be gained from structured population data even in a case where following marked individuals over their whole lifespan is not practical. PMID:20122249

  11. Marbles in Motion.

    ERIC Educational Resources Information Center

    Brown, Helen; Meyers, Bernice; Schmidt, William

    1999-01-01

    Marbles were successfully used to help primary students develop concepts of motion. Marble-unit activities began with shaking and rattling inference bags and predicting by listening just how many marbles were in each bag. Students made qualitative and quantitative observations of the marbles, manipulated marbles with a partner, and observed…

  12. Reproductive biology of Ambystoma salamanders in the southeastern United States

    USGS Publications Warehouse

    Glorioso, Brad M.; Waddle, J. Hardin; Hefner, Jeromi M.

    2015-01-01

    Reproductive aspects of Ambystoma salamanders were investigated at sites in Louisiana (2010–12) and Mississippi (2013). Three species occurred at the Louisiana site, Spotted Salamander (A. maculatum), Marbled Salamander (A. opacum), and Mole Salamander (A. talpoideum), whereas only Spotted Salamanders were studied at the Mississippi site. A total of 162 and 71 egg masses of Spotted Salamanders were examined at the Louisiana and Mississippi sites, respectively. Significantly more Spotted Salamander eggs per egg mass were observed at the Mississippi site (x̄ = 78.2) than the Louisiana site (x̄ = 53.8; P < 0.001). The mean snout–vent length of female Spotted Salamanders at the Mississippi site (82.9 mm) was significantly larger than the Louisiana site (76.1 mm; P < 0.001). Opaque Spotted Salamander egg masses were not found at the Mississippi site, but accounted for 11% of examined egg masses at the Louisiana site. The mean number of eggs per egg mass at the Louisiana site did not differ between opaque (47.3) and clear (54.6) egg masses (P = 0.21). A total of 47 egg masses of the Mole Salamander were examined, with a mean number of 6.7 embryos per mass. Twenty-three individual nests of the Marbled Salamander were found either under or in decaying logs in the dry pond basins. There was no difference between the mean numbers of eggs per mass of attended nests (93.0) versus those that were discovered unattended (86.6; P = 0.67). Females tended to place their nests at intermediate heights within the pond basin.

  13. Growth, survival, longevity, and population size of the Big Mouth Cave salamander (Gyrinophilus palleucus necturoides) from the type locality in Grundy County, Tennessee, USA

    USGS Publications Warehouse

    Niemiller, Matthew L.; Glorioso, Brad M.; Fenolio, Dante B.; Reynolds, R. Graham; Taylor, Steven J.; Miller, Brian T.

    2016-01-01

    Salamander species that live entirely in subterranean habitats have evolved adaptations that allow them to cope with perpetual darkness and limited energy resources. We conducted a 26-month mark–recapture study to better understand the individual growth and demography of a population of the Big Mouth Cave Salamander (Gyrinophilus palleucus necturoides). We employed a growth model to estimate growth rates, age at sexual maturity, and longevity, and an open population model to estimate population size, density, detectability, and survival rates. Furthermore, we examined cover use and evidence of potential predation. Individuals probably reach sexual maturity in 3–5 years and live at least nine years. Survival rates were generally high (>75%) but declined during the study. More than 30% of captured salamanders had regenerating tails or tail damage, which presumably represent predation attempts by conspecifics or crayfishes. Most salamanders (>90%) were found under cover (e.g., rocks, trash, decaying plant material). Based on 11 surveys during the study, population size estimates ranged from 21 to 104 individuals in the ca. 710 m2 study area. Previous surveys indicated that this population experienced a significant decline from the early 1970s through the 1990s, perhaps related to silvicultural and agricultural practices. However, our data suggest that this population has either recovered or stabilized during the past 20 years. Differences in relative abundance between early surveys and our survey could be associated with differences in survey methods or sampling conditions rather than an increase in population size. Regardless, our study demonstrates that this population is larger than previously thought and is in no immediate risk of extirpation, though it does appear to exhibit higher rates of predation than expected for a species believed to be an apex predator of subterranean food webs.

  14. [Effect of population density on enzymatic activity of antioxidative and phenol oxidase systems of imagoes and nymphs of the marble cockroach Nauphoeta cinerea].

    PubMed

    Murzagulov, G S; Saltykova, E S; Gaĭfullina, L R; Nikolenko, A G

    2013-01-01

    The work deals with effect of density of population on functional activity of components pf protective system of adult individuals and nymphs of the marble cockroach. The resistance of individuals has been noted to decrease both at individual maintenance and under conditions of overpopulation. Changes in activities of enzymes of antioxidative and phenoloxidase systems are studied ion the insect hemolymph and intestine. Possible consequences of isolation and overpopulation are discussed both for stability and for individual development.

  15. Salamander Saver

    ERIC Educational Resources Information Center

    Ilseman, Kelly; Hoffmann, Kristine

    2016-01-01

    On a spring morning in Maine, traps made of nets rise above vernal pools in a small wetland, ready to collect salamanders. The traps were designed by groups of rural and urban high school students from Maine and Massachusetts participating in the University of Maine Upward Bound Math Science Program (UBMS) at the university campus in Orono, Maine.…

  16. Metals, Parasites, and Environmental Conditions Affecting Breeding Populations of Spotted Salamanders (Ambystoma maculatum) in Northern Arkansas, USA.

    PubMed

    DeMali, Heather M; Trauth, Stanley E; Bouldin, Jennifer L

    2016-06-01

    The spotted salamander (Ambystoma maculatum) is indigenous to northern Arkansas, and several breeding sites are known to exist in the region. Spotted salamanders (n = 17) were collected and examined for parasites and only three females harbored nematodes (Physaloptera spp.). Chronic aquatic bioassays were conducted using water collected from eight breeding ponds during different hydroperiod events. No lethal or sublethal effects were measured in Ceriodaphnia dubia; however, decreased growth and survival were seen in Pimephales promelas. Aqueous, sediment, and salamander hepatic samples were analyzed for As, Cd, Cu, Pb, and Ni. Metal analysis revealed possible increased metal exposure following precipitation, with greatest metal concentrations measured in sediment samples. Hepatic metal concentrations were similar in parasitized and non-parasitized individuals, and greatest Pb concentrations were measured following normal precipitation events. Determining environmental stressors of amphibians, especially during their breeding and subsequent larval life stage, is imperative to improve species conservation.

  17. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders

    PubMed Central

    Ziemba, Julie L.

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from “non-invaded” and “pheretimoid invaded” sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance

  18. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders.

    PubMed

    Ziemba, Julie L; Hickerson, Cari-Ann M; Anthony, Carl D

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from "non-invaded" and "pheretimoid invaded" sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance following Asian

  19. Populations and productivity of seabirds at South Marble Island, Glacier Bay, Alaska, during May-July, 1999

    USGS Publications Warehouse

    Zador, Stephani G.; Piatt, John F.

    1999-01-01

    In the course of directed research on glaucous-winged gulls, we investigated the numbers and activities of all breeding and non-breeding seabirds associated with South Marble Island in Glacier Bay, Alaska, during mid-May to late July, 1999. Most observations were made from the island; additional observations were made during transportation to and from the island. Data were collected on the presence and numbers of all seabirds observed. Detailed information on breeding chronology and productivity were also collected for glaucous-winged gulls (Larus glaucescens), pigeon guillemots (Cepphus columba), black-legged kittiwakes (Rissa tridactyla), and black oystercatchers (Haemantopus bachmani).

  20. Separating Population Structure from Population History: A Cladistic Analysis of the Geographical Distribution of Mitochondrial DNA Haplotypes in the Tiger Salamander, Ambystoma Tigrinum

    PubMed Central

    Templeton, A. R.; Routman, E.; Phillips, C. A.

    1995-01-01

    Nonrandom associations of alleles or haplotypes with geographical location can arise from restricted gene flow, historical events (fragmentation, range expansion, colonization), or any mixture of these factors. In this paper, we show how a nested cladistic analysis of geographical distances can be used to test the null hypothesis of no geographical association of haplotypes, test the hypothesis that significant associations are due to restricted gene flow, and identify patterns of significant association that are due to historical events. In this last case, criteria are given to discriminate among contiguous range expansion, long-distance colonization, and population fragmentation. The ability to make these discriminations depends critically upon an adequate geographical sampling design. These points are illustrated with a worked example: mitochondrial DNA haplotypes in the salamander Ambystoma tigrinum. For this example, prior information exists about restricted gene flow and likely historical events, and the nested cladistic analyses were completely concordant with this prior information. This concordance establishes the plausibility of this nested cladistic approach, but much future work will be necessary to demonstrate robustness and to explore the power and accuracy of this procedure. PMID:7498753

  1. Effects of Timber Harvests and Silvicultural Edges on Terrestrial Salamanders

    PubMed Central

    MacNeil, Jami E.; Williams, Rod N.

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m). Small harvests (<4 ha) and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years

  2. Effects of timber harvests and silvicultural edges on terrestrial salamanders.

    PubMed

    MacNeil, Jami E; Williams, Rod N

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m). Small harvests (<4 ha) and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years

  3. Solid Mathematical Marbling.

    PubMed

    Lu, Shufang; Jin, Xiaogang; Jaffer, Aubrey; Gao, Fei; Mao, Xiaoyang

    2016-05-25

    Years of research have been devoted to computer-generated two-dimensional marbling. However, three-dimensional marbling has yet to be explored. In this paper, we present mathematical marbling of three-dimensional solids which supports a compact random-access vector representation. Our solid marbling textures are created by composing closed-form 3D pattern tool functions. These tool functions are an injection function and five deformation functions. The injection function is used to generate basic patterns, and the deformation functions are responsible for transforming the basic pattern into complex marbling effects. The resulting representation is feature preserving and resolution-independent. Our approach can render high-quality images preserving both the sharp features and the smooth color variations of a solid texture. When implemented on the GPU, our representation enables efficient color evaluation during the real-time solid marbling texture mapping. The color of a point in the volume space is computed by the 3D pattern tool functions from its coordinates. Our method consumes very little memory because only the mathematical functions and their corresponding parameters are stored. In addition, we develop an intuitive user interface and a genetic algorithm to facilitate the solid marbling texture authoring process. We demonstrate the effectiveness of our approach through various solid marbling textures and 3D objects carved from them.

  4. Marvelous Marbled Underwater Scenes

    ERIC Educational Resources Information Center

    Walkup, Nancy

    2005-01-01

    In an effort to intrigue her fifth graders with a novel and spontaneous approach to line and movement, Nancy Walkup introduced paper marbling as a means to create remarkable decorative surface designs. To marble paper, some kind of pigment, usually oil or acrylic paint, is floated upon the surface of a liquid such as water or liquid starch. In the…

  5. Tracing the first step to speciation: ecological and genetic differentiation of a salamander population in a small forest.

    PubMed

    Steinfartz, Sebastian; Weitere, Markus; Tautz, Diethard

    2007-11-01

    Mechanisms and processes of ecologically driven adaptive speciation are best studied in natural situations where the splitting process is still occurring, i.e. before complete reproductive isolation is achieved. Here, we present a case of an early stage of adaptive differentiation under sympatric conditions in the fire salamander, Salamandra salamandra, that allows inferring the underlying processes for the split. Larvae of S. salamandra normally mature in small streams until metamorphosis, but in an old, continuous forest area near Bonn (the Kottenforst), we found salamander larvae not only in small streams but also in shallow ponds, which are ecologically very different from small streams. Common-environment experiments with larvae from both habitat types reveal specific adaptations to these different ecological conditions. Mitochondrial and microsatellite analyses show that the two ecologically differentiated groups also show signs of genetic differentiation. A parallel analysis of animals from a neighbouring much larger forest area (the Eifel), in which larvae mature only in streams, shows no signs of genetic differentiation, indicating that gene flow between ecologically similar types can occur over large distances. Hence, geographical factors cannot explain the differential larval habitat adaptations in the Kottenforst, in particular since adult life and mating of S. salamandra is strictly terrestrial and not associated with larval habitats. We propose therefore that the evolution of these adaptations was coupled with the evolution of cues for assortative mating which would be in line with models of sympatric speciation that suggest a co-evolution of habitat adaptations and associated mating signals.

  6. A test of the central-marginal hypothesis using population genetics and ecological niche modelling in an endemic salamander (Ambystoma barbouri).

    PubMed

    Micheletti, Steven J; Storfer, Andrew

    2015-03-01

    The central-marginal hypothesis (CMH) predicts that population size, genetic diversity and genetic connectivity are highest at the core and decrease near the edges of species' geographic distributions. We provide a test of the CMH using three replicated core-to-edge transects that encompass nearly the entire geographic range of the endemic streamside salamander (Ambystoma barbouri). We confirmed that the mapped core of the distribution was the most suitable habitat using ecological niche modelling (ENM) and via genetic estimates of effective population sizes. As predicted by the CMH, we found statistical support for decreased genetic diversity, effective population size and genetic connectivity from core to edge in western and northern transects, yet not along a southern transect. Based on our niche model, habitat suitability is lower towards the southern range edge, presumably leading to conflicting core-to-edge genetic patterns. These results suggest that multiple processes may influence a species' distribution based on the heterogeneity of habitat across a species' range and that replicated sampling may be needed to accurately test the CMH. Our work also emphasizes the importance of identifying the geographic range core with methods other than using the Euclidean centre on a map, which may help to explain discrepancies among other empirical tests of the CMH. Assessing core-to-edge population genetic patterns across an entire species' range accompanied with ENM can inform our general understanding of the mechanisms leading to species' geographic range limits.

  7. Northwestern salamanders Ambystoma gracile in mountain lakes: record oviposition depths among salamanders

    USGS Publications Warehouse

    Hoffman, R.; Pearl, C.A.; Larson, G.L.; Samora, B.

    2012-01-01

    Oviposition timing, behaviors, and microhabitats of ambystomatid salamanders vary considerably (Egan and Paton 2004; Figiel and Semlitsch 1995; Howard and Wallace 1985; Mac-Cracken 2007). Regardless of species, however, females typically oviposit using sites conducive to embryo development and survival. For example, the results of an experiment by Figiel and Semlitsch (1995) on Ambystoma opacum (Marbled Salamander) oviposition indicated that females actively selected sites that were under grass clumps in wet versus dry treatments, and surmised that environmental conditions such as humidity, moisture, and temperature contributed to their results. Other factors associated with ambystomatid oviposition and embryo survival include water temperature (Anderson 1972; Brown 1976), dissolved oxygen concentration (Petranka et al. 1982; Sacerdote and King 2009), oviposition depth (Dougherty et al. 2005; Egan and Paton 2004), and oviposition attachment structures such as woody vegetation (McCracken 2007; Nussbaum et al. 1983). Resetarits (1996), in creating a model of oviposition site selection for anuran amphibians, hypothesized that oviparous organisms were also capable of modifying oviposition behavior and site selection to accommodate varying habitat conditions and to minimize potential negative effects of environmental stressors. Kats and Sih (1992), investigating the oviposition of Ambystoma barbouri (Streamside Salamander) in pools of a Kentucky stream, found that females preferred pools without predatory Lepomis cyanellus (Green Sunfish), and that the number of egg masses present in a pool historically containing fish increased significantly the year after fish had been extirpated from the pool. Palen et al. (2005) determined that Ambystoma gracile (Northwestern Salamander) and Ambystoma macrodactylum (Longtoed Salamander) eggs were deposited either at increased depth or in full shaded habitats, respectively, as water transperancy to UV-B radiation increased.

  8. From species divergence to population structure: a multimarker approach on the most basal lineage of Salamandridae, the spectacled salamanders (genus Salamandrina) from Italy.

    PubMed

    Hauswaldt, J Susanne; Angelini, Claudio; Gehara, Marcelo; Benavides, Edgar; Polok, Andy; Steinfartz, Sebastian

    2014-01-01

    The Apennine Peninsula is one of Europe's main glacial refugial areas and harbors a large number of lineages and species. Here, a pattern of higher genetic diversity in the south compared to that of the north is characteristic of most vertebrates; however, most studies that have produced these results have relied only on inferences based on mitochondrial DNA. The spectacled salamanders (genus Salamandrina) are endemic to the Apennine Peninsula and have diverged into two sibling species: S. terdigitata (in the south) and S. perspicillata (in the north), presumably in the late Miocene or early Pliocene. By sequencing one mitochondrial (cytb) and two nuclear genes (RAG1 and POMC) and genotyping 10 microsatellite loci, we traced the evolution of these sibling species from their divergence to their contemporary population structure at a fine scale. Using a multilocus coalescent-based approach, we estimated the temporal divergence of both species at approximately 2.25 mya (million years ago), which, hence, is much younger than previous estimates. The classical pattern of high genetic diversity in the south and lower diversity in the north was confirmed only for some markers, and the demographic histories of the two species differed substantially. Whereas S. perspicillata (north) expanded from a single major refugium in the center of the Apennine Peninsula, populations of S. terdigitata (south) persisted through cooler periods in multiple refugia. Further, the fine-scale population genetic structure of 16 S. perspicillata populations revealed significant genetic differentiation, even across short geographic distances. The results of our study stress that for a better understanding of phylogeographic patterns and past demographic processes, both mitochondrial and multiple nuclear loci should be analyzed to avoid gene-specific, and possibly biased results.

  9. Molecular phylogeography and population genetic structure of an endangered species Pachyhynobius shangchengensis (hynobiid Salamander) in a fragmented habitat of southeastern China.

    PubMed

    Zhao, Yanyu; Zhang, Yanhua; Li, Xiaochen

    2013-01-01

    The salamander Pachyhynobius shangchengensis (Hynobiidae) is a vulnerable species restricted to a patchy distribution associated with small mountain streams surrounded by forested slopes in the Mount Dabieshan region in southeastern China. However, molecular phylogeography and population genetic structure of P. shangchengensis remain poorly investigated. In this study, we explored the genetic structure and phylogeography of P. shangchengensis based on partial sequences of the mitochondrial DNA (mtDNA) cytochrome b and cytochrome c oxidase subunit I genes. Fifty-one haplotypes and four clades were found among 93 samples. Phylogenetic analyses revealed four deeply divergent and reciprocally monophyletic mtDNA lineages that approximately correspond to four geographic regions separated by complicated topography and long distances. The distinct geographic distributions of all lineages and the estimated divergence time suggest spatial and temporal separation coinciding with climatic changes during the Pleistocene. Analysis of molecular variance indicated that most of the observed genetic variation occurred among the four groups, implying long-term interruption of gene flow, and the possible separation of P. shangchengensis into four management units for conservation.

  10. Deterioration of marble structures

    SciTech Connect

    Cheng, R.J.; Hwu, H.R.; Kim, J.T.; Leu, S.M.

    1987-01-15

    The accelerated destruction of marble objects has focused attention on how the damage occurs and on the role of acid rain. Roger Cheng of the State University of New York and colleagues at the Johns Hopkins University describe their efforts to elucidate the process.

  11. Ancestry of unisexual salamanders.

    PubMed

    Hedges, S B; Bogart, J P; Maxson, L R

    1992-04-23

    In eastern North America there are populations of all-female salamanders that incorporate the nuclear genomes of two or three of four sympatric bisexual species. The hybrids can be diploid, triploid, tetraploid or pentaploid, and 18 different combinations have been reported. All hybrids require sperm from a sympatric male of one of the bisexual species to reproduce, but the sperm may or may not be incorporated in the egg. Some of the hybrids are believed to represent separate, clonal species, but little is known of the origin of this hybrid complex. Vertebrate mitochondrial DNA is inherited maternally, allowing identification of the female parent that gave rise to hybrid lineages. A portion of the cytochrome b gene was sequenced from diploid and triploid hybrids that represent combinations of all four species. Nearly all hybrids had a similar mitochondrial genome sequence, independent of nuclear genome composition and ploidy, and the sequence was distinct from that of any of the four bisexual species. The hybrids maintain a mitochondrial lineage that has evolved independently of their nuclear genome and represent the most ancient known unisexual vertebrate lineage.

  12. Evolutionary cytogenetics in salamanders.

    PubMed

    Sessions, Stanley K

    2008-01-01

    Salamanders (Amphibia: Caudata/Urodela) have been the subject of numerous cytogenetic studies, and data on karyotypes and genome sizes are available for most groups. Salamanders show a more-or-less distinct dichotomy between families with large chromosome numbers and interspecific variation in chromosome number, relative size, and shape (i.e. position of the centromere), and those that exhibit very little variation in these karyological features. This dichotomy is the basis of a major model of karyotype evolution in salamanders involving a kind of 'karyotypic orthoselection'. Salamanders are also characterized by extremely large genomes (in terms of absolute mass of nuclear DNA) and extensive variation in genome size (and overall size of the chromosomes), which transcends variation in chromosome number and shape. The biological significance and evolution of chromosome number and shape within the karyotype is not yet understood, but genome size variation has been found to have strong phenotypic, biogeographic, and phylogenetic correlates that reveal information about the biological significance of this cytogenetic variable. Urodeles also present the advantage of only 10 families and less than 600 species, which facilitates the analysis of patterns within the entire order. The purpose of this review is to present a summary of what is currently known about overall patterns of variation in karyology and genome size in salamanders. These patterns are discussed within an evolutionary context.

  13. Ambystoma maculatum (spotted salamander). Reproduction

    USGS Publications Warehouse

    Glorioso, Brad M.; Waddle, Hardin; Hefner, Jeromi

    2012-01-01

    The Spotted Salamander is a wide-ranging salamander of the eastern United States that typically breeds in winter or early spring in ephemeral pools in lowland forests. Ambystoma maculatum is known to deposit 2-4 egg masses per year, each containing 1-250 eggs. As part of ongoing research into the ecology and reproductive biology of Spotted Salamanders in the Kisatchie District of Kisatchie National Forest in Natchitoches Parish, Louisiana, USA, we have been counting the number of embryos per egg mass. We captured seven female A. maculatum in a small pool, six of which were still gravid. We took standard measurements, including SVL, and then implanted a Passive Integrated Transponder (PIT tag) into each adult female as was the protocol. About an hour after processing these animals we marked new A. maculatum egg masses found in the same small pool using PVC pin flags pushed carefully through the outer jelly. We did not have enough time to process them that evening, and it was not until a few days later that we photographed those masses. We discovered that one of the masses contained a PIT tag in the outer jelly that corresponded to one of the six gravid females that were marked that same evening. To our knowledge, this is the first report of PIT tags being the means, albeit coincidentally, by which a particular egg mass of Ambystoma maculatum has been assigned to a particular female. For our purposes, losing the PIT tag from the adult female is counter to the goals of our study of this population, and we will no longer be implanting PIT tags into gravid females.

  14. Quantity discrimination in salamanders.

    PubMed

    Krusche, Paul; Uller, Claudia; Dicke, Ursula

    2010-06-01

    We investigated discrimination of large quantities in salamanders of the genus Plethodon. Animals were challenged with two different quantities (8 vs 12 or 8 vs 16) in a two-alternative choice task. Stimuli were live crickets, videos of live crickets or images animated by a computer program. Salamanders reliably chose the larger of two quantities when the ratio between the sets was 1:2 and stimuli were live crickets or videos thereof. Magnitude discrimination was not successful when the ratio was 2:3, or when the ratio was 1:2 when stimuli were computer animated. Analysis of the salamanders' success and failure as well as analysis of stimulus features points towards movement as a dominant feature for quantity discrimination. The results are generally consistent with large quantity discrimination investigated in many other animals (e.g. primates, fish), current models of quantity representation (analogue magnitudes) and data on sensory aspects of amphibian prey-catching behaviour (neuronal motion processing).

  15. Effects of urbanization on occupancy of stream salamanders.

    PubMed

    Price, Steven J; Cecala, Kristen K; Browne, Robert A; Dorcas, Michael E

    2011-06-01

    Urban development is the most common form of land conversion in the United States. Using a before-after control-impact study design, we investigated the effects of urbanization on larval and adult stages of southern two-lined salamanders (Eurycea cirrigera) and northern dusky salamanders (Desmognathus fuscus). Over 5 years, we estimated changes in occupancy and probabilities of colonization and survival in 13 stream catchments after urbanization and in 17 catchments that were not urbanized. We also examined effects of proportion of urbanized area in a catchment and distance of the salamander population to the nearest stream on probabilities of colonization and survival. Before urbanization, adult and larval stages of the two salamander species occupied nearly all surveyed streams, with occupancy estimates ranging from 1.0 to 0.78. Four years after urbanization mean occupancy of larval and adult two-lined salamanders had decreased from 0.87 and 0.78 to 0.57 and 0.39, respectively. Estimates of mean occupancy of larval northern dusky salamanders decreased from 1.0 to 0.57 in urban streams 4 years after urbanization; however, adult northern dusky salamander occupancy remained close to 1.0 in urban streams over 5 years. Occupancy estimates in control streams were similar for each species and stage over 5 years. Urbanization was associated with decreases in survival probabilities of adult and larval two-lined salamanders and decreases in colonization probabilities of larval dusky salamanders. Nevertheless, proportion of impervious surface and distance to nearest stream had little effect on probabilities of survival and colonization. Our results imply that in the evaluation of the effects of urbanization on species, such as amphibians, with complex life cycles, consideration of the effects of urbanization on both adult and larval stages is required.

  16. The influence of ecology and genetics on behavioral variation in salamander populations across the Eastern Continental Divide.

    PubMed

    Rissler, Leslie J; Wilbur, Henry M; Taylor, Douglas R

    2004-08-01

    Understanding the unique contributions of ecology and history to the distribution of species within communities requires an integrative approach. The Eastern Continental Divide in southwestern Virginia separates river drainages that differ in species composition: the more aquatic, predatory Desmognathus quadramaculatus is present only in the New River drainage (which drains to the Gulf of Mexico), while Desmognathus monticola is present in both the New River drainage and the James River drainage (which drains to the Atlantic Ocean). We investigated natural distributions, behavioral variation in experimental mesocosms, population genetic, and phylogenetic implications of community structure. The presence of D. quadramaculatus increased the terrestriality of D. monticola in natural and experimental situations but to different degrees in allopatric and sympatric populations. Our ecological data suggest that the degree of terrestriality in D. monticola is a result of a balance between the optimal aquatic habitat and risks of predation. Our genetic analyses suggest that D. monticola has experienced a recent range expansion and has only a recent history of association with D. quadramaculatus in Virginia. This is surprising given the strong behavioral variation that exists in populations experiencing unique community compositions over a scale of meters. This study demonstrates the need to combine both ecology and genetics toward an understanding of the factors affecting species distributions, behavioral variation between populations, and patterns of genetic variation across a landscape.

  17. Native Salamanders and Introduced Fish: Changing the Nature of Mountain Lakes and Ponds

    USGS Publications Warehouse

    Larson, Gary L.; Hoffman, Robert L.

    2003-01-01

    During the last century, many fishless mountain lakes and ponds in the Pacific Northwest were stocked with non-native fish, such as brook trout, for recreational purposes. These introduced fish replaced long-toed and northwestern salamander larvae as the top aquatic vertebrate predator by preying on salamander larvae. This predatory interaction has been shown to reduce the abundances of larval salamander populations. We conducted studies in two national parks to assess the abundances of salamander larvae in lakes with and without introduced fish. These studies suggest that the two salamander species were affected quite differently by the presence of introduced fish because of different life-history traits and different distributions of salamanders and fish within each park.

  18. Terrestrial salamander abundance on reclaimed mountaintop removal mines

    USGS Publications Warehouse

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Mountaintop removal mining, a large-scale disturbance affecting vegetation, soil structure, and topography, converts landscapes from mature forests to extensive grassland and shrubland habitats. We sampled salamanders using drift-fence arrays and coverboard transects on and near mountaintop removal mines in southern West Virginia, USA, during 2000–2002. We compared terrestrial salamander relative abundance and species richness of un-mined, intact forest with habitats on reclaimed mountaintop removal mines (reclaimed grassland, reclaimed shrubland, and fragmented forest). Salamanders within forests increased in relative abundance with increasing distance from reclaimed mine edge. Reclaimed grassland and shrubland habitats had lower relative abundance and species richness than forests. Characteristics of reclaimed habitats that likely contributed to lower salamander abundance included poor soils (dry, compacted, little organic matter, high rock content), reduced vertical structure of vegetation and little tree cover, and low litter and woody debris cover. Past research has shown that salamander populations reduced by clearcutting may rebound in 15–24 years. Time since disturbance was 7–28 years in reclaimed habitats on our study areas and salamander populations had not reached levels found in adjacent mature forests.

  19. Terrestrial distribution of pond-breeding salamanders around an isolated wetland.

    PubMed

    Scott, David E; Komoroski, Mark J; Croshaw, Dean A; Dixon, Philip M

    2013-11-01

    Terrestrial habitats surrounding isolated wetlands are a critical resource for many pond-breeding amphibian species, yet few studies have examined the terrestrial distribution of post-metamorphic juveniles and adults. We used an encircling drift fence at a breeding pond in conjunction with partial fences at 90, 172, and 332 m from the wetland to estimate the terrestrial distribution of adult marbled salamanders (Ambystoma opacum; four breeding seasons) and mole salamanders (A. talpoideum; two seasons), as well as the dispersion of newly metamorphosed A. opacum (one summer). For newly metamorphosed A. opacum, 79% emigrated < 90 m from the wetland, and 8% moved beyond 172 m; movement distance was unrelated to body size. Distribution of adult A. opacum varied among years, with an average of 28% (range 23-31%) occurring beyond 172 m in all years. Averaged across two years, 51% of adult A. talpoideum occurred beyond 172 m. Lognormal models provided a good fit to both the juvenile and adult ambystomatid distributions, and parameters differed between age classes, sexes, species, and years within species. For adult A. opacum a buffer radius of 300 m or 340 m, depending on the year, is estimated to include 95% of adults; for A. talpoideum the estimate is 464 m or 501 m. A reanalysis of distribution data for seven ambystomatid species shows that a previous estimate of a 164-m radius to protect 95% of a population underestimates the needed buffer radius by 185 m. Because our study wetland requires a nearly 500 m wide radius to protect 95% of its ambystomatid adults, preservation of similar communities may require much more surrounding terrestrial habitat than previously thought.

  20. The Blue Marble

    NASA Technical Reports Server (NTRS)

    2002-01-01

    This spectacular Moderate Resolution Imaging Spectroradiometer (MODIS) 'blue marble' image is based on the most detailed collection of true-color imagery of the entire Earth to date. Using a collection of satellite-based observations, scientists and visualizers stitched together months of observations of the land surface, oceans, sea ice, and clouds into a seamless, true-color mosaic of every square kilometer (.386 square mile) of our planet. Most of the information contained in this image came from MODIS, illustrating MODIS' outstanding capacity to act as an integrated tool for observing a variety of terrestrial, oceanic, and atmospheric features of the Earth. The land and coastal ocean portions of this image is based on surface observations collected from June through September 2001 and combined, or composited, every eight days to compensate for clouds that might block the satellite's view on any single day. Global ocean color (or chlorophyll) data was used to simulate the ocean surface. MODIS doesn't measure 3-D features of the Earth, so the surface observations were draped over topographic data provided by the U.S. Geological Survey EROS Data Center. MODIS observations of polar sea ice were combined with observations of Antarctica made by the National Oceanic and Atmospheric Administration's AVHRR sensor-the Advanced Very High Resolution Radiometer. The cloud image is a composite of two days of MODIS imagery collected in visible light wavelengths and a third day of thermal infra-red imagery over the poles. A large collection of imagery based on the blue marble in a variety of sizes and formats, including animations and the full (1 km) resolution imagery, is available at the Blue Marble page. Image by Reto Stockli, Render by Robert Simmon. Based on data from the MODIS Science Team

  1. Impact of valley fills on streamside salamanders in southern West Virginia

    USGS Publications Warehouse

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Valley fills associated with mountaintop-removal mining bury stream headwaters and affect water quality and ecological function of reaches below fills. We quantified relative abundance of streamside salamanders in southern West Virginia during 2002 in three streams below valley fills (VFS) and in three reference streams (RS). We surveyed 36 10- × 2-m stream transects, once in summer and fall, paired by order and structure. Of 2,343 salamanders captured, 66.7% were from RS. Total salamanders (adults plus larvae) were more abundant in RS than VFS for first-order and second-order reaches. Adult salamanders had greater abundance in first-order reaches of RS than VFS. Larval salamanders were more abundant in second-order reaches of RS than VFS. No stream width or mesohabitat variables differed between VFS and RS. Only two cover variables differed. Silt cover, greater in VFS than RS first-order reaches, is a likely contributor to reduced abundance of salamanders in VFS. Second-order RS had more boulder cover than second-order VFS, which may have contributed to the higher total and larval salamander abundance in RS. Water chemistry assessments of our VFS and RS reported elevated levels of metal and ion concentrations in VFS, which can depress macroinvertebrate populations and likely affect salamander abundance. Valley fills appear to have significant negative effects on stream salamander abundance due to alterations in habitat structure, water quality and chemistry, and macroinvertebrate communities in streams below fills.

  2. Portugues Marbles as Stone Heritage

    NASA Astrophysics Data System (ADS)

    Lopes, Luis; Martins, Ruben

    2013-04-01

    The main objective of this paper is to present and justify the reasons for the worldwide recognition of Portuguese Marbles as Stone Heritage. These marbles are also known as "Estremoz Marble" since was the first county were exploited. In the Estremoz Anticline marbles occupy an intermediate stratigraphic position being part of a volcano-sedimentary sequence of Cambrian age. The anticlinal structure has a Precambrian core and the younger rocks aged Devonian Period. This sequence has deformed by the Variscan Orogeny, which performed twice with different intensities both in ductile and brittle tension fields. The early Alpine Cycle also acts in the region and cause more fracturing of the marble. Practically in all the quarries is possible to perceive the spatial-temporal continuity of the deformation where one can describe a complete Wilson Cycle. Together all these geological features imprint the marbles beautiful aesthetic patterns that can be highlighted when used as dimension stone. Nowadays most of the quarries are placed in the counties of Borba and mainly in Vila Viçosa. This last city claims for itself the "Capital of the Marble" title and named the marble as "White Gold". In fact, according to the historical record, the marbles were quarried in Portuguese Alentejo's Province since the fourth century BC. Locally these geological materials are available easily accessible. Exhibit physical properties that allow the fabrication of structural and decorative elements and so were used since humans settled in the region and developed a structured Society. In the Roman period, the pieces of art made with Estremoz Marbles were exported abroad and today are represented in Museums and Archaeological Sites throughout Europe and North Africa countries. The Portuguese Marbles and Limestones, transformed into altars, stairways, columns, statues and pieces of wall cladding, were carried as ballast in the holds of ships. At the destination the Portuguese People had built

  3. From lamprey to salamander: an exploratory modeling study on the architecture of the spinal locomotor networks in the salamander.

    PubMed

    Bicanski, Andrej; Ryczko, Dimitri; Cabelguen, Jean-Marie; Ijspeert, Auke Jan

    2013-10-01

    The evolutionary transition from water to land required new locomotor modes and corresponding adjustments of the spinal "central pattern generators" for locomotion. Salamanders resemble the first terrestrial tetrapods and represent a key animal for the study of these changes. Based on recent physiological data from salamanders, and previous work on the swimming, limbless lamprey, we present a model of the basic oscillatory network in the salamander spinal cord, the spinal segment. Model neurons are of the Hodgkin-Huxley type. Spinal hemisegments contain sparsely connected excitatory and inhibitory neuron populations, and are coupled to a contralateral hemisegment. The model yields a large range of experimental findings, especially the NMDA-induced oscillations observed in isolated axial hemisegments and segments of the salamander Pleurodeles waltlii. The model reproduces most of the effects of the blockade of AMPA synapses, glycinergic synapses, calcium-activated potassium current, persistent sodium current, and [Formula: see text]-current. Driving segments with a population of brainstem neurons yields fast oscillations in the in vivo swimming frequency range. A minimal modification to the conductances involved in burst-termination yields the slower stepping frequency range. Slow oscillators can impose their frequency on fast oscillators, as is likely the case during gait transitions from swimming to stepping. Our study shows that a lamprey-like network can potentially serve as a building block of axial and limb oscillators for swimming and stepping in salamanders.

  4. Subcritical crack growth in marble

    NASA Astrophysics Data System (ADS)

    Nara, Yoshitaka; Nishida, Yuki; Toshinori, Ii; Harui, Tomoki; Tanaka, Mayu; Kashiwaya, Koki

    2016-04-01

    It is essential to study time-dependent deformation and fracturing in various rock materials to prevent natural hazards related to the failure of a rock mass. In addition, information of time-dependent fracturing is essential to ensure the long-term stability of a rock mass surrounding various structures. Subcritical crack growth is one of the main causes of time-dependent fracturing in rock. It is known that subcritical crack growth is influenced by not only stress but also surrounding environment. Studies of subcritical crack growth have been widely conducted for silicate rocks such as igneous rocks and sandstones. By contrast, information of subcritical crack growth in carbonate rocks is not enough. Specifically, influence of surrounding environment on subcritical crack growth in carbonate rock should be clarified to ensure the long-term stability of a rock mass. In this study, subcritical crack growth in marble was investigated. Especially, the influence of the temperature, relative humidity and water on subcritical crack growth in marble is investigated. As rock samples, marbles obtained in Skopje-City in Macedonia and Carrara-City in Italy were used. To measure subcritical crack growth, we used the load relaxation method of the double-torsion (DT) test. All measurements by DT test were conducted under controlled temperature and relative humidity. For both marbles, it was shown that the crack velocity in marble in air increased with increasing relative humidity at a constant temperature. Additionally, the crack velocity in water was much higher than that in air. It was also found that the crack velocity increased with increasing temperature. It is considered that temperature and water have significant influences on subcritical crack growth in marble. For Carrara marble in air, it was recognized that the value of subcritical crack growth index became low when the crack velocity was higher than 10-4 m/s. This is similar to Region II of subcritical crack growth

  5. Marble Cake Perspectives

    NASA Astrophysics Data System (ADS)

    Langmuir, C. H.

    2007-12-01

    Since the original suggestions by Hanson (Geol. Soc. London, 1977) and Allegre and Turcotte (Nature, 1986), the concept of a "veined" or "marble cake" mantle has gained wide acceptance as a paradigm for mantle composition and components. The "veined mantle" was conceived thinking of the mantle as an ultramafic migmatite with many types of veins, but emphasized metasomatic components contained in hydrous phases as an explanation for alkali basalts. The "marble cake" mantle emphasized recycled oceanic lithosphere. Both types of veins are inevitable consequences of mantle convection. Oceanic lithosphere is recycled and stretched; low melting components of the mantle are inevitably melted in ascending mantle flow, even beneath thick lithsosphere. Both vein types have been widely invoked to explain incompatible element enriched basalts from the mantle. Most recently, disequilibrium melting of veined mantle sources by various mechanisms have become a popular suggestion to explain diverse aspects of mantle geochemistry (e.g. Sobolev et al., Nature, 2005; Phipps Morgan et al., EPSL, 1999). The physical mechanisms that would allow disequilibrium melting of fine scale veins, however, remain to be demonstrated. Average upper mantle composition is residual to continents and requires removal of low F melts to generate the depleted MORB source, and enrichment by low F melts to create the enriched source. Such a process is also necessary in the Sobolev et al model for Hawaii, which generates the equivalent of a low F melt by two stages of larger degree melting. Enriched sources are not restricted to ocean islands, and the name "OIB source" is a misnomer. Enriched basalts occur on normal ridges, in back-arc basins, behind subduction zones, in continental rifts and in isolated volcanic cones. Most of these are not mantle plumes. Enriched components have been ascribed to recycled ocean lithosphere, but recycled ocean crust is depleted, not enriched. Therefore the isotopic signature

  6. Plethodon cinereus (Redback Salamander) predation

    USGS Publications Warehouse

    Jung, R.E.; Ward, W.L.; Kings, C.O.; Weir, L.A.

    2000-01-01

    In 1999 at the Patuxent Research Refuge, we observed a large rove beetle (Staphylinus maculosus) consuming an eviscerated redback salamander (Plethodon cinereus) underneath a coverboard. Rove beetles typically eat invertebrates.

  7. SPATIALLY AUTOCORRELATED DEMOGRAPHY AND INTERPOND MIGRATION IN THE CALIFORNIA TIGER SALAMANDER (AMBYSTOME CALIFORNIENSE)

    EPA Science Inventory

    We investigated the metapopulation structure of the California tiger salamander (Ambystoma californiense) using a combination of indirect and direct methods to evaluate two key requirements of modern metapopulation models: 1) that patches support somewhat independent populations ...

  8. Marble decay due to microcracking

    NASA Astrophysics Data System (ADS)

    Shushakova, V.; Fuller, E. R., Jr.; Heidelbach, F.; Siegesmund, S.

    2012-04-01

    An actual degradation phenomenon of marble structures, i.e., microcracking, is examined via computer simulations with a microstructure-based finite element modelling. Crack initiation and crack propagation were characterized, as well their dependence on grain- shape preferred orientation (SPO), lattice preferred orientation (LPO), grain size and grain-boundary fracture toughness. Calcite is used as an illustrative example. Results are expected to be general for myriad marble microstructures, as the thermophysical properties of various marbles do not differ that much. Three SPOs were analyzed: equiaxed grains; elongated grains and a mixture of equiaxed and elongated grains. Six LPOs were considered: a random orientation distribution function (ODF); an ODF with strong directional crystal texture generated via March Dollase fiber-texture; and four types of actual marble texture as measured on marble samples with electron back-scattered diffraction (EBSD). Two different grain sizes were analyzed: fine grains range up to 200μm and medium size grains of approximate 1mm. The fracture surface energy for the grain boundaries was chosen to be 20 % and 40 % of the fracture surface energy of a grain, so that both intergranular and transgranular fractures were possible. Simulations were performed for both heating and cooling by 50 °C in steps of 1 °C. Microcracking results were correlated with the thermoelastic responses (indicators) related to degradation. Certain combinations of SPO, LPO, grain size, and grain-boundary fracture toughness have a significant influence on the thermal-elastic response of marble. For instance, thermal stresses and elastic strain energy are a strong function of the LPO. With increasing LPO the strain energy density and the maximum principal stress decreases. With decreasing grain size and increasing LPO and SPO, the area of microcracking is smaller and microcracking commences at a higher temperature differential.

  9. The Tower and Glass Marbles Problem

    ERIC Educational Resources Information Center

    Denman, Richard T.; Hailey, David; Rothenberg, Michael

    2010-01-01

    The Catseye Marble company tests the strength of its marbles by dropping them from various levels of their office tower, to find the highest floor from which a marble will not break. We find the smallest number of drops required and from which floor each drop should be made. We also find out how these answers change if a restriction is placed on…

  10. Landmark learning by juvenile salamanders (Ambystoma maculatum).

    PubMed

    Heuring, Whitney L; Mathis, Alicia

    2014-10-01

    Learning to use a landmark as a beacon to locate resources is one of the simplest forms of spatial learning. We tested whether landmark learning occurs in a semifossorial salamander that migrates annually to breeding ponds as adults. Juvenile spotted salamanders (Ambystoma maculatum) were tested in square containers with a plastic feeding dish in each corner, and a piece of earthworm was placed in one randomly-chosen dish. For landmark-trained salamanders, a rock was placed beside the dish containing the prey. For control salamanders, the rock was placed beside a randomly selected feeding dish. Each salamander was trained once every 2 days for 30 days. Significantly more landmark-trained salamanders than control salamanders entered the landmark area first, and landmark-trained individuals had faster latencies to enter the landmark area and longer stay-times. These results suggest that spotted salamanders are able to locate resources by associating their positions with landmarks.

  11. Evaluation of terrestrial and streamside salamander monitoring techniques at Shenandoah National Park

    USGS Publications Warehouse

    Jung, R.E.; Droege, S.; Sauer, J.R.; Landy, R.B.

    2000-01-01

    In response to concerns about amphibian declines, a study evaluating and validating amphibian monitoring techniques was initiated in Shenandoah and Big Bend National Parks in the spring of 1998. We evaluate precision, bias, and efficiency of several sampling methods for terrestrial and streamside salamanders in Shenandoah National Park and assess salamander abundance in relation to environmental variables, notably soil and water pH. Terrestrial salamanders, primarily redback salamanders (Plethodon cinereus), were sampled by searching under cover objects during the day in square plots (10 to 35 m2). We compared population indices (mean daily and total counts) with adjusted population estimates from capture-recapture. Analyses suggested that the proportion of salamanders detected (p) during sampling varied among plots, necessitating the use of adjusted population estimates. However, adjusted population estimates were less precise than population indices, and may not be efficient in relating salamander populations to environmental variables. In future sampling, strategic use of capture-recapture to verify consistency of p's among sites may be a reasonable compromise between the possibility of bias in estimation of population size and deficiencies due to inefficiency associated with the estimation of p. The streamside two-lined salamander (Eurycea bislineata) was surveyed using four methods: leaf litter refugia bags, 1 m2 quadrats, 50 x 1 m visual encounter transects, and electric shocking. Comparison of survey methods at nine streams revealed congruent patterns of abundance among sites, suggesting that relative bias among the methods is similar, and that choice of survey method should be based on precision and logistical efficiency. Redback and two-lined salamander abundance were not significantly related to soil or water pH, respectively.

  12. The marbled crayfish as a paradigm for saltational speciation by autopolyploidy and parthenogenesis in animals

    PubMed Central

    Vogt, Günter; Falckenhayn, Cassandra; Schrimpf, Anne; Schmid, Katharina; Hanna, Katharina; Panteleit, Jörn; Helm, Mark; Schulz, Ralf; Lyko, Frank

    2015-01-01

    ABSTRACT The parthenogenetic all-female marbled crayfish is a novel research model and potent invader of freshwater ecosystems. It is a triploid descendant of the sexually reproducing slough crayfish, Procambarus fallax, but its taxonomic status has remained unsettled. By cross-breeding experiments and parentage analysis we show here that marbled crayfish and P. fallax are reproductively separated. Both crayfish copulate readily, suggesting that the reproductive barrier is set at the cytogenetic rather than the behavioural level. Analysis of complete mitochondrial genomes of marbled crayfish from laboratory lineages and wild populations demonstrates genetic identity and indicates a single origin. Flow cytometric comparison of DNA contents of haemocytes and analysis of nuclear microsatellite loci confirm triploidy and suggest autopolyploidisation as its cause. Global DNA methylation is significantly reduced in marbled crayfish implying the involvement of molecular epigenetic mechanisms in its origination. Morphologically, both crayfish are very similar but growth and fecundity are considerably larger in marbled crayfish, making it a different animal with superior fitness. These data and the high probability of a divergent future evolution of the marbled crayfish and P. fallax clusters suggest that marbled crayfish should be considered as an independent asexual species. Our findings also establish the P. fallax–marbled crayfish pair as a novel paradigm for rare chromosomal speciation by autopolyploidy and parthenogenesis in animals and for saltational evolution in general. PMID:26519519

  13. Impact dynamics of liquid marbles

    NASA Astrophysics Data System (ADS)

    Marston, Jeremy; Supakar, Tinku

    2016-11-01

    The impact of particle coated droplets (a.k.a. liquid marbles or armored droplets) onto solid substrates is assessed experimentally with high-speed video. The impact is characterized by the maximum spread diameter, which conforms to scaling laws in terms of the impact Weber number, meaning that the marbles behave similar to water droplets during this stage. However, the motion of the particles across the surface allows us to observe both clustering and divergence of the particle shell and, in particular, we observe the formation of arrested shapes (i.e. jammed interfaces) after impact onto hydrophobic surfaces, from an initially spherical shape. In this case, we postulate that the speed of retraction and rate of change of surface coverage is a key ingredient leading to arrested shapes.

  14. Cannibalistic-morph Tiger Salamanders in unexpected ecological contexts

    USGS Publications Warehouse

    McLean, Kyle I.; Stockwell, Craig A.; Mushet, David M.

    2016-01-01

    Barred tiger salamanders [Ambystoma mavortium (Baird, 1850)] exhibit two trophic morphologies; a typical and a cannibalistic morph. Cannibalistic morphs, distinguished by enlarged vomerine teeth, wide heads, slender bodies, and cannibalistic tendencies, are often found where conspecifics occur at high density. During 2012 and 2013, 162 North Dakota wetlands and lakes were sampled for salamanders. Fifty-one contained A. mavortium populations; four of these contained cannibalistic morph individuals. Two populations with cannibalistic morphs occurred at sites with high abundances of conspecifics. However, the other two populations occurred at sites with unexpectedly low conspecific but high fathead minnow [Pimephales promelas (Rafinesque, 1820)] abundances. Further, no typical morphs were observed in either of these later two populations, contrasting with earlier research suggesting cannibalistic morphs only occur at low frequencies in salamander populations. Another anomaly of all four populations was the occurrence of cannibalistic morphs in permanent water sites, suggesting their presence was due to factors other than faster growth allowing them to occupy ephemeral habitats. Therefore, our findings suggest environmental factors inducing the cannibalistic morphism may be more complex than previously thought.

  15. Floating mechanism of a small liquid marble

    PubMed Central

    Ooi, Chin Hong; Plackowski, Chris; Nguyen, Anh V.; Vadivelu, Raja K.; John, James A. St.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-01-01

    Flotation of small solid objects and liquid droplets on water is critical to natural and industrial activities. This paper reports the floating mechanism of liquid marbles, or liquid droplets coated with hydrophobic microparticles. We used X-ray computed tomography (XCT) to acquire cross-sectional images of the floating liquid marble and interface between the different phases. We then analysed the shape of the liquid marble and the angles at the three-phase contact line (TPCL). We found that the small floating liquid marbles follow the mechanism governing the flotation of solid objects in terms of surface tension forces. However, the contact angles formed and deformation of the liquid marble resemble that of a sessile liquid droplet on a thin, elastic solid. For small liquid marbles, the contact angle varies with volume due to the deformability of the interface. PMID:26902930

  16. Biofouling of marbles by oxygenic photosynthetic microorganisms.

    PubMed

    Karaca, Zeki; Öztürk, Ayten; Çolak, Emel

    2015-08-01

    Phototrophic microorganisms disfigure the surfaces of different types of stone. Stone structure is damaged by the activity of photoautotrophic and other microorganisms. However, to date few, investigations have been undertaken into the relationship between microorganisms and the properties of different types of marble. In this study, biological activity of photoautotrophic microorganisms on three types of marble (Yatagan White, Giallo Anticato and Afyon White) was investigated under laboratory conditions over a short period of time. The three types of marble supported the growth of phototrophic microbial communities on their outer and inner layers, turning their original colour from white to a yellowish green colour. The porosity of the marble types facilitated filamentous microbial growth in the presence of water. Scanning electron microscope analysis revealed the accumulation of aggregates such as small spherical, fibrillar, calcified globular bodies on the inner surfaces of the marbles. This suggests that the microscopic characteristics of particular marble types may stimulate the growth of certain types of microorganisms.

  17. Raman and XRD characterization of Moroccan Marbles

    NASA Astrophysics Data System (ADS)

    Khrissi, S.; Haddad, M.; Bejjit, L.; Ait Lyazidi, S.; El Amraoui, M.; Falguères, C.

    2017-03-01

    Various marbles collected from Moroccan careers, and two white reference marbles originating from Carrare-Italy and Drama-Greece, have been studied by different analytical techniques. Chemical composition of rocks has been determined by X-Ray fluorescence. X-Ray diffraction and Raman spectroscopy allowed the identification of both major (calcite and dolomite) and minor (quartz) mineralogical components. Moreover, Raman spectroscopy has been used to identify the calcium carbonate phases and to examine the graphitic ones in the marbles.

  18. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander.

    PubMed

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M; Willard, Scott T; Kouba, Andrew J

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration.

  19. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander

    PubMed Central

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M.; Willard, Scott T.; Kouba, Andrew J.

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration. PMID:27258650

  20. Detection of Batrachochytrium dendrobatidis in endemic salamander species from central Texas.

    PubMed

    Gaertner, James P; Forstner, Michael R J; O'Donnell, Lisa; Hahn, Dittmar

    2009-03-01

    A nested PCR protocol was used to analyze five endemic salamander species from Central Texas for the presence of the emerging pathogen, chytrid fungus (Batrachochytrium dendrobatidis). Chytrid fungus was detected from samples of each of the five species sampled: with low abundance, in the Texas salamander (Eurycea neotenes) (1 positive out of 16 individuals tested; 1/16), the Blanco River Springs salamander (E. pterophila) (1/20), the threatened San Marcos salamander (E. nana) (1/17), and the endangered Barton Springs salamander (E. sosorum) (1/7); much higher abundance was obtained for the Jollyville Plateau salamander (E. tonkawae) (6/14), which has recently been petitioned for addition to the USA endangered species list. With one exception, sequences of PCR products were identical to the 5.8S rRNA gene, and nearly so for the flanking internal transcribed spacer (ITS) regions of B. dendrobatidis which confirmed the detection of chytrid fungus, and thus demonstrated the presence of this pathogen in populations of endangered species in Central Texas. These confirmations were obtained from nonconsumptive tail clippings which confirms the applicability of historically collected samples from other studies in the examination of the fungus across time.

  1. Liquid marble as microbioreactor for bioengineering applications

    NASA Astrophysics Data System (ADS)

    Sarvi, Fatemeh; Jain, Kanika; Alhasan, Layla; Arbatan, Tina; Shen, Wei; Chan, Peggy P. Y.

    2015-12-01

    This paper reports the use of liquid marbles (LMs) as miniature bioreactors to produce three-dimensional (3D) spheroids including tumor-like spheriods from cancer cells and embryoid bodies (EBs) from stem cells. A liquid marble microbioreactor is prepared by placing a drop of cell suspension onto a polytetrafluoroethylene (PTFE) particle bed. Without the addition of growth factors, suspended EBs from liquid marbles exhibit spontaneous contraction. These results indicate that the liquid marble provides a suitable microenvironment to induce EB formation and spontaneous cardiac differentiation. The EBs were further plated onto gelatin-coated tissue culture dishes. Plated EBs express mature cardiomyocyte marker cardiac troponinT (cTnT), indicating that these EBs have differentiated into functional cardiomyocytes. The cardiomyocytes generated using this liquid marble approach could be useful for transplantation.

  2. Climate change and shrinking salamanders: alternative mechanisms for changes in plethodontid salamander body size.

    PubMed

    Connette, Grant M; Crawford, John A; Peterman, William E

    2015-08-01

    An increasing number of studies have demonstrated relationships between climate trends and body size change of organisms. In many cases, climate might be expected to influence body size by altering thermoregulation, energetics or food availability. However, observed body size change can result from a variety of ecological processes (e.g. growth, selection, population dynamics) or imperfect observation of biological systems. We used two extensive datasets to evaluate alternative mechanisms for recently reported changes in the observed body size of plethodontid salamanders. We found that mean adult body size of salamanders can be highly sensitive to survey conditions, particularly rainfall. This systematic bias in the detection of larger or smaller individuals could result in a signature of body size change in relation to reported climate trends when it is simply observation error. We also identify considerable variability in body size distributions among years and find that individual growth rates can be strongly influenced by weather. Finally, our study demonstrates that measures of mean adult body size can be highly variable among surveys and that large sample sizes may be required to make reliable inferences. Identifying the effects of climate change is a critical area of research in ecology and conservation. Researchers should be aware that observed changes in certain organisms can result from multiple ecological processes or systematic bias due to nonrandom sampling of populations.

  3. Characterization of displaced bipolar cells in the tiger salamander retina.

    PubMed

    Maple, Bruce R; Zhang, Jian; Pang, Ji-Jie; Gao, Fan; Wu, Samuel M

    2005-03-01

    In immunocytochemical studies of the tiger salamander retina, 17% of neurons in the outer nuclear layer did not label for recoverin, a photoreceptor marker. Lucifer yellow injection showed a population of cells in the ONL to be displaced bipolar cells, with axon terminals that stratified exclusively in the OFF sublamina of the inner plexiform layer (IPL), and predominately within the cone-dominated region of the OFF sublamina. Glutamate generated a dendritic cationic conductance increase in all displaced bipolar cells tested, and typical cone-dominated bipolar cell light responses were observed among displaced cells that stratified in the central IPL. We conclude that displaced bipolar cells in the tiger salamander retina are entirely OFF-center cells, and predominately cone-dominated cells.

  4. From polymer latexes to multifunctional liquid marbles.

    PubMed

    Fernandes, Ana M; Mantione, Daniele; Gracia, Raquel; Leiza, Jose R; Paulis, Maria; Mecerreyes, David

    2015-02-25

    A simple method to prepare multifunctional liquid marbles and dry water with magnetic, color, and fluorescent properties is presented. Multifunctional liquid marbles were prepared by encapsulation of water droplets using flocculated polymer latexes. First, the emulsion polymerization reaction of polystyrene and poly(benzyl methacrylate) was carried out using cheap and commercially available cationic surfactants. Subsequently, flocculation of the latex was provoked by an anion-exchange reaction of the cationic surfactant by the addition of lithium bis(trifluoromethanesulfonyl)imide salt. The flocculated polymer latex was filtered and dried, leading to very hydrophobic micronanoparticulated powders. These powders showed a great ability to stabilize the air/water interface. Stable liquid marbles were obtained by rolling water droplets onto the hydrophobic powders previously prepared. The use of very small polystyrene nanoparticles led us to the preparation of very stable and the biggest known liquid marbles up to 2.5 mL of water. Furthermore, the introduction of fluorescent comonomer dyes into the polymer powders allowed us to obtain new morphological images and new knowledge about the structure of liquid marbles by confocal microscopy. Furthermore, the introduction of magnetic nanoparticles into the polymer latex led to magnetic responsive liquid marbles, where the iron oxide nanoparticles are protected within a polymer. Altogether this method represents an accessible and general platform for the preparation of multifunctional liquid marbles and dry water, which may contribute to extending of their actual range of applications.

  5. Susceptibility of the endangered California tiger salamander, Ambystoma californiense, to ranavirus infection.

    PubMed

    Picco, Angela M; Brunner, Jesse L; Collins, James P

    2007-04-01

    Emerging infectious diseases are implicated in the declines and extinctions of amphibians worldwide. Ranaviruses in the family Iridoviridae are a global concern and have caused amphibian die-offs in wild populations in North America, Europe, South America, and in commercial populations in Asia and South America. The movement of amphibians for bait, food, pets, and research provides a route for the introduction of ranaviruses into naive and potentially endangered species. In this report, we demonstrate that the California tiger salamander, Ambystoma californiense, is susceptible to Ambystoma tigrinum virus (ATV). This virus has not been previously reported in California tiger salamander, but observed mortality in experimentally infected animals suggests that California tiger salamander populations could be adversely affected by an ATV introduction.

  6. Hybrid vigor between native and introduced salamanders raises new challenges for conservation

    PubMed Central

    Fitzpatrick, Benjamin M.; Shaffer, H. Bradley

    2007-01-01

    Hybridization between differentiated lineages can have many different consequences depending on fitness variation among hybrid offspring. When introduced organisms hybridize with natives, the ensuing evolutionary dynamics may substantially complicate conservation decisions. Understanding the fitness consequences of hybridization is an important first step in predicting its evolutionary outcome and conservation impact. Here, we measured natural selection caused by differential viability of hybrid larvae in wild populations where native California Tiger Salamanders (Ambystoma californiense) and introduced Barred Tiger Salamanders (Ambystoma tigrinum mavortium) have been hybridizing for 50–60 years. We found strong evidence of hybrid vigor; mixed-ancestry genotypes had higher survival rates than genotypes containing mostly native or mostly introduced alleles. Hybrid vigor may be caused by heterozygote advantage (overdominance) or recombinant hybrid vigor (due to epistasis or complementation). These genetic mechanisms are not mutually exclusive, and we find statistical support for both overdominant and recombinant contributions to hybrid vigor in larval tiger salamanders. Because recombinant homozygous genotypes can breed true, a single highly fit genotype with a mosaic of native and introduced alleles may eventually replace the historically pure California Tiger Salamander (listed as Threatened under the U.S. Endangered Species Act). The management implications of this outcome are complex: Genetically pure populations may not persist into the future, but average fitness and population viability of admixed California Tiger Salamanders may be enhanced. The ecological consequences for other native species are unknown. PMID:17884982

  7. Hybrid vigor between native and introduced salamanders raises new challenges for conservation.

    PubMed

    Fitzpatrick, Benjamin M; Shaffer, H Bradley

    2007-10-02

    Hybridization between differentiated lineages can have many different consequences depending on fitness variation among hybrid offspring. When introduced organisms hybridize with natives, the ensuing evolutionary dynamics may substantially complicate conservation decisions. Understanding the fitness consequences of hybridization is an important first step in predicting its evolutionary outcome and conservation impact. Here, we measured natural selection caused by differential viability of hybrid larvae in wild populations where native California Tiger Salamanders (Ambystoma californiense) and introduced Barred Tiger Salamanders (Ambystoma tigrinum mavortium) have been hybridizing for 50-60 years. We found strong evidence of hybrid vigor; mixed-ancestry genotypes had higher survival rates than genotypes containing mostly native or mostly introduced alleles. Hybrid vigor may be caused by heterozygote advantage (overdominance) or recombinant hybrid vigor (due to epistasis or complementation). These genetic mechanisms are not mutually exclusive, and we find statistical support for both overdominant and recombinant contributions to hybrid vigor in larval tiger salamanders. Because recombinant homozygous genotypes can breed true, a single highly fit genotype with a mosaic of native and introduced alleles may eventually replace the historically pure California Tiger Salamander (listed as Threatened under the U.S. Endangered Species Act). The management implications of this outcome are complex: Genetically pure populations may not persist into the future, but average fitness and population viability of admixed California Tiger Salamanders may be enhanced. The ecological consequences for other native species are unknown.

  8. Earliest known crown-group salamanders.

    PubMed

    Gao, Ke-Qin; Shubin, Neil H

    2003-03-27

    Salamanders are a model system for studying the rates and patterns of the evolution of new anatomical structures. Recent discoveries of abundant Late Jurassic and Early Cretaceous salamanders are helping to address these issues. Here we report the discovery of well-preserved Middle Jurassic salamanders from China, which constitutes the earliest known record of crown-group urodeles (living salamanders and their closest relatives). The new specimens are from the volcanic deposits of the Jiulongshan Formation (Bathonian), Inner Mongolia, China, and represent basal members of the Cryptobranchidae, a family that includes the endangered Asian giant salamander (Andrias) and the North American hellbender (Cryptobranchus). These fossils document a Mesozoic record of the Cryptobranchidae, predating the previous record of the group by some 100 million years. This discovery provides evidence to support the hypothesis that the divergence of the Cryptobranchidae from the Hynobiidae had taken place in Asia before the Middle Jurassic period.

  9. Life history as a predictor of salamander recovery rate from timber harvest in southern appalachian forests, USA.

    PubMed

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Forest management often represents a balance between social, economic, and ecological objectives. In the eastern United States, numerous studies have established that terrestrial salamander populations initially decline in abundance following timber harvest, yet the large-scale and long-term consequences are relatively unknown. We used count data from terrestrial survey points to examine the relation between salamander abundance and historic timber harvest while accounting for imperfect detection of individuals. Overall, stream- and terrestrial-breeding salamanders appeared to differ by magnitude of population decline, rate of population recovery, and extent of recolonization from surrounding forest. Specifically, estimated abundance of both species groups was positively associated with stand age and recovery rates were predicted to increase over time for red-legged salamanders (Plethodon shermani) and decrease in stream-breeding species. Abundance of stream-breeding salamanders was predicted to reach a peak by 100 years after timber harvest, and the population growth rate of red-legged salamanders was predicted to undergo a significant increase 100 years after harvest. Estimated abundance of stream-breeding salamanders in young forest stands was also negatively associated with the distance to adjacent forest, a result that suggests immigration has a role in the recovery of these species. Our results indicate that salamander abundance in young forest stands may be only modestly lower than in more mature forest but that full recovery from timber harvest may take a substantial amount of time and that species life history may affect patterns of recovery. Historia de Vida como un Vaticinador de la Tasa de Recuperación de una Salamandra a la Colecta de Madera en los Bosques del Sur de los Apalaches, E.U.A.

  10. Phylogeography and genetic identification of the newly-discovered populations of torrent salamanders (Rhyacotriton cascade and R. variegatus) in the central Cascades (USA)

    USGS Publications Warehouse

    Wagner, R.S.; Miller, Mark P.; Haig, Susan M.

    2006-01-01

    Newly discovered populations of Rhyacotritonidae were investigated for taxonomic identity, hybridization, and sympatry. Species in the genus Rhyacotriton have been historically difficult to identify using morphological characters. Mitochondrial (mtDNA) 16S ribosomal RNA sequences (491 bp) and allozymes (6 loci) were used to identify the distribution of populations occurring intermediate between the previously described ranges of R. variegatus and R. cascadae in the central Cascade Mountain region of Oregon. Allozyme and mitochondrial sequence data both indicated the presence of two distinct evolutionary lineages, with each lineage corresponding to the allopatric distribution of R. cascadae and R. variegatus. Results suggest the Willamette River acts as a phylogeographic barrier limiting the distribution of both species, although we cannot exclude the possibility that reproductive isolation also exists that reinforces species' distributions. This study extends the previously described geographical ranges of both R. cascadae and R. variegatus and defines an eastern range limit for R. variegatus conservation efforts.

  11. Stream water temperature limits occupancy of salamanders in mid-Atlantic protected areas

    USGS Publications Warehouse

    Grant, Evan H. Campbell; Wiewel, Amber N. M.; Rice, Karen C.

    2014-01-01

    Stream ecosystems are particularly sensitive to urbanization, and tolerance of water-quality parameters is likely important to population persistence of stream salamanders. Forecasted climate and landscape changes may lead to significant changes in stream flow, chemical composition, and temperatures in coming decades. Protected areas where landscape alterations are minimized will therefore become increasingly important for salamander populations. We surveyed 29 streams at three national parks in the highly urbanized greater metropolitan area of Washington, DC. We investigated relationships among water-quality variables and occupancy of three species of stream salamanders (Desmognathus fuscus, Eurycea bislineata, and Pseudotriton ruber). With the use of a set of site-occupancy models, and accounting for imperfect detection, we found that stream-water temperature limits salamander occupancy. There was substantial uncertainty about the effects of the other water-quality variables, although both specific conductance (SC) and pH were included in competitive models. Our estimates of occupancy suggest that temperature, SC, and pH have some importance in structuring stream salamander distribution.

  12. Wildlife disease. Recent introduction of a chytrid fungus endangers Western Palearctic salamanders.

    PubMed

    Martel, A; Blooi, M; Adriaensen, C; Van Rooij, P; Beukema, W; Fisher, M C; Farrer, R A; Schmidt, B R; Tobler, U; Goka, K; Lips, K R; Muletz, C; Zamudio, K R; Bosch, J; Lötters, S; Wombwell, E; Garner, T W J; Cunningham, A A; Spitzen-van der Sluijs, A; Salvidio, S; Ducatelle, R; Nishikawa, K; Nguyen, T T; Kolby, J E; Van Bocxlaer, I; Bossuyt, F; Pasmans, F

    2014-10-31

    Emerging infectious diseases are reducing biodiversity on a global scale. Recently, the emergence of the chytrid fungus Batrachochytrium salamandrivorans resulted in rapid declines in populations of European fire salamanders. Here, we screened more than 5000 amphibians from across four continents and combined experimental assessment of pathogenicity with phylogenetic methods to estimate the threat that this infection poses to amphibian diversity. Results show that B. salamandrivorans is restricted to, but highly pathogenic for, salamanders and newts (Urodela). The pathogen likely originated and remained in coexistence with a clade of salamander hosts for millions of years in Asia. As a result of globalization and lack of biosecurity, it has recently been introduced into naïve European amphibian populations, where it is currently causing biodiversity loss.

  13. Marble Ageing Characterization by Acoustic Waves

    NASA Astrophysics Data System (ADS)

    Boudani, Mohamed El; Wilkie-Chancellier, Nicolas; Martinez, Loïc; Hébert, Ronan; Rolland, Olivier; Forst, Sébastien; Vergès-Belmin, Véronique; Serfaty, Stéphane

    In cultural heritage, statue marble characterization by acoustic waves is a well-known non-destructive method. Such investigations through the statues by time of flight method (TOF) point out sound speeds decrease with ageing. However for outdoor stored statues as the ones in the gardens of Chateau de Versailles, ageing affects mainly the surface of the Carrara marble. The present paper proposes an experimental study of the marble acoustic properties variations during accelerated laboratory ageing. The surface degradation of the marble is reproduced in laboratory for 29 mm thick marble samples by using heating/cooling thermal cycles on one face of a marble plate. Acoustic waves are generated by 1 MHz central frequency contact transducers excited by a voltage pulse placed on both sides of the plate. During the ageing and by using ad hoc transducers, the marble samples are characterized in transmission, along their volume by shear, compressional TOF measurements and along their surface by Rayleigh waves measurements. For Rayleigh waves, both TOF by transducers and laser vibrometry methods are used to detect the Rayleigh wave. The transmission measurements point out a deep decrease of the waves speeds in conjunction with a dramatic decrease of the maximum frequency transmitted. The marble acts as a low pass filter whose characteristic frequency cut decreases with ageing. This pattern occurs also for the Rayleigh wave surface measurements. The speed change in conjunction with the bandwidth translation is shown to be correlated to the material de-structuration during ageing. With a similar behavior but reversed in time, the same king of phenomena have been observed trough sol-gel materials during their structuration from liquid to solid state (Martinez, L. et all (2004). "Chirp-Z analysis for sol-gel transition monitoring". Ultrasonics, 42(1), 507-510.). A model is proposed to interpret the acoustical measurements

  14. Detection of an enigmatic plethodontid Salamander using Environmental DNA

    USGS Publications Warehouse

    Pierson, Todd W.; Mckee, Anna; Spear, Stephen F.; Maerz, John C.; Camp, Carlos D.; Glenn, Travis C.

    2016-01-01

    The isolation and identification of environmental DNA (eDNA) offers a non-invasive and efficient method for the detection of rare and secretive aquatic wildlife, and it is being widely integrated into inventory and monitoring efforts. The Patch-Nosed Salamander (Urspelerpes brucei) is a tiny, recently discovered species of plethodontid salamander known only from headwater streams in a small region of Georgia and South Carolina. Here, we present results of a quantitative PCR-based eDNA assay capable of detecting Urspelerpes in more than 75% of 33 samples from five confirmed streams. We deployed the method at 31 additional streams and located three previously undocumented populations of Urspelerpes. We compare the results of our eDNA assay with our attempt to use aquatic leaf litterbags for the rapid detection of Urspelerpes and demonstrate the relative efficacy of the eDNA assay. We suggest that eDNA offers great potential for use in detecting other aquatic and semi-aquatic plethodontid salamanders.

  15. Extreme morphological and ecological homoplasy in tropical salamanders

    PubMed Central

    Parra-Olea, Gabriela; Wake, David B.

    2001-01-01

    Fossorial salamanders typically have elongate and attenuated heads and bodies, diminutive limbs, hands and feet, and extremely elongate tails. Batrachoseps from California, Lineatriton from eastern México, and Oedipina from southern México to Ecuador, all members of the family Plethodontidae, tribe Bolitoglossini, resemble one another in external morphology, which has evolved independently. Whereas Oedipina and Batrachoseps are elongate because there are more trunk vertebrae, a widespread homoplasy (parallelism) in salamanders, the genus Lineatriton is unique in having evolved convergently by an alternate “giraffe-neck” developmental program. Lineatriton has the same number of trunk vertebrae as related, nonelongated taxa, but individual trunk vertebrae are elongated. A robust phylogenetic hypothesis, based on sequences of three mtDNA genes, finds Lineatriton to be deeply nested within a clade characterized by generalized ecology and morphology. Lineatriton lineolus, the only currently recognized taxon in the genus, shows unanticipated genetic diversity. Surprisingly, geographically separated populations of L. lineolus are not monophyletic, but are sister taxa of different species of the morphologically generalized genus Pseudoeurycea. Lineatriton, long thought to be a unique monospecific lineage, is polyphyletic. Accordingly, the specialized morphology of Lineatriton displays homoplasy at two hierarchical levels: (i) with respect to other elongate lineages in the family (convergence), and (ii) within what is currently recognized as a single taxon (parallelism). These evolutionary events are of adaptive significance because to invade the lowland tropics salamanders must be either arboreal or fossorial; the repeated evolution of elongation and attenuation has led to multiple lowland invasions. PMID:11427707

  16. Photoresponsive liquid marbles and dry water.

    PubMed

    Tan, Tristan Tsai Yuan; Ahsan, Aniq; Reithofer, Michael R; Tay, Siok Wei; Tan, Sze Yu; Hor, Tzi Sum Andy; Chin, Jia Min; Chew, Benny Kia Jia; Wang, Xiaobai

    2014-04-01

    Stimuli-responsive liquid marbles for controlled release typically rely on organic moieties that require lengthy syntheses. We report herein a facile, one-step synthesis of hydrophobic and oleophobic TiO2 nanoparticles that display photoresponsive wettability. Water liquid marbles stabilized by these photoresponsive TiO2 particles were found to be stable when shielded from ultraviolet (UV) radiation; however, they quickly collapsed after being irradiated with 302 nm UV light. Oil- and organic-solvent-based liquid marbles could also be fabricated using oleophobic TiO2 nanoparticles and show similar UV-induced collapse. Finally, we demonstrated the formation of the micronized form of water liquid marbles, also known as dry water, by homogenization of the TiO2 nanoparticles with water. The TiO2 dry water displayed a similar photoresponse, whereby the micronized liquid marbles collapsed after irradiation and the dry water turned from a free-flowing powder to a paste. Hence, by exploiting the photoresponsive wettability of TiO2, we fabricated liquid marbles and dry water that display photoresponse and studied the conditions required for their collapse.

  17. Evaporation rate of PTFE liquid marbles

    NASA Astrophysics Data System (ADS)

    Tosun, A.; Erbil, H. Y.

    2009-12-01

    Liquid marbles are hydrophilic liquid drops encapsulated with a hydrophobic powder. They behave as micro-reservoirs of liquids able to move rapidly without any leakage and are promising candidates to be applied in genetic analysis where 2D microfluidics and lab-on-a-chip methods are used. The manipulation of liquid marbles using gravitational, electrostatic and magnetic fields were recently investigated. In this work, we determined the evaporation rates of PTFE marbles formed by encapsulating PTFE micropowder on a water droplet in a closed chamber where relative humidity and temperature was kept constant. Evaporation rates of PTFE marbles were compared with the rates of pure water droplets in terms of evaporation resistance, ϕ parameter and it was found that PTFE marbles have longer life-time than water droplets so that ϕ values were found to increase regularly from 0.365 to 0.627 with the increase of RH of the evaporating medium. The barrier effect of PTFE microparticles at the water-air interface was more effective when water was evaporating slowly. PTFE water marbles have life-time of 26-60 min to retain their spherical shape under normal atmospheric conditions which is suitable for many promising applications in microfluidics, genetic analysis, electromagnetic actuators and valves.

  18. Impacts of a gape limited Brook Trout, Salvelinus fontinalis, on larval Northwestern salamander, Ambystoma gracile, growth: A field enclosure experiment

    USGS Publications Warehouse

    Currens, C.R.; Liss, W.J.; Hoffman, R.L.

    2007-01-01

    The formation of amphibian population structure is directly affected by predation. Although aquatic predators have been shown to have direct negative effects on larval salamanders in laboratory and field experiments, the potential impacts of gape-limited fish on larval salamander growth has been largely underexplored. We designed an enclosure experiment conducted in situ to quantify the effects of gape-limited Brook Trout (Salvelinus fontinalis) on larval Northwestern Salamander (Ambystoma gracile) growth. We specifically tested whether the presence of fish too small to consume larvae had a negative effect on larval growth. The results of this study indicate that the presence of a gape-limited S. fontinalis can have a negative effect on growth of larval A. gracile salamanders. Copyright 2007 Society for the Study of Amphibians and Reptiles.

  19. Water rolling and floating upon water: marbles supported by a water/marble interface.

    PubMed

    Bormashenko, Edward; Bormashenko, Yelena; Musin, Albina

    2009-05-01

    Floating of liquid marbles on a water/air interface was studied. The critical density allowing floating marbles containing NaCl solution was established experimentally and compared with its calculated value. A satisfactory agreement between experimental and theoretical values of the critical density is reported.

  20. At random meetings to the creation of new species of Salamander

    NASA Astrophysics Data System (ADS)

    Brillant, Marie-Pierre

    2013-04-01

    The pupils in final year of high school (15-18 years old) study the notion "species" and the creation of new species in various ways. Having studied genetic admixtures, this activity allows the pupils to build a scenario explaining the creation of a new species of Salamander in southern California from an ancestral population existing in northern Oregon. They can observe, on Google Earth, various populations of Salamander of the genus Ensatina. Salamanders of the genus Ensatina live in California around the Joaquin and Sacramento dry valleys. In this software, the pupils get information about the salamanders' environment and photographs of individuals and environments. During a migratory movement toward new territories to be colonized, these salamanders meet an inhospitable environment that they can not occupy. This population then splits up into two migratory branches, east and west, each overcoming the obstacles in different ways. The two groups gradually colonized southern territories but they avoided the too dry and hot San Joaquin plains. The two main branches of the original population gradually move away from each other, and genetic exchanges between them decrease over time. Eventually, we can find various populations of Salamander on both sides of the valleys, since the salamanders occupied new territories and diversified along the way. Among mutations that randomly occur, only those mutations that are best adapted in the origin were conserved in the genetic heritage of every population. When the individuals stemming from different western populations met, they were interfertile and give fertile hybrids, which was verified in the laboratory. Likewise, when individuals of the different eastern subspecies met accidentally, fertile hybrids also could arise from these crossings. The pupils can observe what happens in the overlap of various populations : interfertility or not. They also have geological, geographical and climatic information about the San Joaquin

  1. Iteroparity in the variable environment of the salamander Ambystoma tigrinum

    USGS Publications Warehouse

    Church, D.R.; Bailey, L.L.; Wilbur, H.M.; Kendall, W.L.; Hines, J.E.

    2007-01-01

    Simultaneous estimation of survival, reproduction, and movement is essential to understanding how species maximize lifetime reproduction in environments that vary across space and time. We conducted a four-year, capture–recapture study of three populations of eastern tiger salamanders (Ambystoma tigrinum tigrinum) and used multistate mark–recapture statistical methods to estimate the manner in which movement, survival, and breeding probabilities vary under different environmental conditions across years and among populations and habitats. We inferred how individuals may mitigate risks of mortality and reproductive failure by deferring breeding or by moving among populations. Movement probabilities among populations were extremely low despite high spatiotemporal variation in reproductive success and survival, suggesting possible costs to movements among breeding ponds. Breeding probabilities varied between wet and dry years and according to whether or not breeding was attempted in the previous year. Estimates of survival in the nonbreeding, forest habitat varied among populations but were consistent across time. Survival in breeding ponds was generally high in years with average or high precipitation, except for males in an especially ephemeral pond. A drought year incurred severe survival costs in all ponds to animals that attempted breeding. Female salamanders appear to defer these episodic survival costs of breeding by choosing not to breed in years when the risk of adult mortality is high. Using stochastic simulations of survival and breeding under historical climate conditions, we found that an interaction between breeding probabilities and mortality limits the probability of multiple breeding attempts differently between the sexes and among populations.

  2. Iteroparity in the variable environment of the salamander Ambystoma tigrinum.

    PubMed

    Church, Don R; Bailey, Larissa L; Wilbur, Henry M; Kendall, William L; Hines, James E

    2007-04-01

    Simultaneous estimation of survival, reproduction, and movement is essential to understanding how species maximize lifetime reproduction in environments that vary across space and time. We conducted a four-year, capture-recapture study of three populations of eastern tiger salamanders (Ambystoma tigrinum tigrinum) and used multistate mark-recapture statistical methods to estimate the manner in which movement, survival, and breeding probabilities vary under different environmental conditions across years and among populations and habitats. We inferred how individuals may mitigate risks of mortality and reproductive failure by deferring breeding or by moving among populations. Movement probabilities among populations were extremely low despite high spatiotemporal variation in reproductive success and survival, suggesting possible costs to movements among breeding ponds. Breeding probabilities varied between wet and dry years and according to whether or not breeding was attempted in the previous year. Estimates of survival in the nonbreeding, forest habitat varied among populations but were consistent across time. Survival in breeding ponds was generally high in years with average or high precipitation, except for males in an especially ephemeral pond. A drought year incurred severe survival costs in all ponds to animals that attempted breeding. Female salamanders appear to defer these episodic survival costs of breeding by choosing not to breed in years when the risk of adult mortality is high. Using stochastic simulations of survival and breeding under historical climate conditions, we found that an interaction between breeding probabilities and mortality limits the probability of multiple breeding attempts differently between the sexes and among populations.

  3. Larval long-toed salamanders incur nonconsumptive effects in the presence of nonnative trout

    USGS Publications Warehouse

    Kenison, Erin K.; Litt, Andrea R.; Pilliod, David; McMahon, Thomas E.

    2016-01-01

    Predators can influence prey directly through consumption or indirectly through nonconsumptive effects (NCEs) by altering prey behavior, morphology, and life history. We investigated whether predator-avoidance behaviors by larval long-toed salamanders (Ambystoma macrodactylum) in lakes with nonnative trout result in NCEs on morphology and development. Field studies in lakes with and without trout were corroborated by experimental enclosures, where prey were exposed only to visual and chemical cues of predators. We found that salamanders in lakes with trout were consistently smaller than in lakes without trout: 38% lower weight, 24% shorter body length, and 29% shorter tail length. Similarly, salamanders in protective enclosures grew 2.9 times slower when exposed to visual and olfactory trout cues than when no trout cues were present. Salamanders in trout-free lakes and enclosures were 22.7 times and 1.48 times, respectively, more likely to metamorphose during the summer season than those exposed to trout in lakes and/or their cues. Observed changes in larval growth rate and development likely resulted from a facultative response to predator-avoidance behavior and demonstrate NCEs occurred even when predation risk was only perceived. Reduced body size and growth, as well as delayed metamorphosis, could have ecological consequences for salamander populations existing with fish if those effects carry-over into lower recruitment, survival, and fecundity.

  4. Estimating superpopulation size and annual probability of breeding for pond-breeding salamanders

    USGS Publications Warehouse

    Kinkead, K.E.; Otis, D.L.

    2007-01-01

    It has long been accepted that amphibians can skip breeding in any given year, and environmental conditions act as a cue for breeding. In this paper, we quantify temporary emigration or nonbreeding probability for mole and spotted salamanders (Ambystoma talpoideum and A. maculatum). We estimated that 70% of mole salamanders may skip breeding during an average rainfall year and 90% may skip during a drought year. Spotted salamanders may be more likely to breed, with only 17% avoiding the breeding pond during an average rainfall year. We illustrate how superpopulations can be estimated using temporary emigration probability estimates. The superpopulation is the total number of salamanders associated with a given breeding pond. Although most salamanders stay within a certain distance of a breeding pond for the majority of their life spans, it is difficult to determine true overall population sizes for a given site if animals are only captured during a brief time frame each year with some animals unavailable for capture at any time during a given year. ?? 2007 by The Herpetologists' League, Inc.

  5. Molecular characterization of major histocompatibility complex class II alleles in wild tiger salamanders (Ambystoma tigrinum).

    PubMed

    Bos, David H; DeWoody, J Andrew

    2005-11-01

    Major histocompatibility complex (MHC) class II genes are usually among the most polymorphic in vertebrate genomes because of their critical role (antigen presentation) in immune response. Prior to this study, the MHC was poorly characterized in tiger salamanders (Ambystoma tigrinum), but the congeneric axolotl (Ambystoma mexicanum) is thought to have an unusual MHC. Most notably, axolotl class II genes lack allelic variation and possess a splice variant without a full peptide binding region (PBR). The axolotl is considered immunodeficient, but it is unclear how or to what extent MHC genetics and immunodeficiency are interrelated. To study the evolution of MHC genes in urodele amphibians, we describe for the first time an expressed polymorphic class II gene in wild tiger salamanders. We sequenced the PBR of a class II gene from wild A. tigrinum (n=33) and identified nine distinct alleles. Observed heterozygosity was 73%, and there were a total of 46 polymorphic sites, most of which correspond to amino acid positions that bind peptides. Patterns of nucleotide substitutions exhibit the signature of diversifying selection, but no recombination was detected. Not surprisingly, trans-species evolution of tiger salamander and axolotl class II alleles was apparent. We have no direct data on the immunodeficiency of tiger salamanders, but the levels of polymorphism in our study population should suffice to bind a variety of foreign peptides (unlike axolotls). Our tiger salamander data suggest that the monomorphism and immunodeficiencies associated with axolotl class II genes is a relic of their unique historical demography, not their phylogenetic legacy.

  6. A case for using Plethodontid salamanders for monitoring biodiversity and ecosystem integrity of North American forests

    USGS Publications Warehouse

    Welsh, H.H.; Droege, S.

    2001-01-01

    Terrestrial salamanders of the family P!ethodontidae have unique attributes that make them excellent indicators of biodiversity and ecosystem integrity in forested habitats. Their longevity, small territory size, site fidelity, sensitivity to natural and anthropogenic perturbations, tendency to occur in high densities, and low sampling costs mean that counts of plethodontid salamanders provide numerous advantages over counts of other North American forest organisms for indicating environmental change. Furthermore, they are tightly linked physiologically to microclimatic and successional processes that influence the distribution and abundance of numerous other hydrophilic but difficult-to-study forest-dwelling plants and animals. Ecosystem processes such as moisture cycling, food-web dynamics, and succession, with their related structural and microclimatic variability, all affect forest biodiversity and have been shown to affect salamander populations as well. We determined the variability associated with sampling for plethodontid salamanders by estimating the coefficient of variation (CV) from available time-series data. The median coefficient of variation indicated that variation in counts of individuals among studies was much lower in plethodonticis (27%) than in lepidoptera (93%), passerine birds (57%), small mammals (69%), or other amphibians (37-46%), which means plethodontid salamanders provide an important statistical advantage over other species for monitoring long-term forest health.

  7. Carrara Marble: a nomination for Global Heritage Stone Resource

    NASA Astrophysics Data System (ADS)

    primavori, piero

    2014-05-01

    In the collective memory, in ordinary people, or in any technical office not devoted expressly to stone, marble is automatically associated with the word Carrara (Italy). Indisputably, for decades and decades, there has been this word association: marble means Carrara and Carrara means marble. In few other commodity sectors is a word so automatically associated with a name, engendering an identification process that, despite the inexorable onslaught of globalization, continues to exist. Carrara Marble, probably one of the most famous dimension stone in the world, has been recently designated as a suitable "Global Heritage Stone Resource". The additional designation of "Global Ornamental Stone" has also been proposed. Quarried since pre-Roman times, this marble is the testimonial of an area/industry that was able - for a variety of reasons not easily repeatable in future stone history - from the dawn of the stone sector to trigger a flywheel-effect on a global scale. The term Carrara Marble, geographically referable to the marbles extracted in the sorroundings of Carrara town, is in reality a general one, erroneously used since long time to define a multitude of different marbles (more than two hundred commercial varieties) extracted in the whole Apuane Alps region, Nortwestern Tuscany, Italy. The district of Carrara Marble is part of a wider territory where five important extractive areas can be recognized: Lunigiana, Garfagnana, Versilia, Massa and the Carrara area sensu stricto. This region is approximately 30 km long and 12 km wide, with marble outcrops, useful for commercial purposes, covering over 75 km2. The Carrara Marble is currently excavated in more than 100 quarries, at a rate of about 1.500.000 tons per year, is processed almost everywhere, and sold all over the world. The most important commercial designations are the following: 1) "Marmo Bianco"/"Marmo Ordinario" (Carrara White marble/Ordinary marble); 2) "Marmo Venato" (Veined marble); 3) "Marmo

  8. Electrical discharges in Chinese salamander Andrias davidianus.

    PubMed

    Olshanskii, V M; Baron, V D; Wei, Xue

    2016-11-01

    In 2-year-old Chinese giant salamanders Andrias davidianus, occasional electric discharges with a characteristic pattern similar to the electric discharges of weakly electric catfish, Polypterus and Protopterus, were recorded for the first time. The discharges markedly differ in shape from the myograms accompanying abrupt movements of the salamander or exceeded them in amplitude by more than an order of magnitude. The discharges were recorded both in the autonomous experiment in the absence of experimenters and at a weak tactile stimulation.

  9. Conservation assessment for the Siskiyou Mountains salamander and Scott Bar salamander in northern California.

    SciTech Connect

    Vinikour, W. S.; LaGory, K. E.; Adduci, J. J.; Environmental Science Division

    2006-10-20

    The purpose of this conservation assessment is to summarize existing knowledge regarding the biology and ecology of the Siskiyou Mountains salamander and Scott Bar salamander, identify threats to the two species, and identify conservation considerations to aid federal management for persistence of the species. The conservation assessment will serve as the basis for a conservation strategy for the species.

  10. Evaporation of Ethanol-Water Binary Mixture Sessile Liquid Marbles.

    PubMed

    Ooi, Chin Hong; Bormashenko, Edward; Nguyen, Anh V; Evans, Geoffrey M; Dao, Dzung V; Nguyen, Nam-Trung

    2016-06-21

    Liquid marble is a liquid droplet coated with particles. Recently, the evaporation process of a sessile liquid marble using geometric measurements has attracted great attention from the research community. However, the lack of gravimetric measurement limits further insights into the physical changes of a liquid marble during the evaporation process. Moreover, the evaporation process of a marble containing a liquid binary mixture has not been reported before. The present paper investigates the effective density and the effective surface tension of an evaporating liquid marble that contains aqueous ethanol at relatively low concentrations. The effective density of an evaporating liquid marble is determined from the concurrent measurement of instantaneous mass and volume. Density measurements combined with surface profile fitting provide the effective surface tension of the marble. We found that the density and surface tension of an evaporating marble are significantly affected by the particle coating.

  11. Environmental acidification is not associated with altered plasma corticosterone levels in the stream-side salamander, Desmognathus ochrophaeus.

    PubMed

    Woodley, Sarah K; Freeman, Peter; Ricciardella, Lauren F

    2014-05-15

    As environments become increasingly altered due to anthropogenic factors, interest is growing in how endocrine systems respond to pollution and environmental degradation. Glucocorticoid hormones (GCs) are a type of stress hormones that are released upon activation of the hypothalamic-pituitary-adrenal axis and have widespread effects throughout the body. We tested the hypothesis that exposure to environmental acidification is associated with altered levels of plasma GCs in adult, stream-side Allegheny Mountain dusky salamanders (Desmognathus ochrophaeus). We compared plasma corticosterone (CORT) in salamanders living in 9 streams that differed in pH. Although capture and handling induced a robust increase in plasma CORT in all populations of salamanders, we discerned no significant effect of environmental pH on baseline CORT or handling-induced CORT levels. In a laboratory study, low pH decreased salamander locomotory activity compared to acid-neutral controls, but there was no effect of pH on plasma CORT. Decreased locomotory activity is a common amphibian response to stress, indicating that low pH has adverse effects on Allegheny Mountain dusky salamanders. Overall, we conclude that the effects of environmental pH on salamander behavior and other potential responses are not mediated by changes in plasma CORT levels. We discuss alternative explanations for our results and describe difficulties involved in searching for relationships between plasma GCs and environmental degradation.

  12. Mineralogical characterization of the Shelburne marble and the Salem limestone

    SciTech Connect

    McGee, E.S.

    1989-01-01

    Samples of Shelburne marble and Salem limestone were selected to represent marbles and limestones used in buildings and monuments. The Royal variety of Shelburne marble is a white marble predominantly composed of calcite but has heterogeneously distributed gray inclusions. The select buff Salem limestone is a beige, homogeneous, fossiliferous limestone, predominantly composed of fragments of echinoderms and bryozoans. The author reports that both samples are appropriate test stones for the National Acid Precipitation Assessment Program stone exposure studies.

  13. ARE SALAMANDERS USEFUL INDICATORS OF HYDROLOGIC PERMANENCE IN HEADWATER STREAMS?

    EPA Science Inventory

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collect...

  14. Persistence and extirpation in invaded landscapes: patch characteristics and connectivity determine effects of non-native predatory fish on native salamanders

    USGS Publications Warehouse

    Pilliod, David S.; Arkle, Robert S.; Maxell, Bryce A.

    2012-01-01

    Studies have demonstrated negative effects of non-native, predatory fishes on native amphibians, yet it is still unclear why some amphibian populations persist, while others are extirpated, following fish invasion. We examined this question by developing habitat-based occupancy models for the long-toed salamander (Ambystoma macrodactylum) and nonnative fish using survey data from 1,749 water bodies across 470 catchments in the Northern Rocky Mountains, USA. We first modeled the habitat associations of salamanders at 468 fishless water bodies in 154 catchments where non-native fish were historically, and are currently, absent from the entire catchment. Wethen applied this habitat model to the complete data set to predict the probability of salamander occupancy in each water body, removing any effect of fish presence. Finally, we compared field-observed occurrences of salamanders and fish to modeled probability of salamander occupancy. Suitability models indicated that fish and salamanders had similar habitat preferences, possibly resulting in extirpations of salamander populations from entire catchments where suitable habitats were limiting. Salamanders coexisted with non-native fish in some catchments by using marginal quality, isolated (no inlet or outlet) habitats that remained fishless. They rarely coexisted with fish within individual water bodies and only where habitat quality was highest. Connectivity of water bodies via streams resulted in increased probability of fish invasion and consequently reduced probability of salamander occupancy.These results could be used to identify and prioritize catchments and water bodies where control measures would be most effective at restoring amphibian populations. Our approach could be useful as a framework for improved investigations into questions of persistence and extirpation of native species when non-native species have already become established.

  15. Marble Bone Disease: A Rare Bone Disorder

    PubMed Central

    Harinathbabu, Maheswari; Thillaigovindan, Ranjani; Prabhu, Geetha

    2015-01-01

    Osteopetrosis, or marble bone disease, is a rare skeletal disorder due to a defective function of the osteoclasts. This defect renders bones more susceptible to osteomyelitis due to decreased vascularity. This disorder is inherited as autosomal dominant and autosomal recessive. Healthcare professionals should urge these patients to maintain their oral health as well as general health, as this condition makes these patients more susceptible to frequent infections and fractures. This case report emphasizes the signs and symptoms of marble bone disease and presents clinical and radiographic findings.  PMID:26594603

  16. Coexistence in streams: Do source-sink dynamics allow salamanders to persist with fish predators?

    USGS Publications Warehouse

    Sepulveda, A.J.; Lowe, W.H.

    2011-01-01

    Theory suggests that source-sink dynamics can allow coexistence of intraguild predators and prey, but empirical evidence for this coexistence mechanism is limited. We used capture-mark-recapture, genetic methods, and stable isotopes to test whether source-sink dynamics promote coexistence between stream fishes, the intraguild predator, and stream salamanders (Dicamptodon aterrimus), the intraguild prey. Salamander populations from upstream reaches without fish were predicted to maintain or supplement sink populations in downstream reaches with fish. We found instead that downstream reaches with fish were not sinks even though fish consumed salamander larvae-apparent survival, recruitment, and population growth rate did not differ between upstream and downstream reaches. There was also no difference between upstream and downstream reaches in net emigration. We did find that D. aterrimus moved frequently along streams, but believe that this is a response to seasonal habitat changes rather than intraguild predation. Our study provides empirical evidence that local-scale mechanisms are more important than dispersal dynamics to coexistence of streams salamanders and fish. More broadly, it shows the value of empirical data on dispersal and gene flow for distinguishing between local and spatial mechanisms of coexistence. ?? 2011 Springer-Verlag.

  17. Coexistence in streams: do source-sink dynamics allow salamanders to persist with fish predators?

    PubMed

    Sepulveda, Adam J; Lowe, Winsor H

    2011-08-01

    Theory suggests that source-sink dynamics can allow coexistence of intraguild predators and prey, but empirical evidence for this coexistence mechanism is limited. We used capture-mark-recapture, genetic methods, and stable isotopes to test whether source-sink dynamics promote coexistence between stream fishes, the intraguild predator, and stream salamanders (Dicamptodon aterrimus), the intraguild prey. Salamander populations from upstream reaches without fish were predicted to maintain or supplement sink populations in downstream reaches with fish. We found instead that downstream reaches with fish were not sinks even though fish consumed salamander larvae-apparent survival, recruitment, and population growth rate did not differ between upstream and downstream reaches. There was also no difference between upstream and downstream reaches in net emigration. We did find that D. aterrimus moved frequently along streams, but believe that this is a response to seasonal habitat changes rather than intraguild predation. Our study provides empirical evidence that local-scale mechanisms are more important than dispersal dynamics to coexistence of streams salamanders and fish. More broadly, it shows the value of empirical data on dispersal and gene flow for distinguishing between local and spatial mechanisms of coexistence.

  18. Colorado Yule Marble; building stone of the Lincoln Memorial

    USGS Publications Warehouse

    McGee, Elaine S.

    1999-01-01

    The Colorado Yule marble, quarried in Marble, Colo., is a very pure white marble, and it has been widely acclaimed for its quality and purity. This marble has been used for many prominent buildings; one of the most notable is the Lincoln Memorial in Washington, D.C., built nearly 80 years ago. Although most of the marble in the memorial appears to be in very good condition, some of the stones have developed pronounced surficial roughness and show a significant loss of carved details and rounded edges compared with adjacent stones. Because adjacent blocks of marble receive nearly identical exposure to weathering agents that cause deterioration of the marble, it seems very likely that this pronounced difference in durability of adjacent stones arises from some inherent characteristic of the marble. The Colorado Yule marble is a nearly pure calcite marble with minor inclusions of mica, quartz, and feldspar. Compositions of the calcite and the inclusion phases in the marble are typical for those phases. The calcite grains that compose the marble are irregularly shaped and range from 100 to 600 micrometers in diameter. The texture of the marble is even, with a slight preferred directional elongation that is visible when the marble is cut in certain directions. Physical tests of the marble show that its strength is comparable to that of other marbles typically used in buildings. Variations in the durability of the marble, like those seen at the Lincoln Memorial, are not related to variations in calcite composition or to the presence of inclusions in the marble. Most likely, the variations arise from differences in the calcite grain boundaries and the degree to which the grains interlock with one another. Weak grain boundaries that permit water or solutions to penetrate into the marble and dissolve the calcite grains at their edges cause the marble to disaggregate or ?sugar.? Subtle differences in texture that occur in the marble from various parts of the quarry probably

  19. LTR retrotransposons contribute to genomic gigantism in plethodontid salamanders.

    PubMed

    Sun, Cheng; Shepard, Donald B; Chong, Rebecca A; López Arriaza, José; Hall, Kathryn; Castoe, Todd A; Feschotte, Cédric; Pollock, David D; Mueller, Rachel Lockridge

    2012-01-01

    Among vertebrates, most of the largest genomes are found within the salamanders, a clade of amphibians that includes 613 species. Salamander genome sizes range from ~14 to ~120 Gb. Because genome size is correlated with nucleus and cell sizes, as well as other traits, morphological evolution in salamanders has been profoundly affected by genomic gigantism. However, the molecular mechanisms driving genomic expansion in this clade remain largely unknown. Here, we present the first comparative analysis of transposable element (TE) content in salamanders. Using high-throughput sequencing, we generated genomic shotgun data for six species from the Plethodontidae, the largest family of salamanders. We then developed a pipeline to mine TE sequences from shotgun data in taxa with limited genomic resources, such as salamanders. Our summaries of overall TE abundance and diversity for each species demonstrate that TEs make up a substantial portion of salamander genomes, and that all of the major known types of TEs are represented in salamanders. The most abundant TE superfamilies found in the genomes of our six focal species are similar, despite substantial variation in genome size. However, our results demonstrate a major difference between salamanders and other vertebrates: salamander genomes contain much larger amounts of long terminal repeat (LTR) retrotransposons, primarily Ty3/gypsy elements. Thus, the extreme increase in genome size that occurred in salamanders was likely accompanied by a shift in TE landscape. These results suggest that increased proliferation of LTR retrotransposons was a major molecular mechanism contributing to genomic expansion in salamanders.

  20. Lead poisoning of a marbled godwit

    USGS Publications Warehouse

    Locke, L.N.; Smith, M.R.; Windingstad, R.M.; Martin, S.J.

    1991-01-01

    A thin adult female marbled godwit (Limosa fedoa) found dead at Benton Lake National Wildlife Refuge, Montana, was found to have 17 ingested lead shot in its gizzard. Its liver contained 51.7 ppm lead (wet weight). Based on these necropsy findings a diagnosis of lead poisoning was made.

  1. An Environmental Handbook of the Marble Area.

    ERIC Educational Resources Information Center

    Campbell, Dan

    The Elk Range located in the very center of the Colorado Rocky Mountains is described in this guide to the Maroon Bells-Snowmass Wilderness Area. Near the ghost town of Marble, Colorado, this wilderness area is described as 66,000 acres 150 miles outside Denver encompassing 25% of all established wilderness in Colorado, 130 miles of marked trails,…

  2. Marbles, Anyone? Traditional Games in the Classroom.

    ERIC Educational Resources Information Center

    Casbergue, Renee M.; Kieff, Judith

    1998-01-01

    Children now play more solitary games, perhaps missing benefits of traditional games such as jacks, marbles, and dominoes. Such games offer children of all backgrounds the opportunity to consolidate knowledge and skills, develop a more orderly way of thinking, and establish themselves with peers. By making these games available in classrooms,…

  3. Data Collection and the Marble Company.

    ERIC Educational Resources Information Center

    Harper, Nancy L.

    A study investigated how managers in various kinds of organizations make decisions and also examined ways that using the Marble Company simulation (developed by L. C. Lederman and L. P. Stewart in 1985) could enhance, clarify, and extend its findings. Managers were asked to write down what they would say to their subordinates in order to elicit…

  4. Phylogeny and genetic history of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870) inferred from complete mitochondrial genomes.

    PubMed

    Malyarchuk, Boris; Derenko, Miroslava; Denisova, Galina

    2013-05-01

    We assessed phylogeny of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870), the most northern ectothermic, terrestrial vertebrate in Eurasia, by sequence analysis of complete mitochondrial genomes in 26 specimens from different localities (China, Khabarovsk region, Sakhalin, Yakutia, Magadan region, Chukotka, Kamchatka, Ural, European part of Russia). In addition, a complete mitochondrial genome of the Schrenck salamander, Salamandrella schrenckii, was determined for the first time. Bayesian phylogenetic analysis of the entire mtDNA genomes of S. keyserlingii demonstrates that two haplotype clades, AB and C, radiated about 1.4 million years ago (Mya). Bayesian skyline plots of population size change through time show an expansion around 250 thousand years ago (kya) and then a decline around the Last Glacial Maximum (25 kya) with subsequent restoration of population size. Climatic changes during the Quaternary period have dramatically affected the population genetic structure of the Siberian salamanders. In addition, complete mtDNA sequence analysis allowed us to recognize that the vast area of Northern Eurasia was colonized only by the Siberian salamander clade C1b during the last 150 kya. Meanwhile, we were unable to find evidence of molecular adaptation in this clade by analyzing the whole mitochondrial genomes of the Siberian salamanders.

  5. Stream salamander species richness and abundance in relation to environmental factors in Shenandoah National Park, Virginia

    USGS Publications Warehouse

    Campbell Grant, Evan H.; Jung, Robin E.; Rice, Karen C.

    2005-01-01

    Stream salamanders are sensitive to acid mine drainage and may be sensitive to acidification and low acid neutralizing capacity (ANC) of a watershed. Streams in Shenandoah National Park, Virginia, are subject to episodic acidification from precipitation events. We surveyed 25 m by 2 m transects located on the stream bank adjacent to the water channel in Shenandoah National Park for salamanders using a stratified random sampling design based on elevation, aspect and bedrock geology. We investigated the relationships of four species (Eurycea bislineata, Desmognathus fuscus, D. monticola and Gyrinophilus porphyriticus) to habitat and water quality variables. We did not find overwhelming evidence that stream salamanders are affected by the acid-base status of streams in Shenandoah National Park. Desmognathus fuscus and D. monticola abundance was greater both in streams that had a higher potential to neutralize acidification, and in higher elevation (>700 m) streams. Neither abundance of E. bislineata nor species richness were related to any of the habitat variables. Our sampling method preferentially detected the adult age class of the study species and did not allow us to estimate population sizes. We suggest that continued monitoring of stream salamander populations in SNP will determine the effects of stream acidification on these taxa.

  6. The amphibian chytrid fungus, Batrachochytrium dendrobatidis, in fully aquatic salamanders from Southeastern North America.

    PubMed

    Chatfield, Matthew W H; Moler, Paul; Richards-Zawacki, Corinne L

    2012-01-01

    Little is known about the impact that the pathogenic amphibian chytrid fungus, Batrachochytrium dendrobatidis (Bd), has on fully aquatic salamander species of the eastern United States. As a first step in determining the impacts of Bd on these species, we aimed to determine the prevalence of Bd in wild populations of fully aquatic salamanders in the genera Amphiuma, Necturus, Pseudobranchus, and Siren. We sampled a total of 98 salamanders, representing nine species from sites in Florida, Mississippi, and Louisiana. Overall, infection prevalence was found to be 0.34, with significant differences among genera but no clear geographic pattern. We also found evidence for seasonal variation, but additional sampling throughout the year is needed to clarify this pattern. The high rate of infection discovered in this study is consistent with studies of other amphibians from the southeastern United States. Coupled with previously published data on life histories and population densities, the results presented here suggest that fully aquatic salamanders may be serving as important vectors of Bd and the interaction between these species and Bd warrants additional research.

  7. A survey for Batrachochytrium dendrobatidis in endangered and highly susceptible Vietnamese salamanders (Tylototriton spp.).

    PubMed

    Thien, Tao Nguyen; Martel, An; Brutyn, Melanie; Bogaerts, Sergé; Sparreboom, Max; Haesebrouck, Freddy; Fisher, Matthew C; Beukema, Wouter; Van, Tang Duong; Chiers, Koen; Pasmans, Frank

    2013-09-01

    Until now, Asian amphibians appear to have largely escaped declines driven by chytridiomycosis. Vietnamese salamanders that belong to the genus Tylototriton are rare and have a patchy distribution in mountainous areas, falling within the proposed environmental envelope of chytrid infections, surrounded by Batrachochytrium dendrobatidis infected regions. If these salamanders are susceptible to chytridiomycosis, then their populations could be highly vulnerable after the introduction of B. dendrobatidis. Examination for the presence of the chytrid fungus in skin swabs from 19 Tylototriton asperrimus and 104 Tylototriton vietnamensis by using quantitative polymerase chain reaction was performed. Susceptibility of T. asperrimus to experimental infection by using the global panzootic lineage (BdGPL) strain of B. dendrobatidis was examined. The fungus was absent in all samples from all wild salamanders examined. Inoculation with the BdGPL strain resulted in mortality of all five inoculated salamanders within 3 weeks after inoculation with infected animals that manifested severe orthokeratotic hyperkeratosis, epidermal hyperplasia, and spongiosis. Although infection by B. dendrobatidis currently appears absent in Vietnamese Tylototriton populations, the rarity of these animals, their pronounced susceptibility to chytridiomycosis, an apparently suitable environmental context and increasing likelihood of the pathogen being introduced, together suggest the need of urgent measures to avoid future scenarios of extinction as witnessed in Central America and Australia.

  8. Role of habitat complexity in predator-prey dynamics between an introduced fish and larval Long-toed Salamanders (Ambystoma macrodactylum)

    USGS Publications Warehouse

    Kenison, Erin K; Litt, Andrea R.; Pilliod, David; McMahon, Tom E

    2016-01-01

    Predation by nonnative fishes has reduced abundance and increased extinction risk for amphibian populations worldwide. Although rare, fish and palatable amphibians have been observed to coexist where aquatic vegetation and structural complexity provide suitable refugia. We examined whether larval long-toed salamanders (Ambystoma macrodactylum Baird, 1849) increased use of vegetation cover in lakes with trout and whether adding vegetation structure could reduce predation risk and nonconsumptive effects (NCEs), such as reductions in body size and delayed metamorphosis. We compared use of vegetation cover by larval salamanders in lakes with and without trout and conducted a field experiment to investigate the influence of added vegetation structure on salamander body morphology and life history. The probability of catching salamanders in traps in lakes with trout was positively correlated with the proportion of submerged vegetation and surface cover. Growth rates of salamanders in enclosures with trout cues decreased as much as 85% and the probability of metamorphosis decreased by 56%. We did not find evidence that adding vegetation reduced NCEs in experimental enclosures, but salamanders in lakes with trout utilized more highly-vegetated areas which suggests that adding vegetation structure at the scale of the whole lake may facilitate coexistence between salamanders and introduced trout.

  9. Salamander occupancy in headwater stream networks

    USGS Publications Warehouse

    Grant, E.H.C.; Green, L.E.; Lowe, W.H.

    2009-01-01

    1. Stream ecosystems exhibit a highly consistent dendritic geometry in which linear habitat units intersect to create a hierarchical network of connected branches. 2. Ecological and life history traits of species living in streams, such as the potential for overland movement, may interact with this architecture to shape patterns of occupancy and response to disturbance. Specifically, large-scale habitat alteration that fragments stream networks and reduces connectivity may reduce the probability a stream is occupied by sensitive species, such as stream salamanders. 3. We collected habitat occupancy data on four species of stream salamanders in first-order (i.e. headwater) streams in undeveloped and urbanised regions of the eastern U.S.A. We then used an information-theoretic approach to test alternative models of salamander occupancy based on a priori predictions of the effects of network configuration, region and salamander life history. 4. Across all four species, we found that streams connected to other first-order streams had higher occupancy than those flowing directly into larger streams and rivers. For three of the four species, occupancy was lower in the urbanised region than in the undeveloped region. 5. These results demonstrate that the spatial configuration of stream networks within protected areas affects the occurrences of stream salamander species. We strongly encourage preservation of network connections between first-order streams in conservation planning and management decisions that may affect stream species.

  10. Liquid Marble Coalescence and Triggered Microreaction Driven by Acoustic Levitation.

    PubMed

    Chen, Zhen; Zang, Duyang; Zhao, Liang; Qu, Mengfei; Li, Xu; Li, Xiaoguang; Li, Lixin; Geng, Xingguo

    2017-03-31

    Liquid marbles show promising potential for application in the microreactor field. Control of the coalescence between two or among multiple liquid marbles is critical; however, the successful merging of two isolated marbles is difficult because of their mechanically robust particle shells. In this work, the coalescence of multiple liquid marbles was achieved via acoustic levitation. The dynamic behaviors of the liquid marbles were monitored by a high-speed camera. Driven by the sound field, the liquid marbles moved toward each other, collided, and eventually coalesced into a larger single marble. The underlying mechanisms of this process were probed via sound field simulation and acoustic radiation pressure calculation. The results indicated that the pressure gradient on the liquid marble surface favors the formation of a liquid bridge between the liquid marbles, resulting in their coalescence. A preliminary indicator reaction was induced by the coalescence of dual liquid marbles, which suggests that expected chemical reactions can be successfully triggered with multiple reagents contained in isolated liquid marbles via acoustic levitation.

  11. Innocent until proven guilty? Stable coexistence of alien rainbow trout and native marble trout in a Slovenian stream.

    PubMed

    Vincenzi, Simone; Crivelli, Alain J; Jesensek, Dusan; Rossi, Gianluigi; De Leo, Giulio A

    2011-01-01

    To understand the consequences of the invasion of the nonnative rainbow trout Oncorhynchus mykiss on the native marble trout Salmo marmoratus, we compared two distinct headwater sectors where marble trout occur in allopatry (MTa) or sympatry (MTs) with rainbow trout (RTs) in the Idrijca River (Slovenia). Using data from field surveys from 2002 to 2009, with biannual (June and September) sampling and tagging from June 2004 onwards, we analyzed body growth and survival probabilities of marble trout in each stream sector. Density of age-0 in September over the study period was greater for MTs than MTa and very similar between MTs and RTs, while density of trout ≥age-1 was similar for MTa and MTs and greater than density of RTs. Monthly apparent survival probabilities were slightly higher in MTa than in MTs, while RTs showed a lower survival than MTs. Mean weight of marble and rainbow trout aged 0+ in September was negatively related to cohort density for both marble and rainbow trout, but the relationship was not significantly different between MTs and MTa. No clear depression of body growth of sympatric marble trout between sampling intervals was observed. Despite a later emergence, mean weight of RTs cohorts at age 0+ in September was significantly higher than weight of both MTs and MTa. The establishment of a self-sustaining population of rainbow trout does not have a significant impact on body growth and survival probabilities of sympatric marble trout. The numerical dominance of rainbow trout in streams at lower altitudes seem to suggest that while the low summer flow pattern of Slovenian streams is favorable for rainbow trout invasion, the adaptation of marble trout to headwater environments may limit the invasion success of rainbow trout in headwaters.

  12. Innocent until proven guilty? Stable coexistence of alien rainbow trout and native marble trout in a Slovenian stream

    NASA Astrophysics Data System (ADS)

    Vincenzi, Simone; Crivelli, Alain J.; Jesensek, Dusan; Rossi, Gianluigi; de Leo, Giulio A.

    2011-01-01

    To understand the consequences of the invasion of the nonnative rainbow trout Oncorhynchus mykiss on the native marble trout Salmo marmoratus, we compared two distinct headwater sectors where marble trout occur in allopatry (MTa) or sympatry (MTs) with rainbow trout (RTs) in the Idrijca River (Slovenia). Using data from field surveys from 2002 to 2009, with biannual (June and September) sampling and tagging from June 2004 onwards, we analyzed body growth and survival probabilities of marble trout in each stream sector. Density of age-0 in September over the study period was greater for MTs than MTa and very similar between MTs and RTs, while density of trout ≥age-1 was similar for MTa and MTs and greater than density of RTs. Monthly apparent survival probabilities were slightly higher in MTa than in MTs, while RTs showed a lower survival than MTs. Mean weight of marble and rainbow trout aged 0+ in September was negatively related to cohort density for both marble and rainbow trout, but the relationship was not significantly different between MTs and MTa. No clear depression of body growth of sympatric marble trout between sampling intervals was observed. Despite a later emergence, mean weight of RTs cohorts at age 0+ in September was significantly higher than weight of both MTs and MTa. The establishment of a self-sustaining population of rainbow trout does not have a significant impact on body growth and survival probabilities of sympatric marble trout. The numerical dominance of rainbow trout in streams at lower altitudes seem to suggest that while the low summer flow pattern of Slovenian streams is favorable for rainbow trout invasion, the adaptation of marble trout to headwater environments may limit the invasion success of rainbow trout in headwaters.

  13. The First Salamander Defensin Antimicrobial Peptide

    PubMed Central

    Jiang, Ke; Rong, Mingqiang; Lai, Ren

    2013-01-01

    Antimicrobial peptides have been widely identified from amphibian skins except salamanders. A novel antimicrobial peptide (CFBD) was isolated and characterized from skin secretions of the salamander, Cynops fudingensis. The cDNA encoding CFBD precursor was cloned from the skin cDNA library of C. fudingensis. The precursor was composed of three domains: signal peptide of 17 residues, mature peptide of 41 residues and intervening propeptide of 3 residues. There are six cysteines in the sequence of mature CFBD peptide, which possibly form three disulfide-bridges. CFBD showed antimicrobial activities against Staphylococcus aureus, Bacillus subtilis, Candida albicans and Escherichia coli. This peptide could be classified into family of β-defensin based on its seqeuence similarity with β-defensins from other vertebrates. Evolution analysis indicated that CFBD was close to fish β-defensin. As far as we know, CFBD is the first β-defensin antimicrobial peptide from salamanders. PMID:24386139

  14. The first salamander defensin antimicrobial peptide.

    PubMed

    Meng, Ping; Yang, Shilong; Shen, Chuanbin; Jiang, Ke; Rong, Mingqiang; Lai, Ren

    2013-01-01

    Antimicrobial peptides have been widely identified from amphibian skins except salamanders. A novel antimicrobial peptide (CFBD) was isolated and characterized from skin secretions of the salamander, Cynops fudingensis. The cDNA encoding CFBD precursor was cloned from the skin cDNA library of C. fudingensis. The precursor was composed of three domains: signal peptide of 17 residues, mature peptide of 41 residues and intervening propeptide of 3 residues. There are six cysteines in the sequence of mature CFBD peptide, which possibly form three disulfide-bridges. CFBD showed antimicrobial activities against Staphylococcus aureus, Bacillus subtilis, Candida albicans and Escherichia coli. This peptide could be classified into family of β-defensin based on its sequence similarity with β-defensins from other vertebrates. Evolution analysis indicated that CFBD was close to fish β-defensin. As far as we know, CFBD is the first β-defensin antimicrobial peptide from salamanders.

  15. Phylogenetic relationships of the endangered Shenandoah salamander (Plethodon shenandoah) and other salamanders of the Plethodon cinereus group (Caudata : Plethodontidae)

    USGS Publications Warehouse

    Sites, J.W.; Morando, M.; Highton, R.; Huber, F.; Jung, R.E.

    2004-01-01

    The Shenandoah salamander (Plethodon shenandoah), known from isolated talus slopes on three of the highest mountains in Shenandoah National Park, is listed as state-endangered in Virginia and federally endangered under the U.S. Endangered Species Act. A 1999 paper by G. R. Thurow described P. shenandoah-like salamanders from three localities further south in the Blue Ridge Physiographic Province, which, if confirmed, would represent a range extension for P. shenandoah of approximately 90 km from its nearest known locality. Samples collected from two of these three localities were included in a molecular phylogenetic study of the known populations of P. shenandoah, and all other recognized species in the Plethodon cinereus group, using a 792 bp region of the mitochondrial cytochrome-b gene. Phylogenetic estimates were based on Bayesian, maximum likelihood, and maximum parsimony methods and topologies examined for placement of the new P. shenandoah-like samples relative to all others. All topologies recovered all haplotypes of the P. shenandoah-like animals nested within P. cinereus, and a statistical comparison of the best likelihood tree topology with one with an enforced (Thurow + Shenandoah P. shenandoah) clade revealed that the unconstrained tree had a significantly lower -In L score (P < 0.05, using the Shimodaira-Hasegawa test) than the constraint tree. This result and other anecdotal information give us no solid reason to consider the Thurow report valid. The current recovery program for P. shenandoah should remain focused on populations in Shenandoah National Park.

  16. Linking the evolution of habitat choice to ecosystem functioning: direct and indirect effects of pond-reproducing fire salamanders on aquatic-terrestrial subsidies.

    PubMed

    Reinhardt, Timm; Steinfartz, Sebastian; Paetzold, Achim; Weitere, Markus

    2013-09-01

    Shifts in life history traits and in the behaviour of species can potentially alter ecosystem functioning. The reproduction of the central European fire salamander (Salamandra salamandra), which usually deposits its larvae in first-order streams, in small pool and pond-like habitats, is an example of a recent local adaptation in this species. Here we aimed to quantify the direct and indirect effects of the predatory larvae on the aquatic food webs in the ponds and on the flux of matter between the ponds and adjacent terrestrial habitats. Our estimates are based on biomass data of the present pond fauna as well as on the analysis of stomach content data, growth rates and population dynamics of the salamander larvae in pond habitats. By their deposition of larvae in early spring, female fire salamanders import between 0.07 and 2.86 g dry mass m(-2) larval biomass into the ponds. Due to high mortality rates in the larval phase and the relatively small size at metamorphosis of the pond-adapted salamanders compared to stream-adapted ones, the biomass export of the metamorphosed salamanders clearly falls below the initial biomass import. Catastrophic events such as high water temperatures and low oxygen levels may even occasionally result in mass mortalities of salamander larvae and thus in a net 100 % import of the salamander biomass into the pond food webs. Indirect effects further accelerate this net import of matter into the aquatic habitat, e.g. the feeding of salamanders on aquatic insect larvae with the emergence of terrestrial adults-thus preventing export-and on terrestrial organisms that fall on the water surface (supporting import). This study demonstrates that the adaptation of salamanders to pond reproduction can alter food web linkages across ecosystem boundaries by enhancing the flux of materials and energy from terrestrial (i.e. forest) to the aquatic (i.e. pond) habitat.

  17. Evolution of Gigantism in Amphiumid Salamanders

    PubMed Central

    Bonett, Ronald M.; Chippindale, Paul T.; Moler, Paul E.; Van Devender, R. Wayne; Wake, David B.

    2009-01-01

    The Amphiumidae contains three species of elongate, permanently aquatic salamanders with four diminutive limbs that append one, two, or three toes. Two of the species, Amphiuma means and A. tridactylum, are among the largest salamanders in the world, reaching lengths of more than one meter, whereas the third species (A. pholeter), extinct amphiumids, and closely related salamander families are relatively small. Amphiuma means and A. tridactylum are widespread species and live in a wide range of lowland aquatic habitats on the Coastal Plain of the southeastern United States, whereas A. pholeter is restricted to very specialized organic muck habitats and is syntopic with A. means. Here we present analyses of sequences of mitochondrial and nuclear loci from across the distribution of the three taxa to assess lineage diversity, relationships, and relative timing of divergence in amphiumid salamanders. In addition we analyze the evolution of gigantism in the clade. Our analyses indicate three lineages that have diverged since the late Miocene, that correspond to the three currently recognized species, but the two gigantic species are not each other's closest relatives. Given that the most closely related salamander families and fossil amphiumids from the Upper Cretaceous and Paleocene are relatively small, our results suggest at least two extreme changes in body size within the Amphuimidae. Gigantic body size either evolved once as the ancestral condition of modern amphiumas, with a subsequent strong size reduction in A. pholeter, or gigantism independently evolved twice in the modern species, A. means and A. tridactylum. These patterns are concordant with differences in habitat breadth and range size among lineages, and have implications for reproductive isolation and diversification of amphiumid salamanders. PMID:19461997

  18. Evolution of gigantism in amphiumid salamanders.

    PubMed

    Bonett, Ronald M; Chippindale, Paul T; Moler, Paul E; Van Devender, R Wayne; Wake, David B

    2009-05-20

    The Amphiumidae contains three species of elongate, permanently aquatic salamanders with four diminutive limbs that append one, two, or three toes. Two of the species, Amphiuma means and A. tridactylum, are among the largest salamanders in the world, reaching lengths of more than one meter, whereas the third species (A. pholeter), extinct amphiumids, and closely related salamander families are relatively small. Amphiuma means and A. tridactylum are widespread species and live in a wide range of lowland aquatic habitats on the Coastal Plain of the southeastern United States, whereas A. pholeter is restricted to very specialized organic muck habitats and is syntopic with A. means. Here we present analyses of sequences of mitochondrial and nuclear loci from across the distribution of the three taxa to assess lineage diversity, relationships, and relative timing of divergence in amphiumid salamanders. In addition we analyze the evolution of gigantism in the clade. Our analyses indicate three lineages that have diverged since the late Miocene, that correspond to the three currently recognized species, but the two gigantic species are not each other's closest relatives. Given that the most closely related salamander families and fossil amphiumids from the Upper Cretaceous and Paleocene are relatively small, our results suggest at least two extreme changes in body size within the Amphuimidae. Gigantic body size either evolved once as the ancestral condition of modern amphiumas, with a subsequent strong size reduction in A. pholeter, or gigantism independently evolved twice in the modern species, A. means and A. tridactylum. These patterns are concordant with differences in habitat breadth and range size among lineages, and have implications for reproductive isolation and diversification of amphiumid salamanders.

  19. Context-dependent movement behavior of woodland salamanders (Plethodon) in two habitat types.

    PubMed

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Animal movement is critical to the maintenance of functional connectivity at the landscape scale and can play a key role in population persistence and metapopulation dynamics. The permeability of habitat to animal movement may vary as a result of either differential mortality, physical resistance, or simply the behavioral responses of organisms to perceived habitat quality. Understanding how and when animal movement behavior varies among habitat types is critical for identifying barriers to dispersal and predicting species distributions in relation to landscape features. We conducted an experimental translocation study and compared the movement success and behavioral strategies of plethodontid salamanders in both forest and open-canopy habitat. We found that individuals in closed-canopy forest oriented more strongly towards their home ranges and moved significantly farther on their release night. In spite of the clear differences in movement paths, the ultimate movement success of homing salamanders did not appear to vary with habitat type. Our study contributes to a growing body of literature suggesting the importance of recognizing the context dependence of animal movement behavior. Because the movement rates of displaced salamanders were significantly reduced in open-canopy, dispersal rates of plethodontid salamanders in open-canopy habitat are likely lower than in control forest. Further mechanistic studies focusing on habitat-specific movement behavior and survival costs will be valuable for effectively identifying and mitigating barriers to animal movement.

  20. Spatial and temporal patterns of Ambystoma tigrinum virus (ATV) prevalence in tiger salamanders Ambystoma tigrinum nebulosum.

    PubMed

    Greer, Amy L; Brunner, Jesse L; Collins, James P

    2009-05-27

    Amphibian ranaviruses have been documented as causes of mass mortality in amphibian populations throughout the world. The temporal and spatial dynamics of ranavirus infections when epidemics are not apparent remains unclear. To address this question, we collected tissue samples from 2003 to 2006 in 4 geographically separated tiger salamander Ambystoma tigrinum nebulosum host populations on the Kaibab Plateau in northern Arizona. We tested for Ambystoma tigrinum virus (ATV), a lethal ranavirus of tiger salamanders, calculated ATV prevalence for each sampling date, and examined temporal and spatial patterns by quantifying the annual level of ATV synchrony among populations using the intraclass correlation coefficient. Salamander populations were commonly infected with ATV. We observed no morbidity or mortality in these populations even as ATV prevalence values varied from 0 to 57%. Infection prevalence across the landscape was more similar within a given year than between years. There was no statistically significant spatial pattern in prevalence across the landscape. Our findings highlight the need to explore new hypotheses regarding the population level impact of these pathogens on amphibian communities.

  1. Conservation genetics of the endangered Shenandoah salamander (Plethodon shenandoah, Plethodontidae)

    USGS Publications Warehouse

    Carpenter, D.W.; Jung, R.E.; Sites, J.W.

    2001-01-01

    The Shenandoah salamander (Plethodon shenandoah) is restricted to three isolated talus outcrops in Shenandoah National Park, VA, USA and has one of the smallest ranges of any tetrapod vertebrate. This species was listed as endangered under the US Endangered Species Act in 1989 over concern that direct competition with the red-backed salamander (Plethodon cinereus), successional habitat changes, and human impacts may cause its decline and possible extinction. We address two issues herein: (1) whether extensive introgression (through long-term hybridization) is present between the two species and threatens the survival of P. shenandoah, and (2) the level of population structure within P. shenandoah. We provide evidence from mtDNA haplotypes that shows no genetic differentiation among the three isolates of P. shenandoah, suggesting that their fragmentation is a geologically recent event, and/or that the isolates are still connected by occasional gene flow. There is also no evidence for extensive introgression of alleles in either direction between P. cinereus and P. shenandoah, which suggests that P. shenandoah may not be in danger of being genetically swamped out through hybridization with P. cinereus.

  2. Atrazine increases ranavirus susceptibility in the tiger salamander, Ambystoma tigrinum.

    PubMed

    Forson, Diane Denise; Storfer, Andrew

    2006-12-01

    Pathogenic diseases and environmental contaminants are two of the leading hypotheses for global amphibian declines, yet few studies have examined the influence of contaminants on disease susceptibility. In this study, we examined effects of ecologically relevant doses of atrazine (0, 1.6, 16, and 160 microg/L), sodium nitrate (0, 6.8, 68 mg/L), and their interactions on susceptibility of four laboratory-bred tiger salamander families to Ambystoma tigrinum virus (ATV), a pathogen implicated in global amphibian die-offs. Salamanders were from Arizona populations where a coevolutionary history with ATV is supported, and thus cofactors rather than recent introduction may contribute to disease epizootics. Use of atrazine and nitrogenous fertilizers are ubiquitous; therefore, the impact of these cofactors on disease susceptibility is an important consideration. Atrazine and sodium nitrate significantly decreased peripheral leukocyte levels, suggesting an impact of these contaminants on the immune system. As expected from this result, atrazine significantly increased susceptibility of larvae to ATV infection. In contrast, nitrate had a marginally significant main effect and significantly decreased infection rate at the highest level. However, neither atrazine nor sodium nitrate had significant effects on viral copy number per individual. These results suggest that ecologically relevant concentrations of atrazine and nitrates have immunosuppressive effects, and atrazine may contribute to ATV epizootics, raising concerns about the influence of contaminants on diseases in general.

  3. Evidence for Sex Chromosome Turnover in Proteid Salamanders.

    PubMed

    Sessions, Stanley K; Bizjak Mali, Lilijana; Green, David M; Trifonov, Vladimir; Ferguson-Smith, Malcolm

    2016-01-01

    A major goal of genomic and reproductive biology is to understand the evolution of sex determination and sex chromosomes. Species of the 2 genera of the Salamander family Proteidae - Necturus of eastern North America, and Proteus of Southern Europe - have similar-looking karyotypes with the same chromosome number (2n = 38), which differentiates them from all other salamanders. However, Necturus possesses strongly heteromorphic X and Y sex chromosomes that Proteus lacks. Since the heteromorphic sex chromosomes of Necturus were detectable only with C-banding, we hypothesized that we could use C-banding to find sex chromosomes in Proteus. We examined mitotic material from colchicine-treated intestinal epithelium, and meiotic material from testes in specimens of Proteus, representing 3 genetically distinct populations in Slovenia. We compared these results with those from Necturus. We performed FISH to visualize telomeric sequences in meiotic bivalents. Our results provide evidence that Proteus represents an example of sex chromosome turnover in which a Necturus-like Y-chromosome has become permanently translocated to another chromosome converting heteromorphic sex chromosomes to homomorphic sex chromosomes. These results may be key to understanding some unusual aspects of demographics and reproductive biology of Proteus, and are discussed in the context of models of the evolution of sex chromosomes in amphibians.

  4. Macrophages are required for adult salamander limb regeneration.

    PubMed

    Godwin, James W; Pinto, Alexander R; Rosenthal, Nadia A

    2013-06-04

    The failure to replace damaged body parts in adult mammals results from a muted growth response and fibrotic scarring. Although infiltrating immune cells play a major role in determining the variable outcome of mammalian wound repair, little is known about the modulation of immune cell signaling in efficiently regenerating species such as the salamander, which can regrow complete body structures as adults. Here we present a comprehensive analysis of immune signaling during limb regeneration in axolotl, an aquatic salamander, and reveal a temporally defined requirement for macrophage infiltration in the regenerative process. Although many features of mammalian cytokine/chemokine signaling are retained in the axolotl, they are more dynamically deployed, with simultaneous induction of inflammatory and anti-inflammatory markers within the first 24 h after limb amputation. Systemic macrophage depletion during this period resulted in wound closure but permanent failure of limb regeneration, associated with extensive fibrosis and disregulation of extracellular matrix component gene expression. Full limb regenerative capacity of failed stumps was restored by reamputation once endogenous macrophage populations had been replenished. Promotion of a regeneration-permissive environment by identification of macrophage-derived therapeutic molecules may therefore aid in the regeneration of damaged body parts in adult mammals.

  5. Anciet marble quarries in Lesvos island Greece

    NASA Astrophysics Data System (ADS)

    Mataragkas, M.; Mataragkas, D.

    2009-04-01

    ANCIENT MARBLE QUARRIES IN LESBOS ISLAND, GREECE Varti- Matarangas M.1 & Matarangas D. 1 Institute of Geological and Mining Exploration (IGME), Olympic Village, Entrance C, ACHARNAE 13677, GREECE myrsini@igme.gr , myrsini@otenet.g r A B S T R A C T Ten ancient marble quarries of Lesbos Island, most of them previously unknown, have been studied, in the frame of the research study on the ancient marble quarries in the Aegean Sea. In the present paper the geological, petrological and morphological features of the aforementioned quarries are examined. Concerning the six ancient quarries located in the areas of Tarti, Agia Paraskevi (Tsaf), Mageiras, Loutra, Latomi (Plomari) and Thermi, the authochthonous neopaleozoic unit constitutes their geological formation, while their hosting lithological formations are the included crystalline limestone lens like beds. In two ancient quarries in the areas Moria and Alyfanta, the geological formation is the authochthonous upper Triassic series and the hosting lithological formation the upper Triassic carbonate sequence, while in the areas of Akrasi-Abeliko and Karyni, the geological formation is the thrust Triassic unit and the lithological hosting formations are the included strongly deformed or not crystalline limestone lenticular beds. Furthermore, the petrographic features were also determined permitting the identification of the building stones that have been used.

  6. Experimental infection of native north Carolina salamanders with Batrachochytrium dendrobatidis.

    PubMed

    Chinnadurai, Sathya K; Cooper, David; Dombrowski, Daniel S; Poore, Matthew F; Levy, Michael G

    2009-07-01

    Chytridiomycosis is an often fatal fungal disease of amphibians caused by Batrachochytrium dendrobatidis. This disease has been implicated in the worldwide decline of many anuran species, but studies of chytridiomycosis in wild salamanders are limited. Between August 2006 and December 2006, we tested wild amphibians in North Carolina, USA (n=212) by polymerase chain reaction (PCR). We identified three PCR-positive animals: one Rana clamitans and two Plethodontid salamanders. We experimentally infected two species of native North Carolina Plethodontid salamanders, the slimy salamander (Plethodon glutinosus) and the Blue Ridge Mountain dusky salamander (Desmognathus orestes) with 1,000,000 zoospores of B. dendrobatidis per animal. Susceptibility was species dependent; all slimy salamanders developed clinical signs of chytridiomycosis, and one died, whereas dusky salamanders remained unaffected. In a second experiment, we challenged naïve slimy salamanders with either 10,000 or 100,000 motile zoospores per animal. Clinical signs consistent with chytridiomycosis were not observed at either dose or in uninfected controls during the 45 days of this experiment. All animals inoculated with B. dendrobatidis in both experiments, regardless of dose, tested positive by PCR. Our study indicates that slimy salamanders are more susceptible to clinical chytridiomycosis than dusky salamanders, and in a laboratory setting, a dose greater than 100,000 zoospores per animal is required to induce clinical disease. This study also indicates that PCR is a very sensitive tool for detecting B. dendrobatidis infection, even in animals that are clinically unaffected, thus positive results should be interpreted with caution.

  7. Ambient ultraviolet radiation causes mortality in salamander eggs

    SciTech Connect

    Blaustein, A.R.; Edmond, B.; Kiesecker, J.M.

    1995-08-01

    Previous research has shown that amphibian species have differential sensitivity to ultraviolet-B (UV-B) radiation. In some anuran species, ambient levels of UV-B cause mortality in embryonic stages and hatching success is significantly reduced. Projected increases in UV-B may affect an increasing number of species. The adverse effects of UV-B may eventually be manifested at the population level and may ultimately contribute to population declines. Using field experiments, we investigated the effects of ambient UV-B on salamander (Ambystoma gracile) embryos developing at natural oviposition sites. We show that the hatching success of eggs of A. gracile shielded from UV-B is significantly higher than those not shielded from UV-B. 27 refs., 1 fig.

  8. Identification of Euryhelmis costaricensis metacercariae in the skin of Tohoku hynobiid salamanders (Hynobius lichenatus), northeastern Honshu, Japan.

    PubMed

    Sato, Hiroshi; Ihara, Sadao; Inaba, Osamu; Une, Yumi

    2010-07-01

    Since 2000, cutaneous nodular lesions were observed in Tohoku hynobiid salamanders (Hynobius lichenatus) in the northern Abukuma Mountains, northeastern Honshu, Japan. The distribution of diseased salamanders has expanded, along with the increasing severity of the disease. Samples (foreleg, hindleg, and tail) from five diseased salamanders caught in the spring of 2009 contained 11 to 383 metacercarial cysts (0.43-0.48 mm in diameter) per individual. Experimental inoculations of the metacercariae into rats (Rattus norvegicus) resulted in the development of pentagonal adults with intrauterine eggs that were collected at 3 days, 2 wk, and 5 wk postinoculation. Although adults obtained from rats were smaller, the flukes were morphologically similar to Euryhelmis costaricensis, recorded from Japanese martens (Martes melampus) in northeastern Honshu. The ribosomal RNA gene sequences of the metacercariae collected from salamanders and the E. costaricensis collected from a Japanese marten were identical, confirming the morphology-based species identification. Environmental changes responsible for the increased frequency of diseased salamanders and the increased parasite load are unknown, although increases in feral populations of introduced raccoons (Procyon lotor) and American minks (Neovison vison) may be associated.

  9. Study of marble deterioration at City Hall, Schenectady, NY

    SciTech Connect

    Cheng, R.J.; Castillo, R.

    1984-01-01

    The effects of air pollution and acid precipitation were investigated as causing the erosion of marble. The research indicated that the marble grains are being structurally weakened by a chemical conversion process of marble to gypsum crystals. The surface zone of chemical activity (2-5 mm) shows the presence of fly ash and iron particles, and points to the possibility of a catalytic mechanism for the conversion of sulfur dioxide to sulfate.

  10. Evaluating multi-level models to test occupancy state responses of Plethodontid salamanders

    USGS Publications Warehouse

    Kroll, Andrew J.; Garcia, Tiffany S.; Jones, Jay E.; Dugger, Catherine; Murden, Blake; Johnson, Josh; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  11. Evaluating Multi-Level Models to Test Occupancy State Responses of Plethodontid Salamanders

    PubMed Central

    Kroll, Andrew J.; Garcia, Tiffany S.; Jones, Jay E.; Dugger, Katie; Murden, Blake; Johnson, Josh; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  12. Evaluating Multi-Level Models to Test Occupancy State Responses of Plethodontid Salamanders.

    PubMed

    Kroll, Andrew J; Garcia, Tiffany S; Jones, Jay E; Dugger, Katie; Murden, Blake; Johnson, Josh; Peterman, Summer; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  13. ON ganglion cells are intrinsically photosensitive in the tiger salamander retina.

    PubMed

    Rajaraman, Kaveri

    2012-01-01

    Intrinsically photosensitive retinal ganglion cells (ipRGCs) have been well characterized in mammalian systems, both morphologically and electrophysiologically. They show slow, sustained responses to bright light in the absence of photoreceptor-based input, mediated by the photopigment melanopsin. Only one mammalian melanopsin gene is expressed in a small fraction of the retinal ganglion cell population, but there are two genes for melanopsin among nonmammalian vertebrates that are widely expressed in a variety of retinal and extraretinal cell types, along with other photosensitive pigments. The current study provides an electrophysiological study of ipRGCs in the larval tiger salamander (Ambystoma tigrinum), a nonmammalian vertebrate with a well-characterized retina. The results show that the ipRGC population is equivalent to the ON ganglion cell population in the tiger salamander retina. This sheds light on the evolutionary trajectory and functional significance of intrinsic photosensitivity through the vertebrate lineage and also affects our understanding of ON cell activity and development. We have characterized the nature of the intrinsic responses of the ON cell population, compared intrinsic and synaptically based receptive fields, and quantified the spectrum of the intrinsic activity. A wider action spectrum of intrinsic photosensitivity was obtained than would be expected for a single opsin photopigment, suggesting the expression of multiple photopigments in the salamander ipRGC. J. Comp. Neurol., 2012. © 2011 Wiley Periodials, Inc.

  14. Unexpected rarity of the pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957-2011.

    PubMed

    Muletz, Carly; Caruso, Nicholas M; Fleischer, Robert C; McDiarmid, Roy W; Lips, Karen R

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957-987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957-2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1-0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection.

  15. Intracapsular algae provide fixed carbon to developing embryos of the salamander Ambystoma maculatum.

    PubMed

    Graham, Erin R; Fay, Scott A; Davey, Adam; Sanders, Robert W

    2013-02-01

    Each spring, North American spotted salamander (Ambystoma maculatum) females each lay hundreds of eggs in shallow pools of water. Eggs are surrounded by jelly layers and are deposited as large gelatinous masses. Following deposition, masses are penetrated by a mutualistic green alga, Oophila amblystomatis, which enters individual egg capsules, proliferates and aggregates near the salamander embryo, providing oxygen that enhances development. We examined the effects of population density of intracapsular O. amblystomatis on A. maculatum embryos and show that larger algal populations promote faster embryonic growth and development. Also, we show that carbon fixed by O. amblystomatis is transferred to the embryos, providing the first evidence of direct translocation of photosynthate from a symbiont to a vertebrate host.

  16. Distribution of the Sonora Tiger Salamander (Ambystoma mavortium stebbinsi) in Mexico

    USGS Publications Warehouse

    Hossack, Blake R.; Muths, Erin L.; Rorabaugh, James C.; Lemos Espinal, Julio A.; Sigafus, Brent H.; Chambert, Thierry A; Carreon Arroyo, Gerardo; Hurtado Felix, David; Toyos Martinez, Daniel; Jones, Thomas R

    2016-01-01

    The Sonoran Tiger Salamander (Ambystoma mavortium stebbinsi Lowe, 1954) was listed as federally endangered in the USA in 1997 (USFWS 1997). In the USA, the distribution of A. mavortium stebbinsi is limited to the San Rafael Valley (approximately 567 km2), between the Sierra San Antonio (called the Patagonia Mountains in Arizona) and Huachuca Mountains, and south of the Canelo Hills, Arizona (Fig. 1). The USA listing was triggered by loss of natural wetland habitats, threats from invasive predators, frequent die-offs from disease, introgression with the introduced Barred Tiger Salamander (A. mavortium mavortium), and small range and number of breeding sites that increases susceptibility to stochastic events (USFWS 1997). Small population sizes and limited gene flow have caused inbreeding, which may further reduce population viability and the potential for recovery (Jones et al. 1988; Storfer et al. 2014). 

  17. Homing orientation in salamanders: A mechanism involving chemical cues

    NASA Technical Reports Server (NTRS)

    Madison, D. M.

    1972-01-01

    A detailed description is given of experiments made to determine the senses and chemical cues used by salamanders for homing orientation. Sensory impairment and cue manipulative techniques were used in the investigation. All experiments were carried out at night. Results show that sense impaired animals did not home as readily as those who were blind but retained their sensory mechanism. This fact suggests that the olfactory mechanism is necessary for homing in the salamander. It was determined that after the impaired salamander regenerated its sensory mechanism it too returned home. It was concluded that homing ability in salamanders is direction independent, distant dependent, and vision independent.

  18. Lethal effects of water quality on threatened California salamanders but not on co-occurring hybrid salamanders.

    PubMed

    Ryan, Maureen E; Johnson, Jarrett R; Fitzpatrick, Benjamin M; Lowenstine, Linda J; Picco, Angela M; Shaffer, H Bradley

    2013-02-01

    Biological invasions and habitat alteration are often detrimental to native species, but their interactions are difficult to predict. Interbreeding between native and introduced species generates novel genotypes and phenotypes, and human land use alters habitat structure and chemistry. Both invasions and habitat alteration create new biological challenges and opportunities. In the intensively farmed Salinas Valley, California (U.S.A.), threatened California tiger salamanders (Ambystoma californiense) have been replaced by hybrids between California tiger salamander and introduced barred tiger salamanders (Ambystoma tigrinum mavortium). We conducted an enclosure experiment to examine the effects habitat modification and relative frequency of hybrid and native California tiger salamanders have on recruitment of salamanders and their prey, Pacific chorus frogs (Pseudacris regilla). We tested whether recruitment differed among genetic classes of tiger salamanders (hybrid or native) and pond hydroperiod (seasonal or perennial). Roughly 6 weeks into the experiment, 70% (of 378 total) of salamander larvae died in 4 out of 6 ponds. Native salamanders survived (n = 12) in these ponds only if they had metamorphosed prior to the die-offs. During die-offs, all larvae of native salamanders died, whereas 56% of hybrid larvae died. We necropsied native and hybrid salamanders, tested water quality, and queried the California Department of Pesticide Regulation database to investigate possible causes of the die-offs. Salamander die-offs, changes in the abundance of other community members (invertebrates, algae, and cyanobacteria), shifts in salamander sex ratio, and patterns of pesticide application in adjacent fields suggest that pesticide use may have contributed to die-offs. That all survivors were hybrids suggests that environmental stress may promote rapid displacement of native genotypes.

  19. Phylogeography of Sardinian Cave Salamanders (Genus Hydromantes) Is Mainly Determined by Geomorphology

    PubMed Central

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M.; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems. PMID:22427830

  20. Phylogeography of Sardinian cave salamanders (genus Hydromantes) is mainly determined by geomorphology.

    PubMed

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems.

  1. Blue Marble Space Institute essay contest

    NASA Astrophysics Data System (ADS)

    Wendel, JoAnna

    2014-04-01

    The Blue Marble Space Institute of Science, based in Seattle, Wash., is inviting college students to participate in its essay contest. Essays need to address the question, "In the next 100 years, how can human civilization prepare for the long-term changes to the Earth system that will occur over the coming millennium?" According to the institute, the purpose of the contest is "to stimulate creative thinking relating to space exploration and global issues by exploring how changes in the Earth system will affect humanity's future."

  2. On the mechanism of floating and sliding of liquid marbles.

    PubMed

    Bormashenko, Edward; Bormashenko, Yelena; Musin, Albina; Barkay, Zahava

    2009-03-09

    The mechanisms of floating and sliding of liquid marbles are studied. Liquid marbles containing CaCl(2) and marbles containing NaOH water solutions float on water containing Na(2)CO(3) and an alcoholic solution of phenolphthalein with no chemical reaction. Sliding of liquid marbles, consisting of NaOH water solutions, on polymer substrates coated with phenolphthalein is studied as well. No chemical reaction is observed. These observations supply direct experimental evidence for the suggestion that interfaces are separated by an air layer when marbles roll on solid substrates. It is concluded that a liquid marble rests on hydrophobic particles coating the liquid. In contrast, drops containing an NaOH water solution sliding on superhydrophobic surfaces coated with phenolphthalein leave a colored trace. The mechanism of low-friction sliding of drops deposited on superhydrophobic surfaces and liquid marbles turns out to be quite different: there is no direct contact between liquid and solid in the case of marbles' motion.

  3. [Sexual dimorphism of marbled polecat Vormela peregusna (Carnivora: Mustelidae)].

    PubMed

    Rozhnov, V V; Abramov, A V

    2006-01-01

    Analysis of morphometric variation in 26 cranial characters were studied in 85 individuals of marbled polecat Vormela peregusna from Turkmenistan demonstrated a low level of sexual dimorphism in the species. The properties of sexual dimorphism in marbled polecat are discussed in terms of available hypotheses of sexual dimorphism in carnivores.

  4. Consolidated waste forms: glass marbles and ceramic pellets

    SciTech Connect

    Treat, R.L.; Rusin, J.M.

    1982-05-01

    Glass marbles and ceramic pellets have been developed at Pacific Northwest Laboratory as part of the multibarrier concept for immobilizing high-level radioactive waste. These consolidated waste forms served as substrates for the application of various inert coatings and as ideal-sized particles for encapsulation in protective matrices. Marble and pellet formulations were based on existing defense wastes at Savannah River Plant and proposed commercial wastes. To produce marbles, glass is poured from a melter in a continuous stream into a marble-making device. Marbles were produced at PNL on a vibratory marble machine at rates as high as 60 kg/h. Other marble-making concepts were also investigated. The marble process, including a lead-encapsulation step, was judged as one of the more feasible processes for immobilizing high-level wastes. To produce ceramic pellets, a series of processing steps are required, which include: spray calcining - to dry liquid wastes to a powder; disc pelletizing - to convert waste powders to spherical pellets; sintering - to densify pellets and cause desired crystal formation. These processing steps are quite complex, and thereby render the ceramic pellet process as one of the least feasible processes for immobilizing high-level wastes.

  5. Skeletal muscle dedifferentiation during salamander limb regeneration.

    PubMed

    Wang, Heng; Simon, András

    2016-10-01

    Salamanders can regenerate entire limbs throughout their life. A critical step during limb regeneration is formation of a blastema, which gives rise to the new extremity. Salamander limb regeneration has historically been tightly linked to the term dedifferentiation, however, with refined research tools it is important to revisit the definition of dedifferentiation in the context. To what extent do differentiated cells revert their differentiated phenotypes? To what extent do progeny from differentiated cells cross lineage boundaries during regeneration? How do cell cycle plasticity and lineage plasticity relate to each other? What is the relationship between dedifferentiation of specialized cells and activation of tissue resident stem cells in terms of their contribution to the new limb? Here we highlight these problems through the case of skeletal muscle.

  6. Performance Evaluation of Concrete using Marble Mining Waste

    NASA Astrophysics Data System (ADS)

    Kore, Sudarshan Dattatraya; Vyas, A. K.

    2016-12-01

    A huge amount waste (approximately 60%) is generated during mining and processing in marble industries. Such waste can be best utilized in infrastructure development works. Coarse aggregate 75% by weight was replaced by aggregate obtained from marble mining waste. The impact of marble waste as a partial replacement for conventional coarse aggregate on the properties of concrete mixes such as workability, compressive strength, permeability, abrasion, etc. was evaluated. The test results revealed that the compressive strength was comparable to that of control concrete. Other properties such as workability of concrete increased, water absorption reduced by 17%, and resistance to abrasion was marginally increased by 2% as compared to that of control concrete. Ultrasonic pulse velocity and FTIR results show improvement in quality of concrete with crushed marble waste. From the TGA analysis it was confirmed that, aggregate produced from marble waste shows better performance under elevated temperature than that of conventional aggregates.

  7. Stream salamanders as indicators of stream quality in Maryland, USA

    USGS Publications Warehouse

    Southerland, M.T.; Jung, R.E.; Baxter, D.P.; Chellman, I.C.; Mercurio, G.; Volstad, J.H.

    2004-01-01

    Biological indicators are critical to the protection of small, headwater streams and the ecological values they provide. Maryland and other state monitoring programs have determined that fish indicators are ineffective in small streams, where stream salamanders may replace fish as top predators. Because of their life history, physiology, abundance, and ubiquity, stream salamanders are likely representative of biological integrity in these streams. The goal of this study was to determine whether stream salamanders are effective indicators of ecological conditions across biogeographic regions and gradients of human disturbance. During the summers of 2001 and 2002, we intensively surveyed for stream salamanders at 76 stream sites located west of the Maryland Coastal Plain, sites also monitored by the Maryland Biological Stream Survey (MBSS) and City of Gaithersburg. We found 1,584 stream salamanders, including all eight species known in Maryland, using two 15 ? 2 m transects and two 4 m2 quadrats that spanned both stream bank and channel. We performed removal sampling on transects to estimate salamander species detection probabilities, which ranged from 0.67-0.85. Stepwise regressions identified 15 of 52 non-salamander variables, representing water quality, physical habitat, land use, and biological conditions, which best predicted salamander metrics. Indicator development involved (1) identifying reference (non-degraded) and degraded sites (using percent forest, shading, riparian buffer width, aesthetic rating, and benthic macroinvertebrate and fish indices of biotic integrity); (2) testing 12 candidate salamander metrics (representing species richness and composition, abundance, species tolerance, and reproductive function) for their ability to distinguish reference from degraded sites; and (3) combining metrics into an index that effectively discriminated sites according to known stream conditions. Final indices for Highlands, Piedmont, and Non-Coastal Plain

  8. In Search of Critically Endangered Species: The Current Situation of Two Tiny Salamander Species in the Neotropical Mountains of Mexico

    PubMed Central

    Sandoval-Comte, Adriana; Pineda, Eduardo; Aguilar-López, José L.

    2012-01-01

    Worldwide, one in every three species of amphibian is endangered, 39 species have gone extinct in the last 500 years and another 130 species are suspected to have gone extinct in recent decades. Of the amphibians, salamanders have the highest portion of their species in one of the risk categories, even higher than the frogs. To date there have been few studies that have used recent field data to examine the status of populations of endangered salamanders. In this study we evaluate the current situation of two tiny salamanders, Parvimolge townsendi and Thorius pennatulus, both of which are distributed at intermediate elevations in the mountains of the northern Neotropics and are considered to be critically endangered; the first has been proposed as possibly extinct. By carrying out exhaustive surveys in both historical and potentially suitable sites for these two species, we evaluated their abundance and the characteristics of their habitats, and we estimated their potential geographic distribution. We visited 22 sites, investing 672 person-hours of sampling effort in the surveys, and found 201 P. townsendi salamanders in 11 sites and only 13 T. pennatulus salamanders in 5 sites. Both species were preferentially found in cloud forest fragments that were well conserved or only moderately transformed, and some of the salamanders were found in shade coffee plantations. The potential distribution area of both species is markedly fragmented and we estimate that it has decreased by more than 48%. The results of this study highlight the importance of carrying out exhaustive, systematic field surveys to obtain accurate information about the current situation of critically endangered species, and help us better understand the crisis that amphibians are facing worldwide. PMID:22485155

  9. In search of critically endangered species: the current situation of two tiny salamander species in the Neotropical mountains of Mexico.

    PubMed

    Sandoval-Comte, Adriana; Pineda, Eduardo; Aguilar-López, José L

    2012-01-01

    Worldwide, one in every three species of amphibian is endangered, 39 species have gone extinct in the last 500 years and another 130 species are suspected to have gone extinct in recent decades. Of the amphibians, salamanders have the highest portion of their species in one of the risk categories, even higher than the frogs. To date there have been few studies that have used recent field data to examine the status of populations of endangered salamanders. In this study we evaluate the current situation of two tiny salamanders, Parvimolge townsendi and Thorius pennatulus, both of which are distributed at intermediate elevations in the mountains of the northern Neotropics and are considered to be critically endangered; the first has been proposed as possibly extinct. By carrying out exhaustive surveys in both historical and potentially suitable sites for these two species, we evaluated their abundance and the characteristics of their habitats, and we estimated their potential geographic distribution. We visited 22 sites, investing 672 person-hours of sampling effort in the surveys, and found 201 P. townsendi salamanders in 11 sites and only 13 T. pennatulus salamanders in 5 sites. Both species were preferentially found in cloud forest fragments that were well conserved or only moderately transformed, and some of the salamanders were found in shade coffee plantations. The potential distribution area of both species is markedly fragmented and we estimate that it has decreased by more than 48%. The results of this study highlight the importance of carrying out exhaustive, systematic field surveys to obtain accurate information about the current situation of critically endangered species, and help us better understand the crisis that amphibians are facing worldwide.

  10. The Marble Experiment: Overview and Simulations

    NASA Astrophysics Data System (ADS)

    Douglas, M. R.; Murphy, T. J.; Cobble, J. A.; Fincke, J. R.; Haines, B. M.; Hamilton, C. E.; Lee, M. N.; Oertel, J. A.; Olson, R. E.; Randolph, R. B.; Schmidt, D. W.; Shah, R. C.; Smidt, J. M.; Tregillis, I. L.

    2015-11-01

    The Marble ICF platform has recently been launched on both OMEGA and NIF with the goal to investigate the influence of heterogeneous mix on fusion burn. The unique separated reactant capsule design consists of an ``engineered'' CH capsule filled with deuterated plastic foam that contains pores or voids that are filled with tritium gas. Initially the deuterium and tritium are separated, but as the implosion proceeds, the D and T mix, producing a DT signature. The results of these experiments will be used to inform a probability density function (PDF) burn modelling approach for un-resolved cell morphology. Initial targets for platform development have consisted of either fine-pore foams or gas mixtures, with the goal to field the engineered foams in 2016. An overview of the Marble experimental campaign will be presented and simulations will be discussed. This work is supported by US DOE/NNSA, performed at LANL, operated by LANS LLC under contract DE-AC52-06NA25396.

  11. Crystalline marble beats limestone for fluegas desulfurization

    SciTech Connect

    1996-05-01

    NovaCon Energy Systems, Inc. (Bedford, NY) has developed an alternative to conventional limestone sorbents. The new process uses a class of marble, selected with a proprietary model. Recent pilot- and full-scale demonstrations in pulverized-coal (PC) and circulating fluidized bed (CFB) boilers suggest that these patented sorbents outperform conventional limestone for the simultaneous control of SOx, NOx, and particulates during the combustion of coal and sulfur-rich fuels, such as oil, mixed municipal waste and used tires. Dubbed thermally active marbles (TAMs), these sorbents are chemically identical to grainy limestone (whose main constituent is calcium carbonate or calcite). However, thanks to the increased pressures and temperatures experienced during their geologic history, these metamorphic minerals have a regular crystalline structure that offers some advantages in the combustion zone. TAMs, on the other hand, enjoy better calcium-utilization rates because upon heating, they cleave along inter- and intra-crystalline faces, continuously exposing fresh surfaces. By minimizing the self-extinguishment suffered by limestone sorbents, TAMs are effective over operating temperatures from 1,200 F to 2,800 F, which is 400 F higher than other calcium-based sorbents. This allows them to be injected closer to the burner or combustion grate to maximize residence time in the unit.

  12. Candidate gene analysis of thyroid hormone receptors in metamorphosing vs. nonmetamorphosing salamanders.

    PubMed

    Voss, S R; Shaffer, H B; Taylor, J; Safi, R; Laudet, V

    2000-08-01

    We used two different experimental approaches to test the hypothesis that thyroid hormone receptor (TR) variation is associated with alternate life cycles modes in ambystomatid salamanders. In the first experiment, the inheritance of TRalpha and TRbeta genotypes was determined for metamorphic and non metamorphic offspring from backcrosses between Ambystoma mexicanum (an obligate metamorphic-failure species) and metamorphic F1 hybrids (A. mexicanum x A. tigrinum tigrinum). The segregation of TR genotype was independent of the expression of life cycle mode phenotype, and neither TR locus was linked to DNA markers that flank a major-effect locus for life cycle mode. In the second experiment, a portion of the ligand-binding domain of TRalpha and TRbeta was cloned and sequenced for DNA samples from 14 different ambystomatid salamander populations, including obligate metamorphic, facultative metamorphic, and obligate metamorphic-failure taxa. Nucleotide sequence variation was found for both TRalpha and TRbeta, with several nonsynonomous substitutions that presumably code for nonconservative amino acid replacements. However, no general relationship was found between TR allelic variation and life cycle mode among populations or species. These data do not implicate TRs as candidate loci involved in the current maintenance or past evolution of alternate life cycle modes in members of the tiger salamander complex.

  13. Sex in unisexual salamanders: discovery of a new sperm donor with ancient affinities.

    PubMed

    Bogart, J P; Bartoszek, J; Noble, D W A; Bi, K

    2009-12-01

    Although bisexual reproduction has considerable evolutionary benefits, several all-female vertebrates exist. Unisexual salamanders in the genus Ambystoma are common around the Great Lakes region in eastern North America. They originated from a hybridization event that involved a female that shared a common ancestor with Ambystoma barbouri 2.4 to 3.9 million years ago but, unexpectedly, A. barbouri nuclear genomes were unknown in unisexuals. Unisexual salamanders steal sperm from donors of normally bisexual species, so their reproductive mode is described as kleptogenesis. Most known unisexuals are polyploid and they all possess at least one A. laterale genome. One or more other genomes are taken from sperm donors that may include A. jeffersonianum, A. laterale, A. texanum and A. tigrinum. We examined unisexual adults and larvae in a southern Ohio pond where unisexual individuals coexist with male A. barbouri. This population provided an opportunity to test hypotheses pertaining to the role of A. barbouri in the evolution of the disparate cytoplasmic and nuclear genomes in unisexual salamanders. Microsatellite DNA loci, mitochondrial DNA sequences and genomic in situ hybridization were used to identify the genomic constitution of individuals. A. barbouri was found to be an acceptable sperm donor for unisexuals but only contributed genomes in ploidy-elevated individuals. In the absence of A. jeffersonianum, this Ohio population is likely experiencing a recent switch in sperm donors from A. jeffersonianum to A. barbouri and demonstrates the evolutionary flexibility and dynamics of kleptogenesis.

  14. Bromeliad selection by two salamander species in a harsh environment.

    PubMed

    Ruano-Fajardo, Gustavo; Rovito, Sean M; Ladle, Richard J

    2014-01-01

    Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment.

  15. Bromeliad Selection by Two Salamander Species in a Harsh Environment

    PubMed Central

    Ruano-Fajardo, Gustavo; Rovito, Sean M.; Ladle, Richard J.

    2014-01-01

    Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment. PMID:24892414

  16. Transcriptome analysis of the endangered Chinese giant salamander (Andrias davidianus): Immune modulation in response to Aeromonas hydrophila infection.

    PubMed

    Qi, Zhitao; Zhang, Qihuan; Wang, Zisheng; Ma, Tianyi; Zhou, Jie; Holland, Jason W; Gao, Qian

    2016-01-01

    The endangered Chinese giant salamander (Andrias davidianus) is the largest extant amphibian species. Disease outbreaks represent one of the major factors threatening A. davidianus populations in the wild and the viability of artificial breeding programmes. Development of future immune therapies to eliminate infectious disease in A. davidianus is dependent on a thorough understanding of the immune mechanisms elicited by pathogen encounters. To this end we have undertaken, for the first time in amphibians, differential transcriptome analysis of the giant salamander response to Aeromonas hydrophila, one of the most devastating pathogens affecting amphibian populations. Out of 87,204 non-redundant consensus unigenes 19,216 were annotated, 6834 of which were upregulated and 906 down-regulated following bacterial infection. 2058 unigenes were involved with immune system processes, including 287 differentially expressed unigenes indicative of the impact of bacterial infection on several innate and adaptive immune pathways in the giant salamander. Other pathways not directly associated with immune-related activity were differentially expressed, including developmental, structural, molecular and growth processes. Overall, this work provides valuable insights into the underlying immune mechanisms elicited during bacterial infection in amphibians that may aid in the future development of disease control measures in protecting the Chinese giant salamander. With the unique position of amphibians in the transition of tetrapods from aquatic to terrestrial habitats, our study will also be invaluable towards the further understanding of the evolution of tetrapod immunity.

  17. Evidence for multiple Pleistocene refugia in the postglacial expansion of the eastern tiger salamander, Ambystoma tigrinum tigrinum.

    PubMed

    Church, Sheri A; Kraus, Johanna M; Mitchell, Joseph C; Church, Don R; Taylor, Douglas R

    2003-02-01

    Pleistocene glaciations were important determinants of historical migration and, hence, current levels of genetic diversity within and among populations. In many cases, these historical migrations led to the existence of disjunct populations of plants and animals. However, the origin and timing of arrival of these disjunct populations is often debated. In the current study, we identify potential refugia and estimate the timing of vicariance events of the eastern tiger salamander, Ambystoma tigrinum tigrinum, using mitochondrial sequence data. The results suggest a vicariant event 0.75-2 million years ago, separating the tiger salamanders to the east and west of the Apalachicola River Basin. East of the Appalachians, there appear to be multiple independent refugia with little migration among the remaining populations. In particular, populations along the Atlantic Coastal Plain were likely isolated in a coastal plain refugium in the Carolinas. Migrants from this refugium were the likely source of colonists for populations occupying previously glaciated areas along the northeastern Atlantic Coast. A second potential refugium occurs in the Blue Ridge Mountains of western Virginia. This refugium contains a disjunct population of the eastern tiger salamander, as well as a community of nearly 70 other disjunct plant and animal species. The tiger salamanders here have been isolated from other populations for 200,000-500,000 years. These results suggest that disjunct mountain populations of Coastal Plain species may have existed in situ throughout the Pleistocene in Appalachian refugia. Therefore, these disjunct populations are not of recent origin, but rather exist as relicts of a warmer, more widespread fauna and flora that is now restricted to the Coastal Plain.

  18. Escape to Alcatraz: evolutionary history of slender salamanders (Batrachoseps) on the islands of San Francisco Bay

    PubMed Central

    Martínez-Solano, Iñigo; Lawson, Robin

    2009-01-01

    Background Island populations are excellent model systems for studies of phenotypic, ecological and molecular evolution. In this study, molecular markers of mitochondrial and nuclear derivation were used to investigate the evolution, structure and origin of populations of the California slender salamander (Batrachoseps attenuatus) inhabiting the six major islands of San Francisco Bay, formed following the rising of sea level around 9,000 years ago. Results There was a high degree of congruence in the results of analyses of nucleotide and allozyme data, both of which strongly support the hypothesis that, for the majority of the islands, salamanders are descended from hilltop populations that became isolated with the formation of the Bay ca. 9,000 years ago. There are two exceptions (Alcatraz and Yerba Buena) where the evidence suggests that salamander populations are wholly or in part, the result of anthropogenic introductions. Comparison of the molecular data and the interpretations drawn therefrom with an earlier morphological study of many of the same salamander populations show some of the same evolutionary trends. Conclusion In spite of marked differences between the evolutionary rates of the two kinds of molecular markers, both indicate distinctive and similar patterns of population structure for B. attenuatus in the San Francisco Bay Area and its islands. With the two noted exceptions, it is clear that most island populations were established prior to the 9,000 years since the formation of the Bay. Results of coalescence-based analyses suggest that for most island populations the mtDNA lineages from which they were derived date from the Pleistocene. It can be said that, based on observed values of genetic diversity, the last 9,000 years of evolution on these islands have been characterized by relative stability, with the occasional extinction of some haplotypes or alleles that were formerly shared between island and mainland populations but overall

  19. The Puzzle of a Marble in a Spinning Pipe

    DTIC Science & Technology

    2015-05-01

    MAY 2015 2. REPORT TYPE 3. DATES COVERED 00-00-2015 to 00-00-2015 4. TITLE AND SUBTITLE The Puzzle of a Marble in a Spinning Pipe 5a. CONTRACT...Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT What trajectory does a marble follow if it is held...298 (Rev. 8-98) Prescribed by ANSI Std Z39-18 Physics Education 50 (3) 279 1. Problem statement A marble is placed one-third of the length along a

  20. Blue Marble: Remote Characterization of Habitable Planets

    NASA Technical Reports Server (NTRS)

    Woolf, Neville; Lewis, Brian; Chartres, James; Genova, Anthony

    2009-01-01

    The study of the nature and distribution of habitable environments beyond the Solar System is a key area for Astrobiology research. At the present time, our Earth is the only habitable planet that can be characterized in the same way that we might characterize planets beyond the Solar System. Due to limitations in our current and near-future technology, it is likely that extra-solar planets will be observed as single-pixel objects. To understand this data, we must develop skills in analyzing and interpreting the radiation obtained from a single pixel. These skills must include the study of the time variation of the radiation, and the range of its photometric, spectroscopic and polarimetric properties. In addition, to understand whether we are properly analyzing the single pixel data, we need to compare it with a ground truth of modest resolution images in key spectral bands. This paper discusses the concept for a mission called Blue Marble that would obtain data of the Earth using a combination of spectropolarimetry, spectrophotometry, and selected band imaging. To obtain imagery of the proper resolution, it is desirable to place the Blue Marble spacecraft no closer than the outer region of cis-lunar space. This paper explores a conceptual mission design that takes advantage of low-cost launchers, bus designs and mission elements to provide a cost effective observing platform located at one of the stable Earth-moon Lagrangian points (L4, L5). The mission design allows for the development and use of novel technologies, such as a spinning moon sensor for attitude control, and leverages lessons-learned from previous low-cost spacecraft such as Lunar Prospector to yield a low-risk mission concept.

  1. Expression of calcium transporters in the retina of the tiger salamander (Ambystoma tigrinum).

    PubMed

    Krizaj, David; Liu, Xiaorong; Copenhagen, David R

    2004-08-02

    Changes in intracellular calcium concentration, [Ca2+]i, modulate the flow of visual signals across all stages of processing in the retina, yet the identities of Ca2+ transporters responsible for these changes are still largely unknown. In the current study, the distribution of plasma membrane and intracellular Ca2+ transporters in the retina of tiger salamander, a model system for physiological studies of retinal function, was determined. Plasma membrane calcium ATPases (PMCAs), responsible for high-affinity Ca2+ extrusion, were highly expressed in the salamander retina. PMCA isoforms 1, 2, and 4 were localized to photoreceptors, whereas the inner retina expressed all four isoforms. PMCA3 was expressed in a sparse population of amacrine and ganglion neurons, whereas PMCA2 was expressed in most amacrine and ganglion cells. Na+/Ca2+ exchangers, a high-capacity Ca2+ extrusion system, were expressed in the outer plexiform layer and in a subset of inner nuclear and ganglion layer cells. Intracellular Ca2+ store transporters were also represented prominently. SERCA2a, a splice variant of the sarcoplasmic-endoplasmic Ca2+ ATPase, was found mostly in photoreceptors, whereas SERCA2b was found in the majority of retinal neurons and in glial cells. The predominant endoplasmic reticulum (ER) Ca2+ channels in the salamander retina are represented by the isoform 2 of the IP3 receptor family and the isoform 2 of the ryanodine receptor family. These results indicate that Ca2+ transporters in the salamander retina are expressed in a cell type-specific manner.

  2. Acute toxicity of some hydrazine compounds to salamander larvae, Ambystoma spp

    SciTech Connect

    Slonim, A.R.

    1986-11-01

    Although hydrazine compounds have been used extensively by industry for a very long time, they have become important in recent years as propellants for aerospace operations. The study of hydrazine compounds in this laboratory began about two decades ago and developed into a large pharmacological and toxicological research program that included also environmental considerations. Subsequently, acute toxicity studies were conducted on the common guppy (Lebistes reticulatus Peters) using four hydrazine compounds of interest. The toxicity of these propellants were evaluated next on other species of aquatic organisms such as mosquito fish (Gambusia affinis) and amphibians. Two different studies were conducted on amphibians: One utilized amphibian eggs and the other amphibian larvae. The larvae of spotted and marbled salamanders (Ambystoma maculatum and A. opacum, respectively) were used primarily in numerous static bioassays to determine the acute toxicity of hydrazine, UDMH and Aerozine-50 on these organisms. The remaining larvae were used in other tests mainly to corroborate previous experimental results (e.g., to see whether toxicity is affected by organism size, aeration of test solutions, and water hardness). The results on the larvae are presented in this paper.

  3. Effects of Red-Backed Salamanders on Ecosystem Functions

    PubMed Central

    Hocking, Daniel J.; Babbitt, Kimberly J.

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m2 plots) and small-scale enclosures (2 m2) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m−2). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types. PMID:24466269

  4. Effects of red-backed salamanders on ecosystem functions.

    PubMed

    Hocking, Daniel J; Babbitt, Kimberly J

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m(2) plots) and small-scale enclosures (2 m(2)) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m(-2)). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types.

  5. The impact of recreational boat traffic on Marbled Murrelets (Brachyramphus marmoratus).

    PubMed

    Bellefleur, Danielle; Lee, Philip; Ronconi, Robert A

    2009-01-01

    This study evaluated the impact of small boat traffic on reaction distances of Marbled Murrelets (Brachyramphus marmoratus), in the marine waters of Pacific Rim National Park Reserve, British Columbia, Canada. Observers on moving boats recorded the minimum distance the boat came to murrelets on the water, and any disturbance reaction (fly, dive, no reaction). Out of the 7500 interactions 11.7% flew, 30.8% dove and 58.1% exhibited no flushing reaction. Using a product-limit analysis, we developed curves for the proportion of Marbled Murrelets flushing (dive or flight) as a function of reaction distance. Overall, the majority of Marbled Murrelets waited until boats were within 40 m before reacting, with 25% of the population reacting at 29.2m. A stepwise Cox regression indicated that age, boat speed, and boat density (loaded in that order), significantly affected flushing response. More juveniles flushed than adults (70.1 versus 51.7%), but at closer distances. Faster boats caused a greater proportion of birds to flush, and at further distances (25% of birds flushed at 40 m at speeds > 29 kph versus 28m at speeds <12kph). A stepwise logistic regression on diving and flight responses indicated that birds tended to fly completely out of feeding areas at the approach of boats travelling >28.8 kph and later in the season (July and August). Other secondary variables included; boat density and time of day. Discussion focused on possible management actions such as the application of speed limits, set back distances, and exclusion of boat traffic to protect Marbled Murrelets.

  6. FLAT MARBLE MARKER WITH CONCRETE COLLAR – JOHN C. DURBIN ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    FLAT MARBLE MARKER WITH CONCRETE COLLAR – JOHN C. DURBIN (ONLY CONFEDERATE BURIAL IN CEMETERY) IN SECTION 1. VIEW TO EAST. - Danville National Cemetery, 1900 East Main Street, Danville, Vermilion County, IL

  7. Women's toilet with marble stalls and wooden doors, east end ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Women's toilet with marble stalls and wooden doors, east end of first floor. View to southwest. - San Bernardino Valley College, Life Science Building, 701 South Mount Vernon Avenue, San Bernardino, San Bernardino County, CA

  8. Interior view of shower room 216 with original marble surround ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Interior view of shower room 2-16 with original marble surround and double sash windows, facing east. - Marine Barracks, Panama Canal, Barracks Building, 100' North of Thatcher Highway, Balboa, Former Panama Canal Zone, CZ

  9. 35. SECOND FLOOR, SOUTHEAST ROOM, NORTH WALL: BLACK MARBLE MANTLE. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    35. SECOND FLOOR, SOUTHEAST ROOM, NORTH WALL: BLACK MARBLE MANTLE. Grape clusters above columns repeat in upper part of cornice and probably in destroyed ceiling centerpiece - Governor Thomas Bennett House, 1 Lucas Street, Charleston, Charleston County, SC

  10. Convergent evolutionary reduction of atrial septation in lungless salamanders.

    PubMed

    Lewis, Zachary R; Hanken, James

    2017-01-01

    Nearly two thirds of the approximately 700 species of living salamanders are lungless. These species respire entirely through the skin and buccopharyngeal mucosa. Lung loss dramatically impacts the configuration of the circulatory system but the effects of evolutionary lung loss on cardiac morphology have long been controversial. For example, there is presumably little need for an atrial septum in lungless salamanders due to the absence of pulmonary veins and the presence of a single source of mixed blood flowing into the heart, but whether lungless salamanders possess an atrial septum and whether the sinoatrial aperture is located in the left or right atrium are unresolved; authors have stated opposing claims since the late 1800s. Here, we use micro-computed tomography (μ-CT) imaging, gross dissection and histological reconstruction to compare cardiac morphology among lungless plethodontid salamanders (Plethodontidae), salamanders with lungs, and the convergently lungless species Onychodactylus japonicus (Hynobiidae). Plethodontid salamanders have partial atrial septa and incomplete separation of the atrium into left and right halves. Partial septation is also seen in O. japonicus. Hence, lungless salamanders from two lineages convergently evolved similar morphology of the atrial septum. The partial septum in lungless salamanders can make it appear that the sinoatrial aperture is in the left atrium, but this interpretation is incorrect. Outgroup comparisons demonstrate that the aperture is located in a posterodorsal extension of the right atrium into the left side of the heart. Independent evolutionary losses of the atrial septum may have a similar developmental basis. In mammals, the lungs induce formation of the atrial septum by secreting morphogens to neighboring mesenchyme. We hypothesize that the lungs induce atrial septum development in amphibians in a similar fashion to mammals, and that atrial septum reduction in lungless salamanders is a direct result

  11. Salamander chytrid fungus (Batrachochytrium salamandrivorans) in the United States—Developing research, monitoring, and management strategies

    USGS Publications Warehouse

    Grant, Evan H. Campbell; Muths, Erin L.; Katz, Rachel A.; Canessa, Stefano; Adams, Michael J.; Ballard, Jennifer R.; Berger, Lee; Briggs, Cheryl J.; Coleman, Jeremy; Gray, Matthew J.; Harris, M. Camille; Harris, Reid N.; Hossack, Blake R.; Huyvaert, Kathryn P.; Kolby, Jonathan E.; Lips, Karen R.; Lovich, Robert E.; McCallum, Hamish I.; Mendelson, Joseph R.; Nanjappa, Priya; Olson, Deanna H.; Powers, Jenny G.; Richgels, Katherine L.D.; Russell, Robin E.; Schmidt, Benedikt R.; Spitzen-van der Sluijs, Annemarieka; Watry, Mary Kay; Woodhams, Douglas C.; White, C. LeAnn

    2016-01-20

    The recently (2013) identified pathogenic chytrid fungus, Batrachochytrium salamandrivorans (Bsal), poses a severe threat to the distribution and abundance of salamanders within the United States and Europe. Development of a response strategy for the potential, and likely, invasion of Bsal into the United States is crucial to protect global salamander biodiversity. A formal working group, led by Amphibian Research and Monitoring Initiative (ARMI) scientists from the U.S. Geological Survey (USGS) Patuxent Wildlife Research Center, Fort Collins Science Center, and Forest and Rangeland Ecosystem Science Center, was held at the USGS Powell Center for Analysis and Synthesis in Fort Collins, Colorado, United States from June 23 to June 25, 2015, to identify crucial Bsal research and monitoring needs that could inform conservation and management strategies for salamanders in the United States. Key findings of the workshop included the following: (1) the introduction of Bsal into the United States is highly probable, if not inevitable, thus requiring development of immediate short-term and long-term intervention strategies to prevent Bsal establishment and biodiversity decline; (2) management actions targeted towards pathogen containment may be ineffective in reducing the long-term spread of Bsal throughout the United States; and (3) early detection of Bsal through surveillance at key amphibian import locations, among high-risk wild populations, and through analysis of archived samples is necessary for developing management responses. Top research priorities during the preinvasion stage included the following: (1) deployment of qualified diagnostic methods for Bsal and establishment of standardized laboratory practices, (2) assessment of susceptibility for amphibian hosts (including anurans), and (3) development and evaluation of short- and long-term pathogen intervention and management strategies. Several outcomes were achieved during the workshop, including development

  12. Toxicity and immune system effects of dietary deltamethrin exposure in tiger salamanders (Ambystoma tigrinum).

    PubMed

    Froese, Jennifer M W; Smits, Judit E G; Forsyth, Douglas J; Wickstrom, Mark L

    2009-01-01

    One theory proposed to explain the global declines in amphibian populations involves contaminant-induced immune alteration and subsequent increased susceptibility to infectious disease. The goal of this study was twofold, to (1) study acute oral toxicity of deltamethrin (cyclopropanecarboxylic acid, 3-(2,2-dibromoethenyl)-2,2-dimethyl cyano(3-phenoxyphenyl)methyl ester) in tiger salamanders (Ambystoma tigrinum), and (2) evaluate whether the insecticide deltamethrin produces immunosuppression in these animals. In the acute toxicity study, tiger salamanders receiving single doses of deltamethrin ranging from 1 to 35 mg/kg displayed intention tremors, hypersalivation, ataxia, choreoathetosis (writhing), severe depression (immobility with minimal response to stimuli), and death. For acute effects, based on clinical signs, the median lethal dose (LD(50)) and lowest observed adverse effect level (LOAEL) were estimated to be 5 to 10 mg/kg and 1 mg/kg, respectively. The LOAEL in animals dosed 3 times per week for 4 wk was 400 microg/kg/d. The endpoints for the immunotoxicity study included lymphoid organ mass and histopathology, hematological variables, and functional assays of phagocytosis, oxidative burst, and lymphoblastic transformation. Tiger salamanders in 4 treatment groups (0, 4, 40, or 400 microg/kg/d) were dosed with deltamethrin via the diet 3 times per week for 4 wk. Deltamethrin exposure resulted in increased liver mass, packed cell volume, and total plasma protein concentration, but these effects were not dose dependent. The relative mass of kidney and spleen, plasma albumin and globulin concentrations, and circulating leukocyte numbers were not affected by deltamethrin exposure, nor were phagocytosis, oxidative burst, and lymphoblastic transformation. This study shows that at moderate levels of exposure, deltamethrin may be neurotoxic to tiger salamanders. However, based on the immune assays considered in this study there was no evidence of immunosuppression

  13. Locomotion and visually guided behavior in salamander: a neuromechanical study

    NASA Astrophysics Data System (ADS)

    Ijspeert, Auke J.; Arbib, Michael A.

    2000-10-01

    This article investigates the neural mechanisms underlying locomotion and visually-guided behavior in a lower vertebrate: the salamander. We develop connectionist models of the salamander's locomotor circuitry and visual system, and analyze their functioning by embedding them into a biomechanical simulation of the salamander's body. This work is therefore an experiment in computational neuroethology which aims at investigating how behavior results from the coupling of a central nervous system (CNS) and a body, and from the interactions of the CNS-body pair with the environment. We believe that understanding these mechanisms is not only relevant for neurobiology but also for potential applications in robotics.

  14. Could we also be regenerative superheroes, like salamanders?

    PubMed

    Dall'Agnese, Alessandra; Puri, Pier Lorenzo

    2016-09-01

    Development of methods to reawaken the semi-dormant regenerative potential that lies within adult human tissues would hold promise for the restoration of diseased or damaged organs and tissues. While most of the regeneration potential is suppressed in many vertebrates, including humans, during adult life, urodele amphibians (salamanders) retain their regenerative ability throughout adulthood. Studies in newts and axolotls, two salamander models, have provided significant knowledge about adult limb regeneration. In this review, we present a comparative analysis of salamander and mammalian regeneration and discuss how evolutionarily altered properties of the regenerative environment can be exploited to restore full regenerative potential in the human body.

  15. Generation of aneurogenic larvae by parabiosis of salamander embryos.

    PubMed

    Kumar, Anoop; Delgado, Jean Paul

    2015-01-01

    Limb regeneration of salamanders is nerve dependent, and the removal of the nerves in early stages of limb regeneration severely curtails the proliferation of the blastemal cells and growth of the regenerate. The removal of the neural tube from a developing salamander embryo results in an aneurogenic larva and the aneurogenic limb (ANL) develops independently without innervation. Paradoxically, the limb in an ANL is capable of regeneration in a nerve-independent manner. Here, we describe a detailed method for the generation of ANL in the spotted salamander, Ambystoma maculatum, for regeneration studies.

  16. The Marble Types of Thassos Island through the Ages

    NASA Astrophysics Data System (ADS)

    Laskaridis, Kostas; Patronis, Michael; Papatrechas, Christos; Schouenborg, Björn

    2013-04-01

    The first references to the "white whole-grain" marble of Thassos Island, Greece, date back to the 6th century BC when stones were quarried at Alyki peninsula and at Fanari and Vathy capes. Since that time, Thassos marble was exported to Samothraki and other neighbouring islands, Asia Minor coastal cities, Southern Greece and Rome. In ancient times, there were two principal types of marble quarries in Thassos: (a) those producing material for the construction of temples and for the creation of various art pieces, i.e. ornamental stones, and (b) those for extraction of rough blocks for export. This paper aims at describing the Thassos marble, the geological setting in brief, its historic use and future supply possibilities and other reasons why it is a time-enduring ornamental stone. The aesthetical characteristics and the physical mechanical properties of its two main types (i.e. calcitic and dolomitic) are described and evaluated. The relevant results justify the wide application range and the continuous use of Thassos marble from ancient to present times and confirm the ability of this stone to survive over time. Keywords: Thassos, Marble, Ornamental Stones, Physical Mechanical Properties, Historic use

  17. Sexual dimorphism and age of Mediterranean salamanders.

    PubMed

    Reinhard, Sandy; Renner, Sandra; Kupfer, Alexander

    2015-02-01

    We analysed sexual size dimorphism (SSD) for two Mediterranean species of the "true" salamander clade possessing distinct life histories (Salamandra algira and Mertensiella caucasica) and equilibrated the morphometric approach to individual age by using skeletochronology. For species that have a short breeding season and live at high altitudes, such as Mediterranean amphibians, the fecundity advantage hypothesis predicts female-biased SSD to maximise reproductive success. Our results showed no SSD in either species; however, morphometric data indicated a male-biased dimorphism in limb (arm and leg) dimensions in both species when compared to body size. Limb dimorphisms are likely related to the particular mating system, which involves an amplexus during spermatophore transfer. Arm length appeared sexually dimorphic during ontogeny both in viviparous S. algira and oviparous M. caucasica. A review on SSD indicated monomorphy of body size as a common lineage-specific pattern among the "true" salamander clade, but also the common presence of other traits such as sexually dimorphic limb proportions.

  18. Defining evolutionary boundaries across parapatric ecomorphs of Black Salamanders (Aneides flavipunctatus) with conservation implications.

    PubMed

    Reilly, Sean B; Marks, Sharyn B; Jennings, W Bryan

    2012-12-01

    The accurate delimitation of evolutionary population units represents an important component in phylogeographic and conservation genetic studies. Here, we used a combined population assignment and historical demographic approach to study a complex of ecomorphologically distinctive populations of Black Salamanders (Aneides flavipunctatus) that are parapatrically distributed and meet at a three-way contact zone in north-western California. We used mitochondrial tree-based and multilocus clustering methods to evaluate a priori two- (Northern and Southern) and three (Northern, Coast and Inland) population hypotheses derived from previous studies. Mitochondrial results were consistent with the two- and three-population hypotheses, while the nDNA clustering results supported only the two-population hypothesis. Historical demographic analyses and mtDNA gene divergence estimates revealed that the Northern and Southern populations split during the Pliocene (2-5 Ma). Subdivision of the Southern population into Coast and Inland populations was estimated to be late Pleistocene (0.24 Ma), although our mtDNA results suggested a Pliocene divergence. Effective gene flow estimates (2N(e)m) suggest that either the two- or three-population hypotheses remain valid. However, our results unexpectedly revealed that the Northern population might instead represent two parapatric populations that separated nearly 4 Ma. These results are surprising because the Pliocene divergence between these ecomorphologically conservative forms is similar or older than for the ecomorphologically divergent Coast and Inland sister populations. We conclude that Black Salamanders in north-western California belong to at least three or four populations or species, and these all meet criteria for being Evolutionary Significant Units or 'ESUs' and therefore warrant conservation consideration.

  19. Status Review of the Marbled Murrelet (Brachyramphus marmoratus) in Alaska and British Columbia

    USGS Publications Warehouse

    Piatt, J.F.; Kuletz, K.J.; Burger, A.E.; Hatch, Shyla A.; Friesen, V.L.; Birt, T.P.; Arimitsu, M.L.; Drew, G.S.; Harding, A.M.A.; Bixler, K.S.

    2007-01-01

    The Marbled Murrelet (Brachyramphus marmoratus) is a small, diving seabird inhabiting inshore waters of the Northeastern Pacific Ocean. This species feeds on small, schooling fishes and zooplankton, and nests primarily on the moss-covered branches of large, old-growth conifers, and also, in some parts of its range, on the ground. We reviewed existing information on this species to evaluate its current status in the northern part of its range-Alaska (U.S.) and British Columbia (Canada). Within the southern part of its range (Washington, Oregon, and California, U.S.), the Marbled Murrelet was listed as a threatened species under the Endangered Species Act (ESA) in 1993, and the U.S. Fish and Wildlife Service (USFWS) needed information on the species throughout its range for ESA deliberations. We compiled published information on the conservation status, population biology, foraging ecology, population genetics, population status and trends, demography, marine and nesting habitat characteristics, threats, and ongoing conservation efforts for Marbled Murrelets in Alaska and British Columbia. We conducted a new genetic study using samples from a segment of the range that had not been included in previous studies (Washington, Oregon) and additional nuclear intron and microsatellite markers. We also analyzed available at-sea survey data from several locations for trend. To understand the reasonableness of the empirical trend data, we developed demographic models incorporating stochasticity to discern what population trends were possible by chance. The genetic studies substantially confirmed previous findings on population structure in the Marbled Murrelet. Our present work finds three populations: (1) one comprising birds in the central and western Aleutian Islands; (2) one comprising birds in central California; and (3) one comprising birds within the center of the range from the eastern Aleutians to northern California. Our knowledge of genetic structure within this

  20. Reduced effects of thyroid hormone on gene expression and metamorphosis in a paedomorphic plethodontid salamander.

    PubMed

    Aran, Robert P; Steffen, Michael A; Martin, Samuel D; Lopez, Olivia I; Bonett, Ronald M

    2014-07-01

    It has been over a century since Gudernatsch (1912, Wilhelm Roux Arch Entwickl Mech Org 35:457-483) demonstrated that mammalian thyroid gland extracts can stimulate tadpole metamorphosis. Despite the tremendous developmental diversity of amphibians, mechanisms of metamorphosis have mostly been studied in a few model systems. This limits our understanding of the processes that influence the evolution of developmental aberrations. Here we isolated thyroid hormone receptors alpha (TRα) and beta (TRβ) from Oklahoma salamanders (Eurycea tynerensis), which exhibit permanently aquatic (paedomorphic) or biphasic (metamorphic) developmental modes in different populations. We found that TRα and TRβ were upregulated by thyroid hormone (T3 ) in tail tissues of larvae from metamorphic populations, but basal levels of TR expression and T3 responsiveness were reduced in larvae from paedomorphic populations. Likewise, we found that T3 treatment resulted in complete loss of larval epibranchials in larvae from metamorphic populations, but little to no epibranchial remodeling occurred in larvae from paedomorphic populations over the same duration. This is the first study to directly demonstrate reduced gene expression and metamorphic responses to T3 in a paedomorphic plethodontid compared to metamorphic conspecifics, and the first salamander system to show differential expression of thyroid hormone receptors associated with alternative developmental patterns.

  1. Salamander-like development in a seymouriamorph revealed by palaeohistology.

    PubMed

    Sanchez, Sophie; Klembara, Jozef; Castanet, Jacques; Steyer, J Sébastien

    2008-08-23

    The amniotes generally lay eggs on land and are thereby differentiated from lissamphibians (salamanders, frogs and caecilians) by their developmental pattern. Although a number of 330-300-Myr old fossils are regarded as early tetrapods placed close to amniotes on the basis of anatomical data, we still do not know whether their developmental pattern was more similar to those of lissamphibians or amniotes. Here we report palaeohistological and skeletochronological evidence supporting a salamander-like development in the seymouriamorph Discosauriscus. Its long-bone growth pattern, slow diaphyseal growth rate and delayed sexual maturity (at more than 10 years old) are more comparable with growth features of extant salamanders rather than extant amniotes, even though they are mostly hypothesized to be phylogenetically closer to living amniotes than salamanders.

  2. Maintaining plethodontid salamanders in the laboratory for regeneration studies.

    PubMed

    Arenas, Claudia Marcela; Gómez-Molina, Andrea; Delgado, Jean Paul

    2015-01-01

    Limb regeneration studies have been extensively carried out in species of Ambystomatidae and Salamandridae families. So far limited research has been conducted in species belonging to the Plethodontidae family, where some of the species differs from other salamander families due to their direct development, thus absence of a larval life. Here, we describe a protocol to maintain the plethodontid salamanders of genus Bolitoglossa species under laboratory conditions to perform regeneration studies.

  3. Life history plasticity does not confer resilience to environmental change in the mole salamander (Ambystoma talpoideum)

    USGS Publications Warehouse

    Courtney L. Davis,; David A.W. Miller,; Walls, Susan; Barichivich, William J.; Riley, Jeffrey W.; Brown, Mary E.

    2017-01-01

    Plasticity in life history strategies can be advantageous for species that occupy spatially or temporally variable environments. We examined how phenotypic plasticity influences responses of the mole salamander, Ambystoma talpoideum, to disturbance events at the St. Marks National Wildlife Refuge (SMNWR), FL, USA from 2009 to 2014. We observed periods of extensive drought early in the study, in contrast to high rainfall and expansive flooding events in later years. Flooding facilitated colonization of predatory fishes to isolated wetlands across the refuge. We employed multistate occupancy models to determine how this natural experiment influenced the occurrence of aquatic larvae and paedomorphic adults and what implications this may have for the population. We found that, in terms of occurrence, responses to environmental variation differed between larvae and paedomorphs, but plasticity (i.e. the ability to metamorphose rather than remain in aquatic environment) was not sufficient to buffer populations from declining as a result of environmental perturbations. Drought and fish presence negatively influenced occurrence dynamics of larval and paedomorphic mole salamanders and, consequently, contributed to observed short-term declines of this species. Overall occurrence of larval salamanders decreased from 0.611 in 2009 to 0.075 in 2014 and paedomorph occurrence decreased from 0.311 in 2009 to 0.121 in 2014. Although variation in selection pressures has likely maintained this polyphenism previously, our results suggest that continued changes in environmental variability and the persistence of fish in isolated wetlands could lead to a loss of paedomorphosis in the SMNWR population and, ultimately, impact regional persistence in the future.

  4. Life history plasticity does not confer resilience to environmental change in the mole salamander (Ambystoma talpoideum).

    PubMed

    Davis, Courtney L; Miller, David A W; Walls, Susan C; Barichivich, William J; Riley, Jeffrey; Brown, Mary E

    2017-03-01

    Plasticity in life history strategies can be advantageous for species that occupy spatially or temporally variable environments. We examined how phenotypic plasticity influences responses of the mole salamander, Ambystoma talpoideum, to disturbance events at the St. Marks National Wildlife Refuge (SMNWR), FL, USA from 2009 to 2014. We observed periods of extensive drought early in the study, in contrast to high rainfall and expansive flooding events in later years. Flooding facilitated colonization of predatory fishes to isolated wetlands across the refuge. We employed multistate occupancy models to determine how this natural experiment influenced the occurrence of aquatic larvae and paedomorphic adults and what implications this may have for the population. We found that, in terms of occurrence, responses to environmental variation differed between larvae and paedomorphs, but plasticity (i.e. the ability to metamorphose rather than remain in aquatic environment) was not sufficient to buffer populations from declining as a result of environmental perturbations. Drought and fish presence negatively influenced occurrence dynamics of larval and paedomorphic mole salamanders and, consequently, contributed to observed short-term declines of this species. Overall occurrence of larval salamanders decreased from 0.611 in 2009 to 0.075 in 2014 and paedomorph occurrence decreased from 0.311 in 2009 to 0.121 in 2014. Although variation in selection pressures has likely maintained this polyphenism previously, our results suggest that continued changes in environmental variability and the persistence of fish in isolated wetlands could lead to a loss of paedomorphosis in the SMNWR population and, ultimately, impact regional persistence in the future.

  5. Using stable isotopes to test for trophic niche partitioning: a case study with stream salamanders and fish

    USGS Publications Warehouse

    Sepulveda, Adam; Lowe, Winsor H.; Marra, Peter P.

    2012-01-01

    5. Although we did not identify mechanisms that facilitate salamander and fish coexistence, our empirical data and use of novel approaches to describe the trophic niche did yield important insights on the role of predator–prey interactions and cannibalism as alternative coexistence mechanisms. In addition, we found that 95% kernel estimators are a simple and robust method to describe population-level measure of trophic structure.

  6. Status Review of the Marbled Murrelet (Brachyramphus marmoratus) in Alaska and British Columbia

    DTIC Science & Technology

    2006-01-01

    Burger, University of Victoria, S.A. Hatch, U.S. Geological Survey, V.L. Friesen , Queen’s University, T.P. Birt, Queens University, M.L. Arimitsu, U.S...Kuletz, K.J., Burger, A.E., Hatch, S.A., Friesen , V.L., Birt, T.P. , Arimitsu, M.L., Drew, G.S., Harding, A.M.A., and K.S. Bixler, 2007, Status...British Columbia ........................................................189 Appendix E . Population Trends of the Marbled Murrelet Evident from At-Sea

  7. A portable detection instrument based on DSP for beef marbling

    NASA Astrophysics Data System (ADS)

    Zhou, Tong; Peng, Yankun

    2014-05-01

    Beef marbling is one of the most important indices to assess beef quality. Beef marbling is graded by the measurement of the fat distribution density in the rib-eye region. However quality grades of beef in most of the beef slaughtering houses and businesses depend on trainees using their visual senses or comparing the beef slice to the Chinese standard sample cards. Manual grading demands not only great labor but it also lacks objectivity and accuracy. Aiming at the necessity of beef slaughtering houses and businesses, a beef marbling detection instrument was designed. The instrument employs Charge-coupled Device (CCD) imaging techniques, digital image processing, Digital Signal Processor (DSP) control and processing techniques and Liquid Crystal Display (LCD) screen display techniques. The TMS320DM642 digital signal processor of Texas Instruments (TI) is the core that combines high-speed data processing capabilities and real-time processing features. All processes such as image acquisition, data transmission, image processing algorithms and display were implemented on this instrument for a quick, efficient, and non-invasive detection of beef marbling. Structure of the system, working principle, hardware and software are introduced in detail. The device is compact and easy to transport. The instrument can determine the grade of beef marbling reliably and correctly.

  8. Olfactory receptor gene expression in tiger salamander olfactory epithelium.

    PubMed

    Marchand, James E; Yang, Xinhai; Chikaraishi, Dona; Krieger, Jurgen; Breer, Heinz; Kauer, John S

    2004-06-28

    Physiological studies of odor-elicited responses from the olfactory epithelium and bulb in the tiger salamander, Ambystoma tigrinum, have elucidated a number of features of olfactory coding that appear to be conserved across several vertebrate species. This animal model has provided an accessible in vivo system for observing individual and ensemble olfactory responses to odorant stimulation using biochemical, neurophysiological, and behavioral assays. In this paper we have complemented these studies by characterizing 35 candidate odorant receptor genes. These receptor sequences are similar to those of the large families of olfactory receptors found in mammals and fish. In situ hybridization, using RNA probes to 20 of these sequences, demonstrates differential distributions of labeled cells across the extent and within the depth of the olfactory epithelium. The distributions of cells labeled with probes to different receptors show spatially restricted patterns that are generally localized to different degrees in medial-lateral and anterior-posterior directions. The patterns of receptor expression in the ventral olfactory epithelium (OE) are mirrored in the dorsal OE. We present a hypothesis as to how the sensory neuron populations expressing different receptor types responding to a particular odorant may relate to the distribution patterns of epithelial and bulbar responses previously characterized using single-unit and voltage-sensitive dye recording methods.

  9. Batrachochytrium salamandrivorans is the predominant chytrid fungus in Vietnamese salamanders

    PubMed Central

    Laking, Alexandra E.; Ngo, Hai Ngoc; Pasmans, Frank; Martel, An; Nguyen, Tao Thien

    2017-01-01

    The amphibian chytrid fungi, Batrachochytrium dendrobatidis (Bd) and B. salamandrivorans (Bsal), pose a major threat to amphibian biodiversity. Recent evidence suggests Southeast Asia as a potential cradle for both fungi, which likely resulted in widespread host-pathogen co-existence. We sampled 583 salamanders from 8 species across Vietnam in 55 locations for Bsal and Bd, determined scaled mass index as a proxy for fitness and collected environmental data. Bsal was found within 14 of the 55 habitats (2 of which it was detected in 2013), in 5 salamandrid species, with a prevalence of 2.92%. The globalized pandemic lineage of Bd was found within one pond on one species with a prevalence of 0.69%. Combined with a complete lack of correlation between infection and individual body condition and absence of indication of associated disease, this suggests low level pathogen endemism and Bsal and Bd co-existence with Vietnamese salamandrid populations. Bsal was more widespread than Bd, and occurs at temperatures higher than tolerated by the type strain, suggesting a wider thermal niche than currently known. Therefore, this study provides support for the hypothesis that these chytrid fungi may be endemic to Asia and that species within this region may act as a disease reservoir. PMID:28287614

  10. Using counts to simultaneously estimate abundance and detection probabilities in a salamander community

    USGS Publications Warehouse

    Dodd, C.K.; Dorazio, R.M.

    2004-01-01

    A critical variable in both ecological and conservation field studies is determining how many individuals of a species are present within a defined sampling area. Labor intensive techniques such as capture-mark-recapture and removal sampling may provide estimates of abundance, but there are many logistical constraints to their widespread application. Many studies on terrestrial and aquatic salamanders use counts as an index of abundance, assuming that detection remains constant while sampling. If this constancy is violated, determination of detection probabilities is critical to the accurate estimation of abundance. Recently, a model was developed that provides a statistical approach that allows abundance and detection to be estimated simultaneously from spatially and temporally replicated counts. We adapted this model to estimate these parameters for salamanders sampled over a six vear period in area-constrained plots in Great Smoky Mountains National Park. Estimates of salamander abundance varied among years, but annual changes in abundance did not vary uniformly among species. Except for one species, abundance estimates were not correlated with site covariates (elevation/soil and water pH, conductivity, air and water temperature). The uncertainty in the estimates was so large as to make correlations ineffectual in predicting which covariates might influence abundance. Detection probabilities also varied among species and sometimes among years for the six species examined. We found such a high degree of variation in our counts and in estimates of detection among species, sites, and years as to cast doubt upon the appropriateness of using count data to monitor population trends using a small number of area-constrained survey plots. Still, the model provided reasonable estimates of abundance that could make it useful in estimating population size from count surveys.

  11. Hellbender genome sequences shed light on genomic expansion at the base of crown salamanders.

    PubMed

    Sun, Cheng; Mueller, Rachel Lockridge

    2014-07-01

    Among animals, genome sizes range from 20 Mb to 130 Gb, with 380-fold variation across vertebrates. Most of the largest vertebrate genomes are found in salamanders, an amphibian clade of 660 species. Thus, salamanders are an important system for studying causes and consequences of genomic gigantism. Previously, we showed that plethodontid salamander genomes accumulate higher levels of long terminal repeat (LTR) retrotransposons than do other vertebrates, although the evolutionary origins of such sequences remained unexplored. We also showed that some salamanders in the family Plethodontidae have relatively slow rates of DNA loss through small insertions and deletions. Here, we present new data from Cryptobranchus alleganiensis, the hellbender. Cryptobranchus and Plethodontidae span the basal phylogenetic split within salamanders; thus, analyses incorporating these taxa can shed light on the genome of the ancestral crown salamander lineage, which underwent expansion. We show that high levels of LTR retrotransposons likely characterize all crown salamanders, suggesting that disproportionate expansion of this transposable element (TE) class contributed to genomic expansion. Phylogenetic and age distribution analyses of salamander LTR retrotransposons indicate that salamanders' high TE levels reflect persistence and diversification of ancestral TEs rather than horizontal transfer events. Finally, we show that relatively slow DNA loss rates through small indels likely characterize all crown salamanders, suggesting that a decreased DNA loss rate contributed to genomic expansion at the clade's base. Our identification of shared genomic features across phylogenetically distant salamanders is a first step toward identifying the evolutionary processes underlying accumulation and persistence of high levels of repetitive sequence in salamander genomes.

  12. Liquid marbles stabilized by charged polymer latexes: how does the drying of the latex particles affect the properties of liquid marbles?

    PubMed

    Sun, Guanqing; Sheng, Yifeng; Wu, Jie; Ma, Guanghui; Ngai, To

    2014-10-28

    The coating of solid particles on the surface of liquid in air makes liquid marbles a promising approach in the transportation of a small amount of liquid. The stabilization of liquid marbles by polymeric latex particles imparts extra triggers such as pH and temperature, leading to the remote manipulation of droplets for many potential applications. Because the functionalized polymeric latexes can exist either as colloidally stable latex or as flocculated latex in a dispersion, the drying of latex dispersions under different conditions may play a significant role in the stabilization of subsequent liquid marbles. This article presents the investigation of liquid marbles stabilized by poly(styrene-co-methacrylic acid) (PS-co-MAA) particles drying under varied conditions. Protonation of the particles before freeze drying makes the particles excellent liquid marble stabilizers, but it is hard to stabilize liquid marbles for particles dried in their deprotonated states. The static properties of liquid marbles with increasing concentrations of protonating reagent revealed that the liquid marbles are gradually undermined by protonating the stabilizers. Furthermore, the liquid marbles stabilized by different particles showed distinct behaviors in separation and merging manipulated by tweezers. This study shows that the initial state of the particles should be carefully taken into account in formulating liquid marbles.

  13. Landscape genetics of the blotched tiger salamander (Ambystoma tigrinum melanostictum).

    PubMed

    Spear, Stephen F; Peterson, Charles R; Matocq, Marjorie D; Storfer, Andrew

    2005-07-01

    The field of landscape genetics has great potential to identify habitat features that influence population genetic structure. To identify landscape correlates of genetic differentiation in a quantitative fashion, we developed a novel approach using geographical information systems analysis. We present data on blotched tiger salamanders (Ambystoma tigrinum melanostictum) from 10 sites across the northern range of Yellowstone National Park in Montana and Wyoming, USA. We used eight microsatellite loci to analyse population genetic structure. We tested whether landscape variables, including topographical distance, elevation, wetland likelihood, cover type and number of river and stream crossings, were correlated with genetic subdivision (F(ST)). We then compared five hypothetical dispersal routes with a straight-line distance model using two approaches: (i) partial Mantel tests using Akaike's information criterion scores to evaluate model robustness and (ii) the BIOENV procedure, which uses a Spearman rank correlation to determine the combination of environmental variables that best fits the genetic data. Overall, gene flow appears highly restricted among sites, with a global F(ST) of 0.24. While there is a significant isolation-by-distance pattern, incorporating landscape variables substantially improved the fit of the model (from an r2 of 0.3 to 0.8) explaining genetic differentiation. It appears that gene flow follows a straight-line topographic route, with river crossings and open shrub habitat correlated with lower F(ST) and thus, decreased differentiation, while distance and elevation difference appear to increase differentiation. This study demonstrates a general approach that can be used to determine the influence of landscape variables on population genetic structure.

  14. Effects of acid rain and sulfur dioxide on marble dissolution

    USGS Publications Warehouse

    Schuster, Paul F.; Reddy, Michael M.; Sherwood, Susan I.

    1994-01-01

    Acid precipitation and the dry deposition of sulfur dioxide (SO2) accelerate damage to carbonate-stone monuments and building materials. This study identified and quantified environmental damage to a sample of Vermont marble during storms and their preceding dry periods. Results from field experiments indicated the deposition of SO2 gas to the stone surface during dry periods and a twofold increase in marble dissolution during coincident episodes of low rain rate and decreased rainfall pH. The study is widely applicable to the analysis of carbonate-stone damage at locations affected by acid rain and air pollution.

  15. 16. CELLAR, UNDER WEST MEETING ROOM, LOOKING SOUTHEAST. Discarded marble ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    16. CELLAR, UNDER WEST MEETING ROOM, LOOKING SOUTHEAST. Discarded marble range top incorporated into a low brick partition. It is possible the range originally stood between the two brick walls beyond to the right. There appears to be a bricked-up fire box opening in the far wall. The fragments of the marble range top have been catalogued into the Architectural Study Collection of Independence National Historical Park. Dimensions recorded in Field Records. - Twelfth Street Meeting House, 20 South Twelfth Street, Philadelphia, Philadelphia County, PA

  16. Effects of acid rain and sulfur dioxide on marble dissolution

    SciTech Connect

    Schuster, P.F.; Reddy, M.M. ); Sherwood, S.I. )

    1994-01-01

    Acid precipitation and the dry deposition of sulfur dioxide (SO[sub 2]) accelerate damage to carbonate-stone monuments and building materials. This study identified and quantified environmental damage to a sample of Vermont marble during storms and their preceding dry periods. Results from field experiments indicated the deposition of SO[sub 2] gas to the stone surface during dry periods and a twofold increase in marble dissolution during coincident episodes of low rain rate and decreased rainfall pH. The study is widely applicable to the analysis of carbonate-stone damage at locations affected by acid rain and air pollution.

  17. Coprophagy in a cave-adapted salamander; the importance of bat guano examined through nutritional and stable isotope analyses

    PubMed Central

    Fenolio, Danté B; Graening, G.O; Collier, Bret A; Stout, Jim F

    2005-01-01

    During a two year population ecology study in a cave environment, 15 Eurycea (=Typhlotriton) spelaea were observed ingesting bat guano. Furthermore, E. spelaea capture numbers increased significantly during the time that grey bats (Myotis grisescens) deposited fresh guano. We investigated the hypothesis that this behaviour was not incidental to the capture of invertebrate prey, but a diet switch to an energy-rich detritus in an oligotrophic environment. Stable isotope assays determined that guano may be assimilated into salamander muscle tissue, and nutritional analyses revealed that guano is a comparable food source to potential invertebrate prey items. This is the first report of coprophagy in a salamander and in any amphibian for reasons other than intestinal inoculation. Because many temperate subterranean environments are often energy poor and this limitation is thought to select for increased diet breadth, we predict that coprophagy may be common in subterranean vertebrates where it is not currently recognized. PMID:16615210

  18. Transcriptomic Analysis of Endangered Chinese Salamander: Identification of Immune, Sex and Reproduction-Related Genes and Genetic Markers

    PubMed Central

    Che, Rongbo; Sun, Yuena; Wang, Rixin; Xu, Tianjun

    2014-01-01

    Background The Chinese salamander (Hynobius chinensis), an endangered amphibian species of salamander endemic to China, has attracted much attention because of its value of studying paleontology evolutionary history and decreasing population size. Despite increasing interest in the Hynobius chinensis genome, genomic resources for the species are still very limited. A comprehensive transcriptome of Hynobius chinensis, which will provide a resource for genome annotation, candidate genes identification and molecular marker development should be generated to supplement it. Principal Findings We performed a de novo assembly of Hynobius chinensis transcriptome by Illumina sequencing. A total of 148,510 nonredundant unigenes with an average length of approximately 580 bp were obtained. In all, 60,388 (40.66%) unigenes showed homologous matches in at least one database and 33,537 (22.58%) unigenes were annotated by all four databases. In total, 41,553 unigenes were categorized into 62 sub-categories by BLAST2GO search, and 19,468 transcripts were assigned to 140 KEGG pathways. A large number of unigenes involved in immune system, local adaptation, reproduction and sex determination were identified, as well as 31,982 simple sequence repeats (SSRs) and 460,923 putative single nucleotide polymorphisms (SNPs). Conclusion This dataset represents the first transcriptome analysis of the Chinese salamander (Hynobius chinensis), an endangered species, to be also the first time of hynobiidae. The transcriptome will provide valuable resource for further research in discovery of new genes, protection of population, adaptive evolution and survey of various pathways, as well as development of molecule markers in Chinese salamander; and reference information for closely related species. PMID:24498226

  19. Landscape influences on dispersal behaviour: a theoretical model and empirical test using the fire salamander, Salamandra infraimmaculata.

    PubMed

    Kershenbaum, Arik; Blank, Lior; Sinai, Iftach; Merilä, Juha; Blaustein, Leon; Templeton, Alan R

    2014-06-01

    When populations reside within a heterogeneous landscape, isolation by distance may not be a good predictor of genetic divergence if dispersal behaviour and therefore gene flow depend on landscape features. Commonly used approaches linking landscape features to gene flow include the least cost path (LCP), random walk (RW), and isolation by resistance (IBR) models. However, none of these models is likely to be the most appropriate for all species and in all environments. We compared the performance of LCP, RW and IBR models of dispersal with the aid of simulations conducted on artificially generated landscapes. We also applied each model to empirical data on the landscape genetics of the endangered fire salamander, Salamandra infraimmaculata, in northern Israel, where conservation planning requires an understanding of the dispersal corridors. Our simulations demonstrate that wide dispersal corridors of the low-cost environment facilitate dispersal in the IBR model, but inhibit dispersal in the RW model. In our empirical study, IBR explained the genetic divergence better than the LCP and RW models (partial Mantel correlation 0.413 for IBR, compared to 0.212 for LCP, and 0.340 for RW). Overall dispersal cost in salamanders was also well predicted by landscape feature slope steepness (76%), and elevation (24%). We conclude that fire salamander dispersal is well characterised by IBR predictions. Together with our simulation findings, these results indicate that wide dispersal corridors facilitate, rather than hinder, salamander dispersal. Comparison of genetic data to dispersal model outputs can be a useful technique in inferring dispersal behaviour from population genetic data.

  20. Maintenance of the Adh polymorphism in Ambystoma tigrinum nebulosum (tiger salamanders). I. Genotypic differences in time to metamorphosis in extreme oxygen environments.

    PubMed

    Carter, P A

    1997-01-01

    Populations of gilled tiger salamanders (Ambystoma tigrinum nebulosum) living in ephemeral ponds were studied in order to determine what evolutionary processes might be affecting genetic variation at the alcohol dehydrogenase (Adh) locus. Ponds frequently dried in late summer; salamanders that did not metamorphose and leave drying ponds died of desiccation. Low levels of water oxygen significantly slowed metamorphosis of tiger salamanders in both natural and laboratory populations. Adh- SS frequency was significantly positively correlated with daily oxygen maxima in ponds, Adh-FF frequency demonstrated a nonsignificant trend to be negatively correlated with this measure, and Adh-SF frequency was unrelated to pond oxygen. Genotype frequency changes across the season in hypoxic and supersaturated ponds suggested that differential mortality of genotypes might explain the relationships with pond oxygen, although other mechanisms cannot be ruled out. Individuals of the Adh-SS genotype metamorphosed more slowly in hypoxic water than in normoxic water in the laboratory, and Adh-FF individuals metamorphosed more slowly in supersaturated water in the field, and in hypoxic water in the laboratory, than they did in normoxic water. Adh-SF individuals metamorphosed at the same rate in all oxygen environments. These data suggest that the Adh polymorphism in tiger salamanders is being maintained by selection for Adh or for a linked locus through differential metamorphosis in extreme oxygen environments.

  1. Invasive hybrid tiger salamander genotypes impact native amphibians

    PubMed Central

    Ryan, Maureen E.; Johnson, Jarrett R.; Fitzpatrick, Benjamin M.

    2009-01-01

    Although the ecological consequences of species invasions are well studied, the ecological impacts of genetic introgression through hybridization are less understood. This is particularly true of the impacts of hybridization on “third party” community members not genetically involved in hybridization. We also know little about how direct interactions between hybrid and parental individuals influence fitness. Here, we examined the ecological effects of hybridization between the native, threatened California Tiger Salamander (Ambystoma californiense) and the introduced Barred Tiger Salamander (Ambystoma tigrinum mavortium). Native x introduced hybrids are widespread in California, where they are top predators in seasonal ponds. We examined the impacts of early generation hybrids (first 2 generations of parental crosses) and contemporary hybrids derived from ponds where hybrids have been under selection in the wild for 20 generations. We found that most classes of hybrid tiger salamander larvae dramatically reduced survival of 2 native community members, the Pacific Chorus Frog (Pseudacris regilla) and the California Newt (Taricha torosa). We also found that native A. californiense larvae were negatively impacted by the presence of hybrid larvae: Native survival and size at metamorphosis were reduced and time to metamorphosis was extended. We also observed a large influence of Mendelian dominance on size, metamorphic timing and predation rate of hybrid tiger salamanders. These results suggest that both genetic and ecological factors are likely to influence the dynamics of admixture, and that tiger salamander hybridization might constitute a threat to additional pond-breeding species of concern in the region. PMID:19564601

  2. Thyroid hormone responsive QTL and the evolution of paedomorphic salamanders.

    PubMed

    Voss, S R; Kump, D K; Walker, J A; Shaffer, H B; Voss, G J

    2012-11-01

    The transformation of ancestral phenotypes into novel traits is poorly understood for many examples of evolutionary novelty. Ancestrally, salamanders have a biphasic life cycle with an aquatic larval stage, a brief and pronounced metamorphosis, followed by a terrestrial adult stage. Repeatedly during evolution, metamorphic timing has been delayed to exploit growth-permissive environments, resulting in paedomorphic salamanders that retain larval traits as adults. We used thyroid hormone (TH) to rescue metamorphic phenotypes in paedomorphic salamanders and then identified quantitative trait loci (QTL) for life history traits that are associated with amphibian life cycle evolution: metamorphic timing and adult body size. We demonstrate that paedomorphic tiger salamanders (Ambystoma tigrinum complex) carry alleles at three moderate effect QTL (met1-3) that vary in responsiveness to TH and additively affect metamorphic timing. Salamanders that delay metamorphosis attain significantly larger body sizes as adults and met2 explains a significant portion of this variation. Thus, substitution of alleles at TH-responsive loci suggests an adaptive pleiotropic basis for two key life-history traits in amphibians: body size and metamorphic timing. Our study demonstrates a likely pathway for the evolution of novel paedomorphic species from metamorphic ancestors via selection of TH-response alleles that delay metamorphic timing and increase adult body size.

  3. Invasive hybrid tiger salamander genotypes impact native amphibians.

    PubMed

    Ryan, Maureen E; Johnson, Jarrett R; Fitzpatrick, Benjamin M

    2009-07-07

    Although the ecological consequences of species invasions are well studied, the ecological impacts of genetic introgression through hybridization are less understood. This is particularly true of the impacts of hybridization on "third party" community members not genetically involved in hybridization. We also know little about how direct interactions between hybrid and parental individuals influence fitness. Here, we examined the ecological effects of hybridization between the native, threatened California Tiger Salamander (Ambystoma californiense) and the introduced Barred Tiger Salamander (Ambystoma tigrinum mavortium). Native x introduced hybrids are widespread in California, where they are top predators in seasonal ponds. We examined the impacts of early generation hybrids (first 2 generations of parental crosses) and contemporary hybrids derived from ponds where hybrids have been under selection in the wild for 20 generations. We found that most classes of hybrid tiger salamander larvae dramatically reduced survival of 2 native community members, the Pacific Chorus Frog (Pseudacris regilla) and the California Newt (Taricha torosa). We also found that native A. californiense larvae were negatively impacted by the presence of hybrid larvae: Native survival and size at metamorphosis were reduced and time to metamorphosis was extended. We also observed a large influence of Mendelian dominance on size, metamorphic timing and predation rate of hybrid tiger salamanders. These results suggest that both genetic and ecological factors are likely to influence the dynamics of admixture, and that tiger salamander hybridization might constitute a threat to additional pond-breeding species of concern in the region.

  4. Variation in salamanders: an essay on genomes, development, and evolution.

    PubMed

    Brockes, Jeremy P

    2015-01-01

    Regeneration is studied in a few model species of salamanders, but the ten families of salamanders show considerable variation, and this has implications for our understanding of salamander biology. The most recent classification of the families identifies the cryptobranchoidea as the basal group which diverged in the early Jurassic. Variation in the sizes of genomes is particularly obvious, and reflects a major contribution from transposable elements which is already present in the basal group.Limb development has been a focus for evodevo studies, in part because of the variable property of pre-axial dominance which distinguishes salamanders from other tetrapods. This is thought to reflect the selective pressures that operate on a free-living aquatic larva, and might also be relevant for the evolution of limb regeneration. Recent fossil evidence suggests that both pre-axial dominance and limb regeneration were present 300 million years ago in larval temnospondyl amphibians that lived in mountain lakes. A satisfying account of regeneration in salamanders may need to address all these different aspects in the future.

  5. Are Salamanders Useful Indicators of Hydrologic Permanence in Headwater Streams?

    NASA Astrophysics Data System (ADS)

    Johnson, B.; Fritz, K.

    2005-05-01

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collected in spring and summer 2003 from 59 sites located longitudinally along 17 forested streams in KY, IN, and OH. Larval Eurycea bislineata/cirrigera dominated all forests, and their abundances were highly correlated with drainage areas and channel dimensions. Appalachian streams were more diverse and had intermittent sites with more Desmognathus and Gyrinophilus spp. Of 22 sites where larvae were collected in spring, 9 sites subsequently dried in summer, suggesting salamanders either emigrated or died. We therefore only used taxa with multi-year larval stages as indicators of perennial water. Salamander larvae >1 yr old were collected from each locality in drainage areas <0.17 km2. However, these older larvae were often found in isolated pools that serve as refugia during dry periods. Findings suggest salamanders with multi-year larval periods can indicate perennial waters and that their use is more effective in Appalachia where abundance and diversity are high. Although this work was reviewed by EPA and approved for publication, it may not necessarily reflect official Agency policy.

  6. Thyroid hormone responsive QTL and the evolution of paedomorphic salamanders

    PubMed Central

    Voss, S R; Kump, D K; Walker, J A; Shaffer, H B; Voss, G J

    2012-01-01

    The transformation of ancestral phenotypes into novel traits is poorly understood for many examples of evolutionary novelty. Ancestrally, salamanders have a biphasic life cycle with an aquatic larval stage, a brief and pronounced metamorphosis, followed by a terrestrial adult stage. Repeatedly during evolution, metamorphic timing has been delayed to exploit growth-permissive environments, resulting in paedomorphic salamanders that retain larval traits as adults. We used thyroid hormone (TH) to rescue metamorphic phenotypes in paedomorphic salamanders and then identified quantitative trait loci (QTL) for life history traits that are associated with amphibian life cycle evolution: metamorphic timing and adult body size. We demonstrate that paedomorphic tiger salamanders (Ambystoma tigrinum complex) carry alleles at three moderate effect QTL (met1–3) that vary in responsiveness to TH and additively affect metamorphic timing. Salamanders that delay metamorphosis attain significantly larger body sizes as adults and met2 explains a significant portion of this variation. Thus, substitution of alleles at TH-responsive loci suggests an adaptive pleiotropic basis for two key life-history traits in amphibians: body size and metamorphic timing. Our study demonstrates a likely pathway for the evolution of novel paedomorphic species from metamorphic ancestors via selection of TH-response alleles that delay metamorphic timing and increase adult body size. PMID:22850698

  7. A potential wound-healing-promoting peptide from salamander skin.

    PubMed

    Mu, Lixian; Tang, Jing; Liu, Han; Shen, Chuanbin; Rong, Mingqiang; Zhang, Zhiye; Lai, Ren

    2014-09-01

    Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

  8. Fine-Scale Genetic Differentiation in a Salamander Hynobius tokyoensis Living in Fragmented Urban Habitats in and Around Tokyo, Japan.

    PubMed

    Sugawara, Hirotaka; Kusano, Tamotsu; Hayashi, Fumio

    2016-10-01

    Salamanders are expected to differentiate genetically among local populations due to their low dispersal ability, and are potentially susceptible to loss of genetic diversity if the population is isolated by habitat fragmentation. The salamander Hynobius tokyoensis is a lowland lentic breeder and endemic to a narrow area of central Japan. In this urban area, H. tokyoensis habitats are extensively fragmented and several populations are threatened with extinction, but information on genetic divergence and loss of genetic diversity is scarce. We performed mitochondrial (cyt b) and microsatellite (five loci) DNA analyses of 815 individuals from 46 populations in 12 regions across their entire distribution range. As a result, populations were clearly separated into northern and southern groups, and genetic differentiation among the 12 regions was also evident. Regional differentiation appears to be affected by a complex geographical history, but the genetic diversity of each population may have also been affected by recent habitat fragmentation. There were positive correlations between the mitochondrial and microsatellite DNA diversities. Some populations have lost genetic diversity in both mitochondrial and microsatellite DNAs; all such populations were at the peripheral edges of the species distribution range. Thus, even in attempts to restore genetic diversity in a small population by the transfer of outside individuals, efforts must be made to avoid genetic pollution.

  9. Spatial genetic structure and regional demography in the southern torrent salamander: Implications for conservation and management

    USGS Publications Warehouse

    Miller, Mark P.; Haig, Susan M.; Wagner, R.S.

    2006-01-01

    The Southern torrent salamander (Rhyacotriton variegatus) was recently found not warranted for listing under the US Endangered Species Act due to lack of information regarding population fragmentation and gene flow. Found in small-order streams associated with late-successional coniferous forests of the US Pacific Northwest, threats to their persistence include disturbance related to timber harvest activities. We conducted a study of genetic diversity throughout this species' range to 1) identify major phylogenetic lineages and phylogeographic barriers and 2) elucidate regional patterns of population genetic and spatial phylogeographic structure. Cytochrome b sequence variation was examined for 189 individuals from 72 localities. We identified 3 major lineages corresponding to nonoverlapping geographic regions: a northern California clade, a central Oregon clade, and a northern Oregon clade. The Yaquina River may be a phylogeographic barrier between the northern Oregon and central Oregon clades, whereas the Smith River in northern California appears to correspond to the discontinuity between the central Oregon and northern California clades. Spatial analyses of genetic variation within regions encompassing major clades indicated that the extent of genetic structure is comparable among regions. We discuss our results in the context of conservation efforts for Southern torrent salamanders.

  10. Phylogeography and spatial genetic structure of the Southern torrent salamander: Implications for conservation and management

    USGS Publications Warehouse

    Miller, M.P.; Haig, S.M.; Wagner, R.S.

    2006-01-01

    The Southern torrent salamander (Rhyacotriton variegatus) was recently found not warranted for listing under the US Endangered Species Act due to lack of information regarding population fragmentation and gene flow. Found in small-order streams associated with late-successional coniferous forests of the US Pacific Northwest, threats to their persistence include disturbance related to timber harvest activities. We conducted a study of genetic diversity throughout this species' range to 1) identify major phylogenetic lineages and phylogeographic barriers and 2) elucidate regional patterns of population genetic and spatial phylogeographic structure. Cytochrome b sequence variation was examined for 189 individuals from 72 localities. We identified 3 major lineages corresponding to nonoverlapping geographic regions: a northern California clade, a central Oregon clade, and a northern Oregon clade. The Yaquina River may be a phylogeographic barrier between the northern Oregon and central Oregon clades, whereas the Smith River in northern California appears to correspond to the discontinuity between the central Oregon and northern California clades. Spatial analyses of genetic variation within regions encompassing major clades indicated that the extent of genetic structure is comparable among regions. We discuss our results in the context of conservation efforts for Southern torrent salamanders. ?? The American Genetic Association. 2006. All rights reserved.

  11. Introduction history and habitat variation explain the landscape genetics of hybrid tiger salamanders.

    PubMed

    Fitzpatrick, Benjamin M; Shaffer, H Bradley

    2007-03-01

    Genetic introgression from introduced species into native populations is a growing challenge for biological conservation, and one that raises unique practical and ethical issues. Here, we describe the extent of introgression between native California tiger salamanders (Ambystoma californiense) and introduced barred tiger salamanders (A. tigrinum mavortium) relative to habitat, distance from introduction sites, and watershed boundaries. We used ancestry informative markers (AIMs) to characterize the degree of introgression at 85 sites within the range of A. californiense. Eight unlinked markers showed concordant patterns, indicating that different chromosomal segments are introgressing at similar rates. The current distribution of introduced alleles is largely contained in the Salinas Valley, California. Within it, the distribution of nonnative alleles was best explained at a broad geographic scale by the history of introductions, with limited introgression beyond 12 km from multiple independent release sites. The spatial transition from highly admixed to nearly pure native populations was abrupt, suggesting either cryptic barriers to dispersal or locally rapid displacement of natives by an advancing hybrid swarm. At a more ecological level, highly modified perennial breeding ponds had higher introduced allele frequencies than more natural seasonal ponds, suggesting greater invasion success in perennial breeding ponds. Management favoring natural habitat characteristics may substantially decrease the rate of spread of introduced alleles.

  12. Larval growth in polyphenic salamanders: making the best of a bad lot.

    PubMed

    Whiteman, H H; Wissinger, S A; Denoël, M; Mecklin, C J; Gerlanc, N M; Gutrich, J J

    2012-01-01

    Polyphenisms are excellent models for studying phenotypic variation, yet few studies have focused on natural populations. Facultative paedomorphosis is a polyphenism in which salamanders either metamorphose or retain their larval morphology and eventually become paedomorphic. Paedomorphosis can result from selection for capitalizing on favorable aquatic habitats (paedomorph advantage), but could also be a default strategy under poor aquatic conditions (best of a bad lot). We tested these alternatives by quantifying how the developmental environment influences the ontogeny of wild Arizona tiger salamanders (Ambystoma tigrinum nebulosum). Most paedomorphs in our study population arose from slow-growing larvae that developed under high density and size-structured conditions (best of a bad lot), although a few faster-growing larvae also became paedomorphic (paedomorph advantage). Males were more likely to become paedomorphs than females and did so under a greater range of body sizes than females, signifying a critical role for gender in this polyphenism. Our results emphasize that the same phenotype can be adaptive under different environmental and genetic contexts and that studies of phenotypic variation should consider multiple mechanisms of morph production.

  13. Phenotypic variation in metamorphosis and paedomorphosis in the salamander Ambystoma talpoideum

    SciTech Connect

    Semlitsch, R.D.; Gibbons, J.W.

    1985-08-01

    Phenotypic variation in metamorphosis and paedomorphosis in the salamander Ambystoma talpoideum was examined to determine its environmental or genetic basis. Eight artificial ponds were maintained, four at each of two environmental treatments: constant water level, to simulate fish-free permanent breeding ponds, and gradual drying out, to simulate temporary breeding ponds. Two populations of salamanders were used, derived from two breeding ponds having different frequencies of paedomorphosis. The water level in the drying treatment was lowered during the last 10 wk of the experimental period with no apparent differences in water chemistry parameters between treatments and only a slight change in water temperature during the last 2 wk. The effects of water level were potentially confounded by those of water temperature, density of larvae, and amount food. Population differences in the frequency of metamorphosis and paedomorphosis could potentially represent genetic differences resulting from the different selective regimes that individuals encounter in breeding ponds varying in drying frequency. 35 references, 3 figures, 4 tables.

  14. Coalescence patterns of endemic Tibetan species of stream salamanders (Hynobiidae: Batrachuperus).

    PubMed

    Lu, Bin; Zheng, Yuchi; Murphy, Robert W; Zeng, Xiaomao

    2012-07-01

    Orogenesis of topographically diverse montane regions often drives complex evolutionary histories of species. The extensive biodiversity of the eastern edge of the Tibetan Plateau, which gradually decreases eastwardly, facilitates a comparison of historical patterns. We use coalescence methods to compare species of stream salamanders (Batrachuperus) that occur at high and low elevations. Coalescent simulations reveal that closely related species are likely to have been influenced by different drivers of diversification. Species living in the western high-elevation region with its northsouth extending mountains appear to have experienced colonization via dispersal followed by isolation and divergence. In contrast, species on the eastern low-elevation region, which has many discontinuous mountain ranges, appear to have experienced fragmentation, sometimes staged, of wide-ranging ancestral populations. The two groups of species appear to have been affected differently by glaciation. High-elevation species, which are more resistant to cooler temperatures, appear to have experienced population declines as recently as the last glaciation (0.016-0.032Ma). In contrast, salamanders dwelling in the warmer and wetter habitats at low-elevation environs appear to have been affected less by the relatively recent, milder glaciation, and more so by harsher, extensive glaciations (0.5-0.175 Ma). Thus, elevation, topography and cold tolerance appear to drive evolutionary patterns of diversification and demography even among closely related taxa. The comparison of multiple species in genealogical analyses can lead to an understanding of the evolutionary drivers.

  15. Non-additive response of larval ringed salamanders to intraspecific density.

    PubMed

    Ousterhout, Brittany H; Semlitsch, Raymond D

    2016-04-01

    Conditions experienced in early developmental stages can have long-term consequences for individual fitness. High intraspecific density during the natal period can affect juvenile and eventually adult growth rates, metabolism, immune function, survival, and fecundity. Despite the important ecological and evolutionary effects of early developmental density, the form of the relationship between natal density and resulting juvenile phenotype is poorly understood. To test competing hypotheses explaining responses to intraspecific density, we experimentally manipulated the initial larval density of ringed salamanders (Ambystoma annulatum), a pond-breeding amphibian, over 11 densities. We modeled the functional form of the relationship between natal density and juvenile traits, and compared the relative support for the various hypotheses based on their goodness of fit. These functional form models were then used to parameterize a simple simulation model of population growth. Our data support non-additive density dependence and presents an alternate hypothesis to additive density dependence, self-thinning and Allee effects in larval amphibians. We posit that ringed salamander larvae may be under selective pressure for tolerance to high density and increased efficiency in resource utilization. Additionally, we demonstrate that models of population dynamics are sensitive to assumptions of the functional form of density dependence.

  16. 69. (Credit JTL) View beneath marble meter bench showing hydraulic ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    69. (Credit JTL) View beneath marble meter bench showing hydraulic lines leading to water valve hydraulic control cylinders from control handles in bench; strings and pulleys activate meters. - McNeil Street Pumping Station, McNeil Street & Cross Bayou, Shreveport, Caddo Parish, LA

  17. A Unit Cell Laboratory Experiment: Marbles, Magnets, and Stacking Arrangements

    ERIC Educational Resources Information Center

    Collins, David C.

    2011-01-01

    An undergraduate first-semester general chemistry laboratory experiment introducing face-centered, body-centered, and simple cubic unit cells is presented. Emphasis is placed on the stacking arrangement of solid spheres used to produce a particular unit cell. Marbles and spherical magnets are employed to prepare each stacking arrangement. Packing…

  18. 10. MARBLE BRIDGE MIDSPAN OF EAST ARCH. THE PLATE READS ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    10. MARBLE BRIDGE MIDSPAN OF EAST ARCH. THE PLATE READS MORRIS RUN BRIDGE, 1908, C.F. MOYER, C.Y. STRADLINGS, S.M. FITE, COMMRR'S, S.B. TWINING CO. CONTR, W. CADWALLADER CLERK. - Morris Run Bridge, Rickert Road (TR 417) spanning Morris Run in Hilltown Township, Dublin, Bucks County, PA

  19. Measuring stone weathering in cities: Surface reduction on marble monuments

    SciTech Connect

    Dragovich, D. )

    1987-01-01

    The purpose of this study was to establish whether measurements of stone weathering recorded by different observers could be aggregated into a simple data base for evaluating pollution effects on calcareous building stone. Apparent differences in recorded weathering rates on marble tombstones were here found to be partly a result of lettering size measured, measuring devices used, and individual observers.

  20. Measuring Marbles: Demonstrating the Basic Tenets of Measurement Theory

    ERIC Educational Resources Information Center

    Wininger, Steven R.

    2007-01-01

    A hands-on activity is described in which students attempt to measure something that they cannot see. In small groups, students estimate the number of marbles in sealed boxes. Next, students' estimates are compared with the actual numbers. Last, values from both the students' estimates and actual numbers are used to explain measurement theory and…

  1. Study of marble deterioration at City Hall, Schenectady, New York

    SciTech Connect

    Cheng, R.J.; Castillo, R.

    1984-01-01

    Constructed in 1930 at a cost of over one million dollars, the City Hall in Schenectady, New York, is listed in the U.S. Register of Historical Buildings. The masonry materials were the finest available at the time of construction; granite, fire hardened exterior brick and Vermont marble - Imperical Danby, an equivalent to Carrara marble from Italy. It is known today that the lack of impurities in the Imperial Danby leads to weak crystalline properties. Cleaned with water, sponges and stiff brushes upon completion of construction, the exterior was not cleaned over a fifty-year period. The research indicated that the marble grains are being structurally weakened by a chemical conversion process of marble to gypsum crystals. The surface zone of chemical activity (2-5 mm) shows the presence of fly ash and iron particles and points to the possibility of a catalytic mechanism for the conversion of sulfur dioxide to sulfate. This research has established symptoms which are consistent with prior reported research into building material deterioration. However, the results presented are not supportive of one mechanism over another.

  2. Novel Hydroxyapatite Coatings for the Conservation of Marble and Limestone

    NASA Astrophysics Data System (ADS)

    Naidu, Sonia

    Marble and limestone are calcite-based materials used in the construction of various structures, many of which have significant artistic and architectural value. Unfortunately, due to calcite's high dissolution rate, these stones are susceptible to chemically-induced weathering in nature. Limestone, due to its inherent porosity, also faces other environmental weathering processes that cause weakening from disintegration at grain boundaries. The treatments presently available are all deficient in one way or another. The aim of this work is to examine the feasibility of using hydroxyapatite (HAP) as a novel protective coating for marble and limestone, with two goals: i) to reduce acid corrosion of marble and ii) to consolidate physically weathered limestone. The motivation for using HAP is its low dissolution rate and structural compatibility with calcite. Mild, wet chemical synthesis routes, in which inorganic phosphate-based solutions were reacted with marble and limestone, alone and with other precursors, were used to produce HAP films. Film nucleation, growth and phase evolution were studied on marble to understand film formation and determine the optimal synthesis route. An acid resistance test was developed to investigate the attack mechanism on marble and quantify the efficacy of HAP-based coatings. Film nucleation and growth were dependent on substrate surface roughness and increased with calcium and carbonate salt additions during synthesis. Acid attack on marble occurred via simultaneous dissolution at grain boundaries, twin boundaries and grain surfaces. HAP provided intermediate protection against acid attack, when compared to two conventional treatments. Its ability to protect the stone from acid was not as significant as predicted from dissolution kinetics and this was attributed to incomplete coverage and residual porosity within the film, arising from its flake-like crystal growth habit, which enabled acid to access the underlying substrate. The

  3. Effects of mercury on behavior and performance of northern two-lined salamanders (Eurycea bislineata).

    PubMed

    Burke, John N; Bergeron, Christine M; Todd, Brian D; Hopkins, William A

    2010-12-01

    Mercury (Hg) causes a range of deleterious effects in wildlife, but little is known about its effects on amphibians. Our objective was to determine whether Hg affects performance and behavior in two-lined salamanders (Eurycea bislineata). We collected salamanders from Hg-contaminated and reference sites and assessed speed, responsiveness, and prey capture ability. Mercury concentrations were >17× higher in salamanders from the contaminated sites and were among the highest documented in amphibians. In the first, but not in the second, locomotion trial, we found a significant effect of Hg on speed and responsiveness. In the prey capture experiment, reference salamanders ate approximately twice as many prey items as the contaminated salamanders. Together, our results suggest that sublethal Hg concentrations may negatively affect salamanders by reducing their ability to successfully execute tasks critical to survival. Future work is warranted to determine whether Hg has other sublethal effects on salamanders and whether other amphibians are similarly affected.

  4. Banding differences between tiger salamander and axolotl chromosomes.

    PubMed

    Cuny, R; Malacinski, G M

    1985-10-01

    The Hoechst 33258 - Giemsa banding patterns were compared on axolotl (Ambystoma mexicanum Shaw) and axolotl - tiger salamander (Ambystoma tigrinum Green) species hybrid prophase chromosomes. Approximately 369 bands per haploid chromosome set were seen in the axolotl and about 344 bands in the tiger salamander. In the haploid set of 14 chromosomes, chromosome 3 has a constant short or q-arm terminal constriction at the location of the nucleolar organizer. Chromosomes 14 Z and W carry the sex determinants, the female being the heterogametic sex (ZW). The banding patterns of chromosomes 1, 6, 11, and 14 Z of the two species are apparently indistinguishable by our banding method. In the axolotl, chromosome 9 has a small long or p-arm terminal deletion. In the tiger salamander, the remaining 10 chromosomes have terminal or internal deletions. No translocations or inversions seem to have occurred since the gene pool separation of the two closely related species.

  5. Salamander limb development: integrating genes, morphology, and fossils.

    PubMed

    Fröbisch, Nadia B; Shubin, Neil H

    2011-05-01

    The development of the tetrapod limb during skeletogenesis follows a highly conservative pattern characterized by a general proximo-distal progression in the establishment of skeletal elements and a postaxial polarity in digit development. Salamanders represent the only exception to this pattern and display an early establishment of distal autopodial structures, specifically the basale commune, an amalgamation of distal carpal and tarsal 1 and 2, and a distinct preaxial polarity in digit development. This deviance from the conserved tetrapod pattern has resulted in a number of hypotheses to explain its developmental basis and evolutionary history. Here we summarize the current knowledge of salamander limb development under consideration of the fossil record to provide a deep time perspective of this evolutionary pathway and highlight what data will be needed in the future to gain a better understanding of salamander limb development specifically and tetrapod limb development and evolution more broadly.

  6. 77 FR 70159 - Marble River, LLC v. Noble Clinton Windpark I, LLC, Noble Ellenburg Windpark, LLC, Noble...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-11-23

    ... Energy Regulatory Commission Marble River, LLC v. Noble Clinton Windpark I, LLC, Noble Ellenburg Windpark..., Marble River, LLC (Marble River or Complainant) filed a formal complaint against Noble Clinton Windpark I... pay Marble River for headroom created by common system upgrade facilities that benefit Noble and...

  7. Historical Demography of an Endangered Salamander, Ranodon sibiricus (Amphibia, Urodela, Hynobiidae): A Reassessment.

    PubMed

    Nishikawa, Kanto; Dujsebayeva, Tatjana; Matsui, Masafumi; Yoshikawa, Natsuhiko; Tominaga, Atsushi

    2017-02-01

    Chinese populations of the endangered Siberian salamander Ranodon sibiricus are reported to have diverged only about 120 years ago, and to have the lowest genetic diversity of any amphibian. However, these conclusions require verification, as the main range of the species is in Kazakhstan. Moreover, the generation time used for estimating divergence time has a weak ground. In order to clarify these problems, we investigated the molecular phylogenetic relationship and historical demography of the species covering its whole distribution range using the mitochondrial DNA region reported for Chinese population (1072 bp sequences of the control region), while conducting skeletochronological analysis to estimate accurate generation time. As a result, the range expansion was estimated at 88,000-50,000 YA, based on the generation time of 6-10 years. Degree of intraspecific genetic differentiation is actually very small, but, as a single species, is not so small as had been reported for Chinese population alone.

  8. Ontogenetic evidence for the Paleozoic ancestry of salamanders.

    PubMed

    Schoch, Rainer R; Carroll, Robert L

    2003-01-01

    The phylogenetic positions of frogs, salamanders, and caecilians have been difficult to establish. Data matrices based primarily on Paleozoic taxa support a monophyletic origin of all Lissamphibia but have resulted in widely divergent hypotheses of the nature of their common ancestor. Analysis that concentrates on the character states of the stem taxa of the extant orders, in contrast, suggests a polyphyletic origin from divergent Paleozoic clades. Comparison of patterns of larval development in Paleozoic and modern amphibians provides a means to test previous phylogenies based primarily on adult characteristics. This proves to be highly informative in the case of the origin of salamanders. Putative ancestors of salamanders are recognized from the Permo-Carboniferous boundary of Germany on the basis of ontogenetic changes observed in fossil remains of larval growth series. The entire developmental sequence from hatching to metamorphosis is revealed in an assemblage of over 600 specimens from a single locality, all belonging to the genus Apateon. Apateon forms the most speciose genus of the neotenic temnospondyl family Branchiosauridae. The sequence of ossification of individual bones and the changing configuration of the skull closely parallel those observed in the development of primitive living salamanders. These fossils provide a model of how derived features of the salamander skull may have evolved in the context of feeding specializations that appeared in early larval stages of members of the Branchiosauridae. Larvae of Apateon share many unique derived characters with salamanders of the families Hynobiidae, Salamandridae, and Ambystomatidae, which have not been recognized in any other group of Paleozoic amphibians.

  9. Ecological implications of metabolic compensation at low temperatures in salamanders

    PubMed Central

    2016-01-01

    Global warming is influencing the biology of the world’s biota. Temperature increases are occurring at a faster pace than that experienced by organisms in their evolutionary histories, limiting the organisms’ response to new conditions. Mechanistic models that include physiological traits can help predict species’ responses to warming. Changes in metabolism at high temperatures are often examined; yet many species are behaviorally shielded from high temperatures. Salamanders generally favor cold temperatures and are one of few groups of metazoans to be most species-rich in temperate regions. I examined variation in body temperature, behavioral activity, and temperature dependence of resting heart rate, used as a proxy for standard metabolic rate, in fire salamanders (Salamandra salamandra). Over 26 years, I found that salamanders are behaviorally active at temperatures as low as 1 °C, and aestivate at temperatures above 16 °C. Infrared thermography indicates limited thermoregulation opportunities for these nocturnal amphibians. Temperature affects resting heart rate, causing metabolic depression above 11 °C, and metabolic compensation below 8 °C: heart rate at 3 °C is 224% the expected heart rate. Thus, salamanders operating at low temperatures during periods of peak behavioral activity are able to maintain a higher metabolic rate than the rate expected in absence of compensation. This compensatory mechanism has important ecological implications, because it increases estimated seasonal heart rates. Increased heart rate, and thus metabolism, will require higher caloric intake for field-active salamanders. Thus, it is important to consider a species performance breadth over the entire temperature range, and particularly low temperatures that are ecologically relevant for cold tolerant species such as salamanders. PMID:27257549

  10. Modular functional organisation of the axial locomotor system in salamanders.

    PubMed

    Cabelguen, Jean-Marie; Charrier, Vanessa; Mathou, Alexia

    2014-02-01

    Most investigations on tetrapod locomotion have been concerned with limb movements. However, there is compelling evidence that the axial musculoskeletal system contributes to important functions during locomotion. Adult salamanders offer a remarkable opportunity to examine these functions because these amphibians use axial undulations to propel themselves in both aquatic and terrestrial environments. In this article, we review the currently available biological data on axial functions during various locomotor modes in salamanders. We also present data showing the modular organisation of the neural networks that generate axial synergies during locomotion. The functional implication of this modular organisation is discussed.

  11. Insights into the mating habits of the tiger salamander (Ambystoma tigrinum tigrinum) as revealed by genetic parentage analyses.

    PubMed

    Gopurenko, David; Williams, Rod N; McCormick, Cory R; DeWoody, J Andrew

    2006-06-01

    Among urodeles, ambystomatid salamanders are particularly amenable to genetic parentage analyses because they are explosive aggregate breeders that typically have large progeny arrays. Such analyses can lead to direct inferences about otherwise cryptic aspects of salamander natural history, including the rate of multiple mating, individual reproductive success, and the spatial distribution of clutches. In 2002, we collected eastern tiger salamander (Ambystoma tigrinum tigrinum) egg masses (> 1000 embryos) from a approximately 80 m linear transect in Indiana, USA. Embryos were genotyped at four variable microsatellite loci and the resulting progeny array data were used to reconstruct multilocus genotypes of the parental dams and sires for each egg mass. UPGMA analysis of genetic distances among embryos resolved four instances of egg mass admixture, where two or more females had oviposited at exactly the same site resulting in the mixing of independent cohorts. In total, 41 discrete egg masses were available for parentage analyses. Twenty-three egg masses (56%) consisted exclusively of full-siblings (i.e. were singly sired) and 18 (44%) were multiply sired (mean 2.6 males/clutch). Parentage could be genetically assigned to one of 17 distinct parent pairs involving at least 15 females and 14 different males. Reproductive skew was evident among males who sired multiply sired clutches. Additional evidence of the effects of sexual selection on male reproductive success was apparent via significant positive correlations between male mating and reproductive success. Females frequently partitioned their clutches into multiple discrete egg masses that were separated from one another by as many as 43 m. Collectively, these data provide the first direct evidence for polygynandry in a wild population of tiger salamanders.

  12. Genetic drift and rapid evolution of viviparity in insular fire salamanders (Salamandra salamandra)

    PubMed Central

    Velo-Antón, G; Zamudio, K R; Cordero-Rivera, A

    2012-01-01

    Continental islands offer an excellent opportunity to investigate adaptive processes and to time microevolutionary changes that precede macroevolutionary events. We performed a population genetic study of the fire salamander (Salamandra salamandra), a species that displays unique intraspecific diversity of reproductive strategies, to address the microevolutionary processes leading to phenotypic and genetic differentiation of island, coastal and interior populations. We used eight microsatellite markers to estimate genetic diversity, population structure and demographic parameters in viviparous insular populations and ovoviviparous coastal and interior populations. Our results show considerable genetic differentiation (FST range: 0.06–0.27), and no clear signs of gene flow among populations, except between the large and admixed interior populations. We find no support for island colonization by rafting or intentional/accidental anthropogenic introductions, indicating that rising sea levels were responsible for isolation of the island populations approximately 9000 years ago. Our study provides evidence of rapid genetic differentiation between island and coastal populations, and rapid evolution of viviparity driven by climatic selective pressures on island populations, geographic isolation with genetic drift, or a combination of these factors. Studies of these viviparous island populations in early stages of divergence help us better understand the microevolutionary processes involved in rapid phenotypic shifts. PMID:22086081

  13. Genetic drift and rapid evolution of viviparity in insular fire salamanders (Salamandra salamandra).

    PubMed

    Velo-Antón, G; Zamudio, K R; Cordero-Rivera, A

    2012-04-01

    Continental islands offer an excellent opportunity to investigate adaptive processes and to time microevolutionary changes that precede macroevolutionary events. We performed a population genetic study of the fire salamander (Salamandra salamandra), a species that displays unique intraspecific diversity of reproductive strategies, to address the microevolutionary processes leading to phenotypic and genetic differentiation of island, coastal and interior populations. We used eight microsatellite markers to estimate genetic diversity, population structure and demographic parameters in viviparous insular populations and ovoviviparous coastal and interior populations. Our results show considerable genetic differentiation (F(ST) range: 0.06-0.27), and no clear signs of gene flow among populations, except between the large and admixed interior populations. We find no support for island colonization by rafting or intentional/accidental anthropogenic introductions, indicating that rising sea levels were responsible for isolation of the island populations approximately 9000 years ago. Our study provides evidence of rapid genetic differentiation between island and coastal populations, and rapid evolution of viviparity driven by climatic selective pressures on island populations, geographic isolation with genetic drift, or a combination of these factors. Studies of these viviparous island populations in early stages of divergence help us better understand the microevolutionary processes involved in rapid phenotypic shifts.

  14. Polymorphism of alternative splicing of major histocompatibility complex transcripts in wild tiger salamanders.

    PubMed

    Bulut, Zafer; McCormick, Cory R; Bos, David H; DeWoody, J Andrew

    2008-07-01

    Alternative splicing (AS) of mRNA transcripts is increasingly recognized as a source of transcriptome diversity. To date, most AS studies have focused either on comparisons across taxa or on intragenomic comparisons across gene families. We generated a novel data set that represents one of the first population genetic comparisons of AS across individuals. In ambystomatid salamanders, AS of the major histocompatibility complex (MHC) class IIbeta gene (Amti-DAB) produces two transcripts, one full-length and one truncated. The full-length transcript is functional, but the truncated transcript is missing the critical beta1 domain that forms half of the peptide binding region in the intact MHC class II molecule. We captured wild salamander larvae (Ambystoma tigrinum tigrinum) and genotyped them at Amti-DAB via DNA sequencing. From these same larvae, we extracted RNA from gill and spleen and evaluated the relative expression level of Amti-DAB in each tissue. Across individuals, 21% of the transcripts were truncated (alternatively spliced), and the absolute level of alternative transcript expression was higher in gill. The high level of nucleotide variation among seven Amti-DAB alleles provides the ability to detect substitutions (or linked DNA polymorphisms) that might have influenced AS. The data reveal no correlation between AS and haplotype, allele, or zygosity. However, indirect evidence (comparative expression patterns across 3 million years of evolution) suggests that the truncated Amti-DAB transcript may be functional and maintained by natural selection.

  15. Identification of Mutant Genes and Introgressed Tiger Salamander DNA in the Laboratory Axolotl, Ambystoma mexicanum.

    PubMed

    Woodcock, M Ryan; Vaughn-Wolfe, Jennifer; Elias, Alexandra; Kump, D Kevin; Kendall, Katharina Denise; Timoshevskaya, Nataliya; Timoshevskiy, Vladimir; Perry, Dustin W; Smith, Jeramiah J; Spiewak, Jessica E; Parichy, David M; Voss, S Randal

    2017-12-01

    The molecular genetic toolkit of the Mexican axolotl, a classic model organism, has matured to the point where it is now possible to identify genes for mutant phenotypes. We used a positional cloning-candidate gene approach to identify molecular bases for two historic axolotl pigment phenotypes: white and albino. White (d/d) mutants have defects in pigment cell morphogenesis and differentiation, whereas albino (a/a) mutants lack melanin. We identified in white mutants a transcriptional defect in endothelin 3 (edn3), encoding a peptide factor that promotes pigment cell migration and differentiation in other vertebrates. Transgenic restoration of Edn3 expression rescued the homozygous white mutant phenotype. We mapped the albino locus to tyrosinase (tyr) and identified polymorphisms shared between the albino allele (tyr (a) ) and tyr alleles in a Minnesota population of tiger salamanders from which the albino trait was introgressed. tyr (a) has a 142 bp deletion and similar engineered alleles recapitulated the albino phenotype. Finally, we show that historical introgression of tyr (a) significantly altered genomic composition of the laboratory axolotl, yielding a distinct, hybrid strain of ambystomatid salamander. Our results demonstrate the feasibility of identifying genes for traits in the laboratory Mexican axolotl.

  16. Structured decision making as a conservation tool for recovery planning of two endangered salamanders

    USGS Publications Warehouse

    O'Donnell, Katherine; Messerman, Arianne F; Barichivich, William J.; Semlitsch, Raymond D.; Gorman, Thomas A.; Mitchell, Harold G; Allan, Nathan; Fenolio, Dante B.; Green, Adam; Johnson, Fred A.; Keever, Allison; Mandica, Mark; Martin, Julien; Mott, Jana; Peacock, Terry; Reinman, Joseph; Romanach, Stephanie; Titus, Greg; McGowan, Conor; Walls, Susan

    2017-01-01

    At least one-third of all amphibian species face the threat of extinction, and current amphibian extinction rates are four orders of magnitude greater than background rates. Preventing extirpation often requires both ex situ (i.e., conservation breeding programs) and in situ strategies (i.e., protecting natural habitats). Flatwoods salamanders (Ambystoma bishopi and A. cingulatum) are protected under the U.S. Endangered Species Act. The two species have decreased from 476 historical locations to 63 recently extant locations (86.8% loss). We suggest that recovery efforts are needed to increase populations and prevent extinction, but uncertainty regarding optimal actions in both ex situ and in situ realms hinders recovery planning. We used structured decision making (SDM) to address key uncertainties regarding both captive breeding and habitat restoration, and we developed short-, medium-, and long-term goals to achieve recovery objectives. By promoting a transparent, logical approach, SDM has proven vital to recovery plan development for flatwoods salamanders. The SDM approach has clear advantages over other previous approaches to recovery efforts, and we suggest that it should be considered for other complex decisions regarding endangered species.

  17. Computer-Assisted Photo Identification Outperforms Visible Implant Elastomers in an Endangered Salamander, Eurycea tonkawae

    PubMed Central

    Bendik, Nathan F.; Morrison, Thomas A.; Gluesenkamp, Andrew G.; Sanders, Mark S.; O’Donnell, Lisa J.

    2013-01-01

    Despite recognition that nearly one-third of the 6300 amphibian species are threatened with extinction, our understanding of the general ecology and population status of many amphibians is relatively poor. A widely-used method for monitoring amphibians involves injecting captured individuals with unique combinations of colored visible implant elastomer (VIE). We compared VIE identification to a less-invasive method – computer-assisted photographic identification (photoID) – in endangered Jollyville Plateau salamanders (Eurycea tonkawae), a species with a known range limited to eight stream drainages in central Texas. We based photoID on the unique pigmentation patterns on the dorsal head region of 1215 individual salamanders using identification software Wild-ID. We compared the performance of photoID methods to VIEs using both ‘high-quality’ and ‘low-quality’ images, which were taken using two different camera types and technologies. For high-quality images, the photoID method had a false rejection rate of 0.76% compared to 1.90% for VIEs. Using a comparable dataset of lower-quality images, the false rejection rate was much higher (15.9%). Photo matching scores were negatively correlated with time between captures, suggesting that evolving natural marks could increase misidentification rates in longer term capture-recapture studies. Our study demonstrates the utility of large-scale capture-recapture using photo identification methods for Eurycea and other species with stable natural marks that can be reliably photographed. PMID:23555669

  18. Environmental correlates of species and genetic richness in lungless salamanders (family plethodontidae)

    NASA Astrophysics Data System (ADS)

    Marshall, Jeremy L.; Camp, Carlos D.

    2006-01-01

    Biological diversity is distributed across the planet in non-random, organised ways. At the species level, numerous environmental variables have been proposed to explain this non-random distribution with available energy and habitat heterogeneity receiving the most empirical support. With regard to genetic organisation, environmental stress and habitat heterogeneity have been widely supported. However, few studies have addressed if these two scales of biological organisation are structured via similar processes. Here, we tested whether or not the distributional organisation of genetic and species richness were driven by similar environmental variables for salamanders of the family Plethodontidae across North America. In general, we found that those environmental variables related to energy, particularly energy made accessible to salamanders via the actions of available moisture, were the primary determinants of both genetic and species richness. This finding is consistent with both the "more individuals hypothesis" of species richness and neutral-theory expectations for genetic richness. Additionally, greater habitat heterogeneity, as measured by increased topographic variance, was of secondary importance in positively influencing species richness, although its effects on genetic richness were far more variable. In total, our results suggest that both of these scales of biological organisation are influenced by similar environmental variables, even though increased genetic richness at the population-level does not always translate into greater species richness.

  19. Calculating biologically accurate mitigation credits: insights from the California tiger salamander.

    PubMed

    Searcy, Christopher A; Shaffer, H Bradley

    2008-08-01

    Current conservation mitigation plans often fail to ensure full in-kind habitat replacement for endangered species, which suggests the need for improved methods for calculating mitigation credits. A simple, yet biologically meaningful method for calculating mitigation credits would be to let the number of mitigation credits assigned to a parcel of land scale with the reproductive value of the individuals occupying that parcel. This can be accomplished by dividing the population into 2 or more subdivisions with different reproductive values, calculating the densities of these subdivisions as a function of one or more habitat parameters, and then forming a weighted sum of these densities such that each density distribution is weighted by the reproductive value of its respective subdivision of the population. This weighted sum is the density distribution of reproductive value, and by integrating it over a particular parcel, one can determine the mitigation value of that parcel. We carried out this procedure for a population of California tiger salamanders (Ambystoma californiense), with distance from breeding site as our habitat parameter and the 3 visually identifiable age classes (adults, juveniles, and metamorphs) as our population subdivisions. This led to a density distribution of reproductive value that decreased exponentially with increasing distance from a breeding site. Mitigation strategies derived from this function will be more likely to ensure the persistence of California tiger salamander populations than current approaches, which assign all land within 1.6 km of a breeding site the same mitigation value. Use of the density distribution of reproductive value as a basis for mitigation plans is a procedure that can be applied to all endangered species, and it should improve the quality of mitigation decisions.

  20. Phylogeography and evolution of the Red Salamander (Pseudotriton ruber).

    PubMed

    Folt, Brian; Garrison, Nicole; Guyer, Craig; Rodriguez, Juanita; Bond, Jason E

    2016-05-01

    Phylogeographic studies frequently result in the elevation of subspecific taxa to species given monophyly, or the synonymy of subspecies that are not monophyletic. However, given limited or incongruent datasets, retention of subspecies can be useful to describe hypothesized incipient species or to illustrate interesting biological phenomena driving morphological diversity. Four subspecific taxa have been used to describe largely allopatric geographic variation within the species Pseudotriton ruber, a plethodontid salamander occupying stream and spring habitats across eastern North America: P. r. vioscai occurs in lowland Coastal Plain habitats, while P. r. ruber, P. r. nitidus, and P. r. schencki occupy upland regions in and around the Appalachian Mountains. Pseudotriton ruber co-occurs through its distribution with the aposematic newt Notophthalmus viridescens, and both species are hypothesized to be part of a Müllerian mimicry complex. In this study, we sequenced regions of two mitochondrial (cytochrome b, NADH dehydrogenase subunit 2) and one single copy nuclear protein-coding gene (pro-opiomelanocortin) from individuals sampled across much of the distribution of P. ruber and then used maximum-likelihood and Bayesian phylogenetic inference to test the monophyly of subspecies, reconstruct biogeographic history, and make inferences about morphological evolution. Phylogeographic hypotheses from mitochondrial and nuclear datasets described structure among populations of P. ruber which separated Coastal Plain and upland Appalachian populations, but subspecies were not monophyletic. Biogeographic reconstruction estimated the ancestor of all populations to have occupied and initially diverged in the Coastal Plain during the Pliocene (∼3.6mya), before one lineage subsequently invaded upland areas of Appalachia. Bold bright coloration of high elevation subspecies P. r. nitidus and P. r. schencki appears to have evolved twice. We hypothesize that the Müllerian mimicry

  1. Marble bowing: comparative studies of three different public building facades

    NASA Astrophysics Data System (ADS)

    Siegesmund, S.; Ruedrich, J.; Koch, A.

    2008-12-01

    The veneer cladding of the Oeconomicum (OEC, Göttingen), the State Theatre of Darmstadt (STD, Darmstadt) and of the State and University Library (SUB, Göttingen) is characterised by pronounced bowing after a short time of exposure. Direct comparison of bowing data related to measurements from 2000 to 2003 at the SUB clearly show that the amplitude in bowing had significantly increased. The bowing is different in intensity and orientation (concave, convex). The cladding material (Peccia marble, Rosa Estremoz marble and Carrara marble) are different in lattice preferred orientation, grain size distribution and grain interlocking. Depending on the bowing, panels may show cracks mostly initiated at the dowels. The percentage of visible cracks and breakouts increases with the amplitude of bowing except for the STD. Repetitive heating-cooling under dry conditions leads to considerable inelastic residual strain only after the first or second thermal cycle. The residual strain continuously increases again if water is present, whereby the moisture content after a thermal cycle has a certain impact on the decay rate. The water-enhanced thermal dilatation strongly correlates with the deterioration rate obtained from the laboratory bow test. Detailed petrophysical investigations provide evidence that with increasing bowing a decrease of mechanical properties (flexural strength or breaking load at dowel hole) occur. Marble degradation is also connected with the increase in porosity and a general shift of the maximum pore radii to larger pore sizes. On-site damage analyses were combined with laboratory tests of the bowing potential to constrain factors that may influence the risk failure. The experimental bowing data clearly demonstrate that after 40 heating cycles combined with the effect of moisture a certain impact on the decay rate is observed. In the case of demounted panels the bowing tests show that already strongly deformed panels from the building exhibit a lower

  2. The romanesque marble portals of Schloss Tirol/Italy

    NASA Astrophysics Data System (ADS)

    Recheis, A.; Bidner, Th.; Hauser, W.; Mirwald, P. W.

    2003-04-01

    Marble artifacts are confronted with two kinds of problems: i) weathering, which is a task for material conservation research, ii) unclear provenance which creates problems with respect to historical interpretations. An art historically very prominent example are the two romanesque marble portals of Schloß Tyrol/ South Tyrol/Italy, the Palas portal at the entrance sheltered by a canopy and the Chapel portal leading directly from the palas hall into the chapel. Stilistic criteria and historical sources date them into the 12th century (1). The performed study concerned a detailed macroscopic mapping and ultrasonic work (2) as well as petrographical and chemical investigations on some very small drill core samples. The map-ping and ultrasonic work revealed that the Palas portal is significantly more weathered and damaged than the chapel portal. At first glance this finding seems consistent with the location of the objects. However, even if a reported period of some 120 years of unsheltered free exposure of the Palas portal after its construction is taken into account, the weathering impacts are too severe (5). A fire catastrophy documented around 1300 might be considered the relevant damage event. This again sheds some light on the specific history of the well preserved Chapel portal: stylistically both portals are contemporaneous, so one may assume that it had been taken from another locality and was built in later. A potential candidate for this is a karolingian church (7-8th century) outside the castle-complex of which the relics have been excavated recently. This picture is substantiated by the results of the material investigations (grain size, chemistry and C, O isotopes (3)) suggesting different provenance of the marbles of the two portals. Comparative studies on the regional marbles speak in favour for Laas Marble for the Palas portal and Sterzing Marble for the Chapel portal (4). The study is continued with a detailed investigation on the supposed fire

  3. Analysis of climatic factors influencing migrations of the salamander Ambystoma talpoideum

    SciTech Connect

    Semlitsch, R.D.

    1985-01-01

    Migrations of breeding adult and metamorphosing juvenile mole salamanders, Ambystoma talpoideum, were studied in five populations in South Carolina from September 1978 through July 1982. Onset of breeding immigrations occurred as early as September but migrations ''en masse'' did not occur until November, December, or January. Time of peak migration varied annually depending upon meteorological conditions. Total number of breeding adults or breeding population size, was significantly correlated with cumulative rainfall during the time of immigration. Sex ratio of immigrating adults was significantly biased towards males at the beginning of the breeding season whereas by the end of the season it was biased towards females. During the very dry year of 1980 - 1981 water levels in two relatively permanent breeding sites were substantially metamorphosis and emigration of sexually mature gilled morphs. Statistical models which predict the magnitude of migrations indicated that rainfall, water level, and minimum air temperature were consistently important environmental variables.

  4. Digit reduction, body size, and paedomorphosis in salamanders.

    PubMed

    Wiens, John J; Hoverman, Jason T

    2008-01-01

    The loss of digits is a widespread evolutionary trend in tetrapods which occurs in nearly every major clade. Alberch and Gale showed that the order in which digits are evolutionarily lost in salamanders versus frogs corresponds to the order in which they develop in each group, providing a classic example of developmental constraint. However, what actually drives the loss of digits in salamanders has remained unclear. Alberch and Gale suggested that loss of digits might be associated with paedomorphosis or with reduced body size. We test these hypotheses by combining morphometric and phylogenetic information for 98 species of salamanders. We find that digit loss is associated with both paedomorphosis and reduction in body size. However, these trends are surprisingly contradictory, in that paedomorphosis is significantly associated with an increase in body size in salamanders. Thus, much of the extreme digit reduction is found in the smaller species within paedomorphic clades that have, on average, unusually large body size. Our results show that the consequences of changes in body size on morphology are highly context dependent. We also show (possibly for the first time) a significant association between paedomorphosis and increased body size, rather than the expected association with reduced body size.

  5. Laboratory testing of sealants with a marble substrate

    SciTech Connect

    Farmer, M.C.; Cechner, R.A.

    1996-12-31

    Polyurethane and silicone sealants are widely specified for installations with porous substrates such as some stones. However, when a sealant is used against such surfaces, there is a potential for a lack of adequate adhesion, or staining of the tone by misapplication or migration of the liquid components of the sealant system, such as primers or plasticizers in the formulation. Some varieties of marble in particular have been reported to be susceptible to staining and discoloration over time from sealants. Application of new sealant over existing sealants is also of great concern for remedial applications. Determining the level of substrate preparation necessary to achieve adequate bond is critical to the success of the remedial construction project. This paper discusses the development and results of a test program conducted to determine the relative performance of sealants installed on a white marble substrate. The tests performed included wet adhesion tests, accelerated weathering studies, and staining due to plasticizer migration.

  6. Radiation Shielding Properties of Some Marbles in Turkey

    SciTech Connect

    Guenoglu, K.; Akkurt, I.

    2011-12-26

    Especially after development of technology, radiation started to be used in a large fields such as medicine, industry and energy. Using radiation in those fields bring hazardous effect of radiation into humancell. Thus radiation protection becomes important in physics. Although there are three ways for radiation protection, shielding of the radiation is the most commonly used method. Natural Stones such as marble is used as construction material especially in critical building and thus its radiation shielding capability should be determined.In this study, gamma ray shielding properties of some different types of marble mined in Turkey, have been measured using a NaI(Tl) scintillator detector. The measured results were also compared with the theoretical calculations XCOM.

  7. Levitation-free vibrated droplets: resonant oscillations of liquid marbles.

    PubMed

    McHale, G; Elliott, S J; Newton, M I; Herbertson, D L; Esmer, K

    2009-01-06

    A spherical conducting droplet in an alternating electric field is known to undergo shape oscillations. When the droplet is supported by a substrate, the shape is no longer a complete sphere, but shape resonances are still observed. To obtain a completely spherical droplet, some kind of levitation is needed, unless the droplet is in microgravity, and this has previously been provided by gas films or magnetic or other external forces. In this work, we report observations of shape oscillations of a hydrophobic-powder-coated droplet of water. A droplet of water rolled on a hydrophobic powder self-coats such that the water becomes encapsulated as a liquid marble. When the powder is a spherical hydrophobic grain with a contact angle greater than 90 degrees , it adheres to the solid-water interface with more than half of its diameter projecting from the liquid, thus ensuring the encapsulated water does not come into contact with any substrate. These liquid marbles are highly mobile and can be regarded as completely nonwetting droplets possessing contact angles of 180 degrees . In this work, we show that they also provide a new mechanism equivalent to levitating droplets and provide droplets with small contact areas and completely mobile contact lines for studies of shape oscillations. Liquid marbles were created using hydrophobic lycopodium and droplets of water containing potassium chloride and were excited into motion using an electrowetting-on-dielectric configuration with applied frequency swept from 1 to 250 Hz. Both an up-and-down motion and an oscillation involving multiple nodes were observed and recorded using a high-speed camera. The resonant oscillation modes of small liquid marbles were fitted to the theory for vibrations of a free spherical volume of fluid. This work demonstrates the principle that oscillation modes of completely nonwetting droplets can be studied using a simple powder coating approach without the need for an active mechanism for levitation.

  8. Geographic variation, genetic structure and conservation unit designation in the larch mountain salamander( Plethodon larselli)

    USGS Publications Warehouse

    Wagner, R.S.; Miller, Mark P.; Crisafulli, Charles; Haig, Susan M.

    2005-01-01

    The Larch Mountain salamander (Plethodon larselli Burns, 1954) is an endemic species in the Pacific northwestern United States facing threats related to habitat destruction. To facilitate development of conservation strategies, we used DNA sequences and RAPDs (random amplified polymorphic DNA) to examine differences among populations of this species. Phylogenetic analyses of cytochrome b revealed a clade of haplotypes from populations north of the Columbia River derived from a clade containing haplotypes from the river's southwestern region. Haplotypes from southeastern populations formed a separate clade. Nucleotide diversity was reduced in northern populations relative to southern populations. These results were corroborated by analyses of RAPD loci, which revealed similar patterns of clustering and diversity. Network analyses suggested that northern populations were colonized following a range expansion mediated by individuals from populations located southwest of the river. Changes in the Columbia River's location during the Pliocene and Pleistocene likely released distributional constraints on this species, permitting their northern range expansion. Based on the barrier presented by the Columbia River's present location and differences in haplotype diversity and population structure observed between northern and southern populations, we suggest that designation of separate management units encompassing each region may assist with mitigating different threats to this species.

  9. Slow DNA loss in the gigantic genomes of salamanders.

    PubMed

    Sun, Cheng; López Arriaza, José R; Mueller, Rachel Lockridge

    2012-01-01

    Evolutionary changes in genome size result from the combined effects of mutation, natural selection, and genetic drift. Insertion and deletion mutations (indels) directly impact genome size by adding or removing sequences. Most species lose more DNA through small indels (i.e., ~1-30 bp) than they gain, which can result in genome reduction over time. Because this rate of DNA loss varies across species, small indel dynamics have been suggested to contribute to genome size evolution. Species with extremely large genomes provide interesting test cases for exploring the link between small indels and genome size; however, most large genomes remain relatively unexplored. Here, we examine rates of DNA loss in the tetrapods with the largest genomes-the salamanders. We used low-coverage genomic shotgun sequence data from four salamander species to examine patterns of insertion, deletion, and substitution in neutrally evolving non-long terminal repeat (LTR) retrotransposon sequences. For comparison, we estimated genome-wide DNA loss rates in non-LTR retrotransposon sequences from five other vertebrate genomes: Anolis carolinensis, Danio rerio, Gallus gallus, Homo sapiens, and Xenopus tropicalis. Our results show that salamanders have significantly lower rates of DNA loss than do other vertebrates. More specifically, salamanders experience lower numbers of deletions relative to insertions, and both deletions and insertions are skewed toward smaller sizes. On the basis of these patterns, we conclude that slow DNA loss contributes to genomic gigantism in salamanders. We also identify candidate molecular mechanisms underlying these differences and suggest that natural variation in indel dynamics provides a unique opportunity to study the basis of genome stability.

  10. On trajectories of rolling marbles in cones and other funnels

    NASA Astrophysics Data System (ADS)

    White, Gary D.

    2013-12-01

    We report on theoretical and experimental results for a ball that rolls without slipping on a surface of revolution, whose symmetry axis is aligned with a uniform gravitational field, particularly investigating both near-circular orbits and scattering-type orbits in cones. The experimental data give support for the theoretical treatment, a non-trivial application of Newton's second law that expands on our previous work and related work of others. Our findings refine those from a recent article in this journal, and largely replicate those obtained from an earlier Lagrangian approach, adding some new details and commentary. While the orbits of marbles rolling in cones do not match inverse-square-law orbits quantitatively (e.g., instead of Kepler's 3rd law, we have T2∝R), we argue that students should experience these qualitative phenomena—precession of orbits, escape velocity behavior, spin-orbit coupling, conservation laws for angular momentum, energy, and spin projection—as much for the fun and kinesthetic impressions as for the raw learning. We also report on a heretofore largely ignored variable in the exploration of rolling orbits in a gravity well: the marble's spin about its own axis as it rolls. Experimenters can, intentionally or not, vary this initial condition and produce different orbital periods for a given orbital radius—a distinctly non-celestial behavior. Careful selection of the initial spin direction and speed for a particular cone can result in marble orbits that mimic the planetary ellipses.

  11. MARBLE: A system for executing expert systems in parallel

    NASA Technical Reports Server (NTRS)

    Myers, Leonard; Johnson, Coe; Johnson, Dean

    1990-01-01

    This paper details the MARBLE 2.0 system which provides a parallel environment for cooperating expert systems. The work has been done in conjunction with the development of an intelligent computer-aided design system, ICADS, by the CAD Research Unit of the Design Institute at California Polytechnic State University. MARBLE (Multiple Accessed Rete Blackboard Linked Experts) is a system of C Language Production Systems (CLIPS) expert system tool. A copied blackboard is used for communication between the shells to establish an architecture which supports cooperating expert systems that execute in parallel. The design of MARBLE is simple, but it provides support for a rich variety of configurations, while making it relatively easy to demonstrate the correctness of its parallel execution features. In its most elementary configuration, individual CLIPS expert systems execute on their own processors and communicate with each other through a modified blackboard. Control of the system as a whole, and specifically of writing to the blackboard is provided by one of the CLIPS expert systems, an expert control system.

  12. Weathering rates of marble in laboratory and outdoor conditions

    SciTech Connect

    Yerrapragada, S.S.; Chirra, S.R.; Jaynes, J.H.; Bandyopadhyay, J.K.; Gauri, K.L.; Li, S.

    1996-09-01

    In the modern urban atmosphere SO{sub 2} and NO{sub 2} attack calcite (CaCO{sub 3}) in marble exposed at rain-sheltered surfaces creating largely gypsum (CaSO{sub 4}{center_dot}2H{sub 2}O) crusts that eventually exfoliate. In combination with CO{sub 2} these gases erode the marble at unsheltered surfaces. the authors report the development of mathematical models to predict the rate of growth of crust and the rate of surface recession. To determine the rate of growth of crust the kinetic rate constant, diffusion rate, and the order of reaction were determined by the application of the shrinking-core model applied to data generated in laboratory experiments. Based on these parameters /and average ambient levels of 10 parts per billion (ppb) SO{sub 2} and 25 ppb NO{sub 2} in Louisville, Ky., the rate of crust formation for this metro area was calculated to be 1.8 {micro}m in the first year. However, the rate of recession was modeled from data obtained by exposing marble slabs to rainfalls. A surface recession of 15 {micro}m/yr was calculated. The models predicted well the rate of growth of crust observed at several sites in Louisville and the predicted surface recession compared well with values reported in the literature.

  13. Can the eastern red-backed salamander (Plethodon cinereus) persist in an acidified landscape?

    USGS Publications Warehouse

    Bondi, Cheryl A; Beier, Colin M.; Ducey, Peter K; Lawrence, Gregory B.; Bailey, Scott W.

    2016-01-01

    Hardwood forests of eastern North America have experienced decades of acidic deposition, leading to soil acidification where base cation supply was insufficient to neutralize acid inputs. Negative impacts of soil acidity on amphibians include disrupted embryonic development, lower growth rates, and habitat loss. However, some amphibians exhibit intraspecific variation in acid tolerance, suggesting the potential for local adaptation in areas where soils are naturally acidic. The eastern red-backed salamander (Plethodon cinereus) is a highly abundant top predator of the northern hardwood forest floor. Early research found that P. cinereus was sensitive to acidic soils, avoiding substrates with pH < 3.8 and experiencing decreased growth rates in acidic habitats. However, recent studies have documented P. cinereus populations in lower pH conditions than previously observed, suggesting some populations may persist in acidic conditions. Here, we evaluated relationships between organic horizon soil pH and P. cinereus abundance, adult health (body size and condition), and microhabitat selection, based on surveys of 34 hardwood forests in northeastern United States that encompass a regional soil pH gradient. We found no associations between soil pH and P. cinereus abundance or health, and observed that this salamander used substrates with pH similar to that available, suggesting that pH does not mediate their fine-scale distributions. The strongest negative predictor of P. cinereus abundance was the presence of dusky salamanders (Desmognathus spp.), which were most abundant in the western Adirondacks. Our results indicate that P. cinereus occupies a wider range of soil pH than has been previously thought, which has implications for their functional role in forest food webs and nutrient cycles in acid-impaired ecosystems. Tolerance of P. cinereus for more acidic habitats, including anthropogenically acidified forests, may be due to local adaptation in

  14. Light-Driven Transport of a Liquid Marble with and against Surface Flows.

    PubMed

    Kavokine, Nikita; Anyfantakis, Manos; Morel, Mathieu; Rudiuk, Sergii; Bickel, Thomas; Baigl, Damien

    2016-09-05

    Liquid marbles, that is, liquid drops coated by a hydrophobic powder, do not wet any solid or liquid substrate, making their transport and manipulation both highly desirable and challenging. Herein, we describe the light-driven transport of floating liquid marbles and emphasize a surprising motion behavior. Liquid marbles are deposited on a water solution containing photosensitive surfactants. Irradiation of the solution generates photoreversible Marangoni flows that transport the liquid marbles toward UV light and away from blue light when the thickness of the liquid substrate is large enough (Marangoni regime). Below a critical thickness, the liquid marbles move in the opposite direction to that of the surface flow at a speed increasing with decreasing liquid thickness (anti-Marangoni). We demonstrate that the anti-Marangoni motion is driven by the free surface deformation, which propels the non-wetting marble against the surface flow. We call this behavior "slide effect".

  15. Fluctuations in a metapopulation of nesting four-toed salamanders, Hemidactylium scutatum, in the Great Smoky Mountains National Park, USA, 1999-2003

    USGS Publications Warehouse

    Corser, J.D.; Dodd, C.K.

    2004-01-01

    We tested two predictions associated with the hypothesis that certain populations of pond-breeding amphibians are structured into metapopulations using minimum relative abundance estimates of nesting four-toed salamanders (Hemidactylium scutatum Schlegel) from 11 different ponds in the Great Smoky Mountains National Park. Coefficients of variation (CV) for counts at individual ponds ranged from 0.25 to 1.26, and the overall mean CV at all 11 ponds was 0.34. Many pairs of ponds had negative correlations in abundance from 1999-2003, whereas others had various degrees of positive correlation (mean r = 0.29). Thus, nesting population size fluctuated semi-independently among the ponds from year to year, inferring the existence of inter-pond dispersal. The mean number of nesting females at a pond was negatively, but non-significantly, correlated (r = -0.27; P = 0.40; 10 d.f.) to the pond's isolation. Owing to physiological constraints on plethodontid salamander energetics, precipitation during the nesting season (February and March) appeared to play an important role (r = 0.78; P = 0.12; 4 d.f.) in the number of nesting females we observed. Unlike some other plethodontid salamander populations in more fragmented southern Appalachian forest ecosystems, this (meta)population within Great Smoky Mountains National Park does not appear to be declining.

  16. The effects of 24-h exposure to carbaryl or atrazine on the locomotor performance and overwinter growth and survival of juvenile spotted salamanders (Ambystoma maculatum).

    PubMed

    Mitchkash, Matthew G; McPeek, Tammy; Boone, Michelle D

    2014-03-01

    Understanding the effects of pesticide exposure on organisms throughout their life cycle is critical to predict population-level effects. For many taxa, including amphibians, juveniles are the main dispersal stage and are disproportionally important to population persistence when compared with other life stages. In the present study, we examined the effects of a single 24-h exposure to the insecticide carbaryl or the herbicide atrazine on locomotor performance (endurance, distance traveled, speed, and fatigue) in the laboratory and terrestrial growth and survival through overwintering in field enclosures using recent metamorphs of spotted salamanders (Ambystoma maculatum). We found that neither atrazine nor carbaryl impacted endurance, but fatigue increased with carbaryl exposure, which could leave salamanders less able to escape repeated attacks by predators. Terrestrial growth and overwinter survival were not affected by short-term exposure to carbaryl or atrazine, suggesting that when individuals can overcome acute effects, no long-term consequences result for the endpoints measured.

  17. Magnetic Anisotropy in Carbonate Rocks: Revisiting the Carrara Marble

    NASA Astrophysics Data System (ADS)

    Schmidt, V.; Hirt, A. M.; Leiss, B.; Piguet, P.; Burlini, L.

    2003-12-01

    Magnetic anisotropy has been used in numerous investigations since the 1950's as an indicator of petrofabric. In deformed rocks the anisotropy of magnetic susceptibility (AMS) has been shown to qualitatively, and sometimes quantitatively reflect finite strain. In low-field AMS all minerals contribute to the measured anisotropy. Over the past years several methods have been used to isolate different components to the AMS. Various high-field methods are used to separate the paramagnetic, diamagnetic and high coercivity antiferromagnetic components from the ferrimagnetic component. In spite of these advances, our understanding of the factors controlling the total AMS signal in a rock remains limited, which has hampered the quantitative use of magnetic fabrics in deformation studies. This is partly due to the limited data available on the intrinsic anisotropy of single mineral crystals. Calcite is one mineral whose AMS is well-determined. Earlier studies have shown that the magnetic fabric in deformed pure marble can be related to the crystallographic orientation of the calcite crystals (Owens and Rutter, 1978, PEPI, 16 2115; deWall et al., 2000, J. Struct. Geol., 22, 1761). De Wall et al (2000) were able to model quantitatively the AMS from the mineral fabric and AMS of calcite for coarse-grained marbles, but were less successful for fine-grained ones. In this study we have used low-field AMS and high-field torque magnetometry to isolate the diamagnetic signal of Carrara marbles. The magnetic fabric has been compared with the calcite fabric in the rocks. Preliminary results will be presented of synthetic calcite aggregates prepared from Carrara marble powder, which was initially uniaxially cold pressed at different amount of load, in order to induce a c-axis maximum type of fabric of various strength, and compare it with the magnetic anisotropy. This was later Hot Isostatic Pressed at about 150 MPa and 700° C to reduce porosity and increase/homogenize the grain

  18. Reinforcement of natural rubber hybrid composites based on marble sludge/Silica and marble sludge/rice husk derived silica

    PubMed Central

    Ahmed, Khalil; Nizami, Shaikh Sirajuddin; Riza, Nudrat Zahid

    2013-01-01

    A research has been carried out to develop natural rubber (NR) hybrid composites reinforced with marble sludge (MS)/Silica and MS/rice husk derived silica (RHS). The primary aim of this development is to scrutinize the cure characteristics, mechanical and swelling properties of such hybrid composite. The use of both industrial and agricultural waste such as marble sludge and rice husk derived silica has the primary advantage of being eco-friendly, low cost and easily available as compared to other expensive fillers. The results from this study showed that the performance of NR hybrid composites with MS/Silica and MS/RHS as fillers is extremely better in mechanical and swelling properties as compared with the case where MS used as single filler. The study suggests that the use of recently developed silica and marble sludge as industrial and agricultural waste is accomplished to provide a probable cost effective, industrially prospective, and attractive replacement to the in general purpose used fillers like china clay, calcium carbonate, and talc. PMID:25685484

  19. Reinforcement of natural rubber hybrid composites based on marble sludge/Silica and marble sludge/rice husk derived silica.

    PubMed

    Ahmed, Khalil; Nizami, Shaikh Sirajuddin; Riza, Nudrat Zahid

    2014-03-01

    A research has been carried out to develop natural rubber (NR) hybrid composites reinforced with marble sludge (MS)/Silica and MS/rice husk derived silica (RHS). The primary aim of this development is to scrutinize the cure characteristics, mechanical and swelling properties of such hybrid composite. The use of both industrial and agricultural waste such as marble sludge and rice husk derived silica has the primary advantage of being eco-friendly, low cost and easily available as compared to other expensive fillers. The results from this study showed that the performance of NR hybrid composites with MS/Silica and MS/RHS as fillers is extremely better in mechanical and swelling properties as compared with the case where MS used as single filler. The study suggests that the use of recently developed silica and marble sludge as industrial and agricultural waste is accomplished to provide a probable cost effective, industrially prospective, and attractive replacement to the in general purpose used fillers like china clay, calcium carbonate, and talc.

  20. Sound production in marbled rockfish (Sebastiscus marmoratus) and implications for fisheries.

    PubMed

    Zhang, Xuguang; Guo, Hongyi; Zhang, Shouyu; Song, Jiakun

    2015-01-01

    Recently, several rockfish species (genus Sebastes) have been reported to be soniferous. To determine whether an additional rockfish species produces sounds, passive acoustic recordings were analyzed from captive marbled rockfish (Sebastiscus marmoratus) during the non-spawning season. Three distinct sounds were identified based on frequency features. The common characteristics among all sounds were low frequency (below 300 Hz) and rapidly dampened pulses consisting of 3-5 acoustic energy cycles. During free-swimming conditions in the canvas tank, the fish produced voluntary sounds with lower frequencies than the disturbance sounds produced by individuals during prodding. Two types of sounds were identified in the disturbance context: one type consists of single or double pulses with two peak frequencies, and another type consists of a series of pulses with a single peak frequency. These results suggest that specific-species and behavior-associated sounds are potentially useful in passive acoustical surveys to monitor rockfish populations and distributions remotely.

  1. Measuring the Coefficient of Friction of a Small Floating Liquid Marble

    PubMed Central

    Ooi, Chin Hong; Nguyen, Anh Van; Evans, Geoffrey M.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-01-01

    This paper investigates the friction coefficient of a moving liquid marble, a small liquid droplet coated with hydrophobic powder and floating on another liquid surface. A floating marble can easily move across water surface due to the low friction, allowing for the transport of aqueous solutions with minimal energy input. However, the motion of a floating marble has yet to be systematically characterised due to the lack of insight into key parameters such as the coefficient of friction between the floating marble and the carrier liquid. We measured the coefficient of friction of a small floating marble using a novel experimental setup that exploits the non-wetting properties of a liquid marble. A floating liquid marble pair containing a minute amount magnetite particles were immobilised and then released in a controlled manner using permanent magnets. The capillarity-driven motion was analysed to determine the coefficient of friction of the liquid marbles. The “capillary charge” model was used to fit the experimental results. We varied the marble content and carrier liquid to establish a relationship between the friction correction factor and the meniscus angle. PMID:27910916

  2. Measuring the Coefficient of Friction of a Small Floating Liquid Marble.

    PubMed

    Ooi, Chin Hong; Nguyen, Anh Van; Evans, Geoffrey M; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-12-02

    This paper investigates the friction coefficient of a moving liquid marble, a small liquid droplet coated with hydrophobic powder and floating on another liquid surface. A floating marble can easily move across water surface due to the low friction, allowing for the transport of aqueous solutions with minimal energy input. However, the motion of a floating marble has yet to be systematically characterised due to the lack of insight into key parameters such as the coefficient of friction between the floating marble and the carrier liquid. We measured the coefficient of friction of a small floating marble using a novel experimental setup that exploits the non-wetting properties of a liquid marble. A floating liquid marble pair containing a minute amount magnetite particles were immobilised and then released in a controlled manner using permanent magnets. The capillarity-driven motion was analysed to determine the coefficient of friction of the liquid marbles. The "capillary charge" model was used to fit the experimental results. We varied the marble content and carrier liquid to establish a relationship between the friction correction factor and the meniscus angle.

  3. Measuring the Coefficient of Friction of a Small Floating Liquid Marble

    NASA Astrophysics Data System (ADS)

    Ooi, Chin Hong; Nguyen, Anh Van; Evans, Geoffrey M.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-12-01

    This paper investigates the friction coefficient of a moving liquid marble, a small liquid droplet coated with hydrophobic powder and floating on another liquid surface. A floating marble can easily move across water surface due to the low friction, allowing for the transport of aqueous solutions with minimal energy input. However, the motion of a floating marble has yet to be systematically characterised due to the lack of insight into key parameters such as the coefficient of friction between the floating marble and the carrier liquid. We measured the coefficient of friction of a small floating marble using a novel experimental setup that exploits the non-wetting properties of a liquid marble. A floating liquid marble pair containing a minute amount magnetite particles were immobilised and then released in a controlled manner using permanent magnets. The capillarity-driven motion was analysed to determine the coefficient of friction of the liquid marbles. The “capillary charge” model was used to fit the experimental results. We varied the marble content and carrier liquid to establish a relationship between the friction correction factor and the meniscus angle.

  4. Georgia marble at the Minnesota State Capitol The Effects of Mineralogy and Climate on Durability

    NASA Astrophysics Data System (ADS)

    Whitenack, Paul; Shotwell, L. Brad; Scheffler, Michael J.

    2016-11-01

    Based on visual observations and tests made of Georgia marble units that have been in service at the historic Minnesota State Capitol for 110 years, a fielddiscernible correlation exists between marble unit mineralogical composition and unit weathering performance. Field studies noted over the course of a five-year restoration project of the capitol exterior were used to categorize the original marble cladding into four perceptible types, which were evaluated by field testing that suggested a correlation between the textural and mineralogical differences within the marble and its long-term durability. To test this theory, field-issued repair assignments made during an exterior marble restoration project at the capitol were examined statistically. The nature and frequency of assigned repairs were compared to the type of marble from which they were originally fabricated to determine whether a correlation existed. The results of this comparison provided convincing statistical verification of the link between mineralogy and durability. This hypothesis was then verified through detailed petrographic analysis in a laboratory setting, which determined that marble consisting of a smaller, more interlocked grain configuration that was more dolomitic than calcitic in its basic chemistry consistently proved to be more durable in weathering performance over time. The paper describes the process followed by the authors to categorize and study the distinct varieties of Georgia marble present on the Minnesota State Capitol, and how this information was used to guide the restoration process with the intent of maximizing the anticipated service life of new marble replacements.

  5. High occupancy of stream salamanders despite high ranavirus prevalence in a southern appalachians watershed.

    PubMed

    Rothermel, Betsie B; Travis, Emilie R; Miller, Debra L; Hill, Robert L; McGuire, Jessica L; Yabsley, Michael J

    2013-06-01

    The interactive effects of environmental stressors and emerging infectious disease pose potential threats to stream salamander communities and their headwater stream ecosystems. To begin assessing these threats, we conducted occupancy surveys and pathogen screening of stream salamanders (Family Plethodontidae) in a protected southern Appalachians watershed in Georgia and North Carolina, USA. Of the 101 salamanders screened for both chytrid fungus (Batrachochytrium dendrobatidis) and Ranavirus, only two exhibited low-level chytrid infections. Prevalence of Ranavirus was much higher (30.4% among five species of Desmognathus). Despite the ubiquity of ranaviral infections, we found high probabilities of site occupancy (≥0.60) for all stream salamander species.

  6. Dusky salamanders (Desmognathus, Plethodontidae) from the Coastal Plain: multiple independent lineages and their bearing on the molecular phylogeny of the genus.

    PubMed

    Beamer, David A; Lamb, Trip

    2008-04-01

    Recent phylogenetic reassessment of the lungless salamanders (Plethodontidae) confirmed a major life-history reversal-from direct development to an aquatic larval stage-in the dusky salamanders (Desmognathus) of eastern North America. This reversal initiated high rates of lineage accumulation, reputedly generating the species richness and ecological breath that now characterize Desmognathus. Certain important aspects of the radiation, e.g., ecomorphological evolution, have been identified through intense sampling effort of Appalachian Highland lineages. However, the research preoccupation on montane species has left overlooked a significant component of dusky salamander distribution-the Coastal Plain. We present the first molecular phylogeny for Desmognathus to incorporate extensive coverage from the Atlantic and Gulf coastal plains. We examined 38 Coastal Plain populations in conjunction with 45 additional populations, representing 16 of the 19 nominal species. Bayesian analysis of 88 mitochondrial cox1 haplotypes diagnosed eight independent population lineages within the Coastal Plain, a number at odds with the region's three currently recognized species. Desmognathus has apparently experienced a complex biogeographic history in this physiographic region, one involving multiple invasions and several ecological transitions from lotic to lentic habitats.

  7. Detecting cryptic species in phylogeographic studies: speciation in the California Slender Salamander, Batrachoseps attenuatus.

    PubMed

    Highton, Richard

    2014-02-01

    A study of DNA sequence variation in the plethodontid salamander Batrachoseps attenuatus by Martínez-Solano et al. (2007) revealed more species than acknowledged by the authors. They sequenced 677 base pairs of the cytochrome-b mitochondrial gene in 178 individuals from 123 populations of the currently recognized species B. attenuatus from throughout most of its known range in southwestern Oregon and northern and central California. Their data show that the common ancestor of the species diverged into five clades during the late Miocene Epoch, an estimated 9.2-5.5 mya, with subsequent divergences producing at least 39 living lineages that replace each other geographically. These groups have been diverging independently from each other throughout the Pleistocene Epoch and many of them have probably reached the species level of divergence.

  8. Apparent predation by Gray Jays, Perisoreus canadensis, on Long-toed Salamanders, Ambystoma macrodactylum, in the Oregon Cascade Range

    USGS Publications Warehouse

    Murray, M.P.; Pearl, C.A.; Bury, R.B.

    2005-01-01

    We report observations of Gray Jays (Perisoreus canadensis) appearing to consume larval Long-toed Salamanders (Ambystoma macrodactylum) in a drying subalpine pond in Oregon, USA. Corvids are known to prey upon a variety of anuran amphibians, but to our knowledge, this is the first report of predation by any corvid on aquatic salamanders. Long-toed Salamanders appear palatable to Gray Jays, and may provide a food resource to Gray Jays when salamander larvae are concentrated in drying temporary ponds.

  9. Retention of low-fitness genotypes over six decades of admixture between native and introduced tiger salamanders

    PubMed Central

    2010-01-01

    Background Introductions of non-native tiger salamanders into the range of California tiger salamanders have provided a rare opportunity to study the early stages of secondary contact and hybridization. We produced first- and second-generation hybrid salamanders in the lab and measured viability among these early-generation hybrid crosses to determine the strength of the initial barrier to gene exchange. We also created contemporary-generation hybrids in the lab and evaluated the extent to which selection has affected fitness over approximately 20 generations of admixture. Additionally, we examined the inheritance of quantitative phenotypic variation to better understand how evolution has progressed since secondary contact. Results We found significant variation in the fitness of hybrids, with non-native backcrosses experiencing the highest survival and F2 hybrids the lowest. Contemporary-generation hybrids had similar survival to that of F2 families, contrary to our expectation that 20 generations of selection in the wild would eliminate unfit genotypes and increase survival. Hybrid survival clearly exhibited effects of epistasis, whereas size and growth showed mostly additive genetic variance, and time to metamorphosis showed substantial dominance. Conclusions Based on first- and second- generation cross types, our results suggest that the initial barrier to gene flow between these two species was relatively weak, and subsequent evolution has been generally slow. The persistence of low-viability recombinant hybrid genotypes in some contemporary populations illustrates that while hybridization can provide a potent source of genetic variation upon which natural selection can act, the sorting of fit from unfit gene combinations might be inefficient in highly admixed populations. Spatio-temporal fluctuation in selection or complex genetics has perhaps stalled adaptive evolution in this system despite selection for admixed genotypes within generations. PMID:20482794

  10. Salamander Blue-sensitive Cones Lost During Metamorphosis†

    PubMed Central

    Chen, Ying; Znoiko, Sergey; DeGrip, Willem J.; Crouch, Rosalie K.; Ma, Jian-xing

    2009-01-01

    The tiger salamander lives in shallow water with bright light in the aquatic phase, and in dim tunnels or caves in the terrestrial phase. In the aquatic phase, there are five types of photoreceptors—two types of rods and three types of cones. Our previous studies showed that the green rods and blue-sensitive cones contain the same visual pigment and have the same absorbance spectra; however, the green rods have a larger photon-catch area and thus have higher light sensitivity than the blue-sensitive cones. Here we show that after metamorphosis, the terrestrial salamander looses the blue-sensitive cones, while the density of the green rods increases. Moreover, the size of the green rod outer segments is increased in the terrestrial phase, compared to that in the aquatic phase. This switch from the blue-sensitive cones to the green rods may represent an adaptation to the dim light environment of the terrestrial phase. PMID:18331398

  11. Ecological radiation with limited morphological diversification in salamanders.

    PubMed

    Blankers, Thomas; Adams, D C; Wiens, J J

    2012-04-01

    A major goal of evolutionary biology is to explain morphological diversity among species. Many studies suggest that much morphological variation is explained by adaptation to different microhabitats. Here, we test whether morphology and microhabitat use are related in plethodontid salamanders, which contain the majority of salamander species, and have radiated into a striking diversity of microhabitats. We obtained microhabitat data for 189 species that also had both morphometric and phylogenetic data. We then tested for associations between morphology and microhabitat categories using phylogenetic comparative methods. Associations between morphology and ecology in plethodontids are largely confined to a single clade within one subfamily (Bolitoglossinae), whereas variation in morphology across other plethodontids is unrelated to microhabitat categories. These results demonstrate that ecological radiation and morphological evolution can be largely decoupled in a major clade. The results also offer a striking contrast to lizards, which typically show close relationships between morphology and microhabitat.

  12. Grain growth in synthetic marbles with added mica and water

    NASA Astrophysics Data System (ADS)

    Olgaard, D. L.; Evans, B.

    1988-10-01

    Evolution of grain size in synthetic marbles was traced from compaction of unconsolidated powder, through primary recrystallization and normal grain growth, to a size stabilized by second phases. To form the marbles, reagent grade CaCO3 was mixed with 0, 1 and 5 volume% mica and heat-treated under pressure with added water. Densification with negligible recrystallization occurred within one hour at 500° C and 500 MPa confining pressure. Primary recrystallization occurred at 500 550° C, causing increases of grain size of factors of 2 5. Resulting samples had uniform grain size, gently curved grain boundaries, and near-equilibrium triple junctions; they were used subsequently for normal grain growth studies. Normal grain growth occurred above 550° C; at 800° C, grain size ( D) increased from 7 μm ( D 0) to 65 μm in 24 hours. Growth rates fit the equation, D n - D {0/ n }= Kt, where K is a constant and n≃2.6. Minor amounts of pores or mica particles inhibit normal grain growth and lead to a stabilized grain size, D max, which depends on the size of the second phases and the inverse of their volume fraction raised to a power between 0.3 and 1. Once D max is reached, normal growth continues only if second phases are mobile or coarsen, or if new driving forces are introduced that cause unpinning of boundaries. Normal grain growth in Solnhofen limestone was significantly slower than in pure synthetic marble, suggesting that migration is also inhibited by second phases in the limestone.

  13. Transgranular Crack Nucleation in Carrara Marble of Brittle Failure

    NASA Astrophysics Data System (ADS)

    Cheng, Yi; Wong, Louis Ngai Yuen; Maruvanchery, Varun

    2016-08-01

    Understanding the microcrack nucleation is of a fundamental importance in the study of rock fracturing process. Due to variations in texture and mineralogy, different rocks may show different distinctive microcrack nucleation mechanisms. In order to understand the microcrack nucleation mechanisms in Carrara marble comprehensively, localized damage zones are artificially produced by loading specimens containing an array of en-echelon flaws in this study. Then, representative samples were cut from those loaded specimens and prepared for optical observation. Four types of microcrack nucleation mechanisms leading to the formation of transgranular cracks have been identified in Carrara marble. Type I and II mechanisms are favored by the distinctive polygonal shape of the crystal grains in Carrara marble. Local tensile stress concentration in these two mechanisms is attributed to grain sliding and divergent normal contact force, respectively. Type III mechanism is associated with the gliding along twin lamellae. The resultant tensile stress concentration could nucleate microcracks within the grain containing these lamellae or in the grain boundary. No microcracks in the adjoining grains were observed in this study. Our statistical analysis suggests that type III mechanism favors the nucleation of new cracks which are nearly perpendicular to the gently inclined twin lamellae and thus have a small angle with the maximum loading direction (about 15°). Type IV mechanism operates in grains failed mainly due to compressive stress rather than tensile stress concentration. Sets of parallel microcracks of this mechanism seem to be related to the crystallographic planes of calcite. The microcracking results also suggest that most of the grain boundaries in damaged zone have been cracked at the loading about 80 % of the specimen strength, while transgranular cracks begin to occur at that time and flourish after about 90 % loading of the strength.

  14. The molecular phylogenetics of endangerment: cryptic variation and historical phylogeography of the California tiger salamander, Ambystoma californiense.

    PubMed

    Shaffer, H Bradley; Pauly, Gregory B; Oliver, Jeffrey C; Trenham, Peter C

    2004-10-01

    A primary goal of conservation genetics is the discovery, delimitation and protection of phylogenetic lineages within sensitive or endangered taxa. Given the importance of lineage protection, a combination of phylogeography, historical geology and molecular clock analyses can provide an important historical context for overall species conservation. We present the results of a range-wide survey of genetic variation in the California tiger salamander, Ambystoma californiense, as well as a summary of the past several million years of inundation and isolation of the Great Central Valley and surrounding uplands that constitute its limited range. A combination of population genetic and phylogenetic analyses of mitochondrial DNA variation among 696 samples from 84 populations revealed six well-supported genetic units that are geographically discrete and characterized by nonoverlapping haplotype distributions. Populations from Santa Barbara and Sonoma Counties are particularly well differentiated and geographically isolated from all others. The remaining units in the Southern San Joaquin Valley, Central Coast Range, Central Valley and Bay Area are separated by geological features, ecological zone boundaries, or both. The geological history of the California landscape is consistent with molecular clock evidence suggesting that the Santa Barbara unit has been isolated for at least 0.74-0.92 Myr, and the Sonoma clade is equally ancient. Our work places patterns of genetic differentiation into both temporal- and landscape-level contexts, providing important insights into the conservation genetics of the California tiger salamander.

  15. Salamander growth rates increase along an experimental stream phosphorus gradient.

    PubMed

    Bumpers, Phillip M; Maerz, John C; Rosemond, Amy D; Benstead, Jonathan P

    2015-11-01

    Nutrient-driven perturbations to the resource base of food webs are predicted to attenuate with trophic distance, so it is unclear whether higher-level consumers will generally respond to anthropogenic nutrient loading. Few studies have tested whether nutrient (specifically, nitrogen [N] and phosphorus [P]) enrichment of aquatic ecosystems propagates through multiple trophic levels to affect predators, or whether N vs. P is relatively more important in driving effects on food webs. We conducted two-year whole-stream N and P additions to five streams to generate gradients in N and P concentration and N:P ratio (target N:P = 2, 8, 16, 32, 128). Larval salamanders are vertebrate predators of primary and secondary macroinvertebrate consumers in many heterotrophic headwater streams in which the basal resources are detritus and associated microorganisms. We determined the effects of N and P on the growth rates of caged and free-roaming larval Desmognathus quadramaculatus and the average body size of larval Eurycea wilderae. Growth rates and average body size increased by up to 40% and 60%, respectively, with P concentration and were negatively related to N:P ratio. These findings were consistent across both species of salamanders using different methodologies (cage vs. free-roaming) and at different temporal scales (3 months vs. 2 yr). Nitrogen concentration was not significantly related to increased growth rate or body size of the salamander species tested. Our findings suggest that salamander growth responds to the relaxation of ecosystem-level P limitation and that moderate P enrichment can have relatively large effects on vertebrate predators in detritus-based food webs.

  16. Identification of conservation units of the hynobiid salamander Pachyhynobius shangchengensis.

    PubMed

    Su, L-N; Zhao, Y-Y; Wu, X-M; Zhang, H-F; Li, X-C

    2015-08-19

    The evolutionary significant units (ESUs) of the salamander Pachyhynobius shangchengensis (Hynobiidae) in the Dabieshan mountains, southeastern China, were identified based on mitochondrial DNA data. We used methods for detecting cryptic species, such as the minimum spanning tree, the automatic barcode gap discovery, and the generalized mixed Yule-coalescent model; geographical partitioning was also used to identify the ESUs. A total of four ESUs were identified.

  17. Marble-type glass based on blast furnace slag

    SciTech Connect

    Sarkisov, P.D.; Smirnov, V.G.; Trifonova, T.E.; Sergeev, Yu.N.

    1987-01-01

    This paper discusses the recovery and use of blast furnace wastes as coloring agents in the manufacture of imitation marble glass. The slags consist of a series of metal oxides each of which is tested for the color it generates when reacted and annealed with the molten glass. Comparative tests were also run against non-waste coloring agents and it was found that the waste-derived colorants were equal or superior both in process behavior and in generating the appropriate optical properties in the finished glass.

  18. Identification and distribution of photoreceptor subtypes in the neotenic tiger salamander retina.

    PubMed

    Sherry, D M; Bui, D D; Degrip, W J

    1998-01-01

    The neotenic tiger salamander retina is a major model system for the study of retinal physiology and circuitry, yet there are unresolved issues regarding the organization of the photoreceptors and the photoreceptor mosaic. The rod and cone subtypes in the salamander retina were identified using a combination of morphological and immunocytochemical markers for specific rod and cone opsin epitopes. Because the visual pigment mechanisms present in the tiger salamander retina are well characterized and the antibodies employed in these studies are specific for particular rod and cone opsin epitopes, we also were able to identify the spectral class of the various rod and cone subtypes. Two classes of rods corresponding to the "red" and "green" rods previously reported in amphibian retinas were identified. In serial semithin section analyses, rods and cones comprised 62.4+/-1.4% and 37.6+/-1.4% of all photoreceptors, respectively. One rod type comprising 98.0+/-0.7% of all rods showed the immunological and morphological characteristics of "red" rods, which are maximally sensitive to middle wavelengths. The second rod subtype comprised 2.0+/-0.7% of all rods and possessed the immunological and morphological characteristics of "green" rods, which are maximally sensitive to short wavelengths. By morphology four cone types were identified, showing three distinct immunological signatures. Most cones (84.8+/-1.5% of all cones), including most large single cones, the accessory and principal members of the double cone, and some small single cones, showed immunolabeling by antisera that recognize long wavelength-sensitive cone opsins. A subpopulation of small single cones (8.4+/-1.7% of all cones) showed immunolabeling for short wavelength-sensitive cone opsin. A separate subpopulation of single cones which included both large and small types (6.8+/-1.4% of all cones) was identified as the UV-Cone population and showed immunolabeling by antibodies that recognize rod opsin epitopes

  19. Predator perception of Batesian mimicry and conspicuousness in a salamander.

    PubMed

    Kraemer, Andrew C; Adams, Dean C

    2014-04-01

    In Batesian mimicry a palatable mimic deceives predators by resembling an unpalatable model. The evolution of Batesian mimicry relies on the visual capabilities of the potential predators, as prey detection provides the selective force driving evolutionary change. We compared the visual capabilities of several potential predators to test predictions stemming from the hypothesis of Batesian mimicry between two salamanders: the model species Notophthalmus viridescens, and polymorphic mimic, Plethodon cinereus. First, we found mimicry to be restricted to coloration, but not brightness. Second, only bird predators appeared able to discriminate between the colors of models and nonmimic P. cinereus. Third, estimates of salamander conspicuousness were background dependent, corresponding to predictions only for backgrounds against which salamanders are most active. These results support the hypothesis that birds influence the evolution of Batesian mimicry in P. cinereus, as they are the only group examined capable of differentiating N. viridescens and nonmimetic P. cinereus. Additionally, patterns of conspicuousness suggest that selection from predators may drive the evolution of conspicuousness in this system. This study confirms the expectation that the visual abilities of predators may influence the evolution of Batesian mimicry, but the role of conspicuousness may be more complex than previously thought.

  20. Evolutionary history of a complex adaptation: Tetrodotoxin resistance in salamanders

    PubMed Central

    Hanifin, Charles T.; Gilly, William F.

    2017-01-01

    Understanding the processes that generate novel adaptive phenotypes is central to evolutionary biology. We used comparative analyses to reveal the history of tetrodotoxin (TTX) resistance in TTX-bearing salamanders. Resistance to TTX is a critical component of the ability to use TTX defensively but the origin of the TTX-bearing phenotype is unclear. Skeletal muscle of TTX-bearing salamanders (modern newts, family: Salamandridae) is unaffected by TTX at doses far in excess of those that block action potentials in muscle and nerve of other vertebrates. Skeletal muscle of non-TTX-bearing salamandrids is also resistant to TTX but at lower levels. Skeletal muscle TTX resistance in the Salamandridae results from the expression of TTX-resistant variants of the voltage-gated sodium channel NaV 1.4 (SCN4a). We identified four substitutions in the coding region of salSCN4a that are likely responsible for the TTX resistance measured in TTX-bearing salamanders and variation at one of these sites likely explains variation in TTX resistance among other lineages. Our results suggest that exaptation has played a role in the evolution of the TTX-bearing phenotype and provide empirical evidence that complex physiological adaptations can arise through the accumulation of beneficial mutations in the coding region of conserved proteins. PMID:25346116

  1. Better than fish on land? Hearing across metamorphosis in salamanders

    PubMed Central

    Christensen, Christian Bech; Lauridsen, Henrik; Christensen-Dalsgaard, Jakob; Pedersen, Michael; Madsen, Peter Teglberg

    2015-01-01

    Early tetrapods faced an auditory challenge from the impedance mismatch between air and tissue in the transition from aquatic to terrestrial lifestyles during the Early Carboniferous (350 Ma). Consequently, tetrapods may have been deaf to airborne sounds for up to 100 Myr until tympanic middle ears evolved during the Triassic. The middle ear morphology of recent urodeles is similar to that of early ‘lepospondyl’ microsaur tetrapods, and experimental studies on their hearing capabilities are therefore useful to understand the evolutionary and functional drivers behind the shift from aquatic to aerial hearing in early tetrapods. Here, we combine imaging techniques with neurophysiological measurements to resolve how the change from aquatic larvae to terrestrial adult affects the ear morphology and sensory capabilities of salamanders. We show that air-induced pressure detection enhances underwater hearing sensitivity of salamanders at frequencies above 120 Hz, and that both terrestrial adults and fully aquatic juvenile salamanders can detect airborne sound. Collectively, these findings suggest that early atympanic tetrapods may have been pre-equipped to aerial hearing and are able to hear airborne sound better than fish on land. When selected for, this rudimentary hearing could have led to the evolution of tympanic middle ears. PMID:25652830

  2. Origin and diversification of a salamander sex pheromone system.

    PubMed

    Janssenswillen, Sunita; Vandebergh, Wim; Treer, Dag; Willaert, Bert; Maex, Margo; Van Bocxlaer, Ines; Bossuyt, Franky

    2015-02-01

    Sex pheromones form an important facet of reproductive strategies in many organisms throughout the Animal Kingdom. One of the oldest known sex pheromones in vertebrates are proteins of the Sodefrin Precursor-like Factor (SPF) system, which already had a courtship function in early salamanders. The subsequent evolution of salamanders is characterized by a diversification in courtship and reproduction, but little is known on how the SPF pheromone system diversified in relation to changing courtship strategies. Here, we combined transcriptomic, genomic, and phylogenetic analyses to investigate the evolution of the SPF pheromone system in nine salamandrid species with distinct courtship displays. First, we show that SPF originated from vertebrate three-finger proteins and diversified through multiple gene duplications in salamanders, while remaining a single copy in frogs. Next, we demonstrate that tail-fanning newts have retained a high phylogenetic diversity of SPFs, whereas loss of tail-fanning has been associated with a reduced importance or loss of SPF expression in the cloacal region. Finally, we show that the attractant decapeptide sodefrin is cleaved from larger SPF precursors that originated by a 62 bp insertion and consequent frameshift in an ancestral Cynops lineage. This led to the birth of a new decapeptide that rapidly evolved a pheromone function independently from uncleaved proteins.

  3. Evolutionary history of a complex adaptation: tetrodotoxin resistance in salamanders.

    PubMed

    Hanifin, Charles T; Gilly, William F

    2015-01-01

    Understanding the processes that generate novel adaptive phenotypes is central to evolutionary biology. We used comparative analyses to reveal the history of tetrodotoxin (TTX) resistance in TTX-bearing salamanders. Resistance to TTX is a critical component of the ability to use TTX defensively but the origin of the TTX-bearing phenotype is unclear. Skeletal muscle of TTX-bearing salamanders (modern newts, family: Salamandridae) is unaffected by TTX at doses far in excess of those that block action potentials in muscle and nerve of other vertebrates. Skeletal muscle of non-TTX-bearing salamandrids is also resistant to TTX but at lower levels. Skeletal muscle TTX resistance in the Salamandridae results from the expression of TTX-resistant variants of the voltage-gated sodium channel NaV 1.4 (SCN4a). We identified four substitutions in the coding region of salSCN4a that are likely responsible for the TTX resistance measured in TTX-bearing salamanders and variation at one of these sites likely explains variation in TTX resistance among other lineages. Our results suggest that exaptation has played a role in the evolution of the TTX-bearing phenotype and provide empirical evidence that complex physiological adaptations can arise through the accumulation of beneficial mutations in the coding region of conserved proteins.

  4. Mechanisms underlying vertebrate limb regeneration: lessons from the salamander.

    PubMed

    Brockes, Jeremy P; Gates, Phillip B

    2014-06-01

    Limb regeneration in adult salamanders proceeds by formation of a mound of progenitor cells called the limb blastema. It provides several pointers for regenerative medicine. These include the role of differentiated cells in the origin of the blastema, the role of regenerating axons of peripheral nerves and the importance of cell specification in conferring morphogenetic autonomy on the blastema. One aspect of regeneration that has received less attention is the ability to undergo multiple episodes without detectable change in the outcome, and with minimal effect of aging. We suggest that, although such pointers are valuable, it is important to understand why salamanders are the only adult tetrapod vertebrates able to regenerate their limbs. Although this remains a controversial issue, the existence of salamander-specific genes that play a significant role in the mechanism of regeneration provides evidence for the importance of local evolution, rather than a purely ancestral mechanism. The three-finger protein called Prod1 is discussed in the present article as an exemplar of this approach.

  5. Catalytic liquid marbles: Ag nanowire-based miniature reactors for highly efficient degradation of methylene blue.

    PubMed

    Miao, Yue-E; Lee, Hiang Kwee; Chew, Wee Shern; Phang, In Yee; Liu, Tianxi; Ling, Xing Yi

    2014-06-04

    Ag nanowire-based catalytic liquid marbles are fabricated as miniature reactors, which demonstrate highly efficient, support-free and rate-controllable heterogeneous degradation of methylene blue, with catalytic efficiency close to 100%. Our miniature catalytic liquid marbles are essential for reactions involving highly toxic/hazardous or costly reactants, where small volume preliminary reactions are preferred.

  6. Genetic evaluation of Angus cattle for carcass marbling using ultrasound and genomic indicators

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Objectives were to estimate genetic parameters needed to elucidate the relationships of a molecular breeding value for marbling (MBV), intramuscular fat of yearling bulls measured with ultrasound (IMF) and marbling score of harvested steers (MRB), and to assess the utility of MBV and IMF in predicti...

  7. Genome Sequence of a Marbled Eel Polyoma-Like Virus in Taiwan

    PubMed Central

    Liu, Ping-Chung

    2017-01-01

    ABSTRACT We report here the complete genome sequence of a virus isolated from a diseased marbled eel (Anguilla marmorata) in Taiwan. The virus has been characterized as being related to Japanese eel endothelial cell-infecting virus (JEECV), with a large T-antigen-like protein. The sequence of the marbled eel virus displays low homology to the JEECV. PMID:28183770

  8. Genome Sequence of a Marbled Eel Polyoma-Like Virus in Taiwan.

    PubMed

    Wen, Chiu-Ming; Liu, Ping-Chung; Nan, Fan-Hua

    2017-02-09

    We report here the complete genome sequence of a virus isolated from a diseased marbled eel (Anguilla marmorata) in Taiwan. The virus has been characterized as being related to Japanese eel endothelial cell-infecting virus (JEECV), with a large T-antigen-like protein. The sequence of the marbled eel virus displays low homology to the JEECV.

  9. Don't Lose Your Marbles!: Game Project Teaches Introductory Manufacturing Skills

    ERIC Educational Resources Information Center

    Kapur, Arjun; Carter, Horlin; Dillon, Dave

    2006-01-01

    This article describes a lab activity conducted in an introductory manufacturing class. In this good, simple, mass-production project, the students designed and produced a small game composed of a piece of plywood and 14 glass marbles. In appearance, the game is something like Chinese checkers, but it involves jumping over marbles, then removing…

  10. "Right-Throughs, Rings, and Taws": Marbles Pitching Terminology in Trinidad and Tobago.

    ERIC Educational Resources Information Center

    Winer, Lise; Boos, Hans E. A.

    Marble games, or pitch, are among the most widely played of traditional boys' games in Trinidad and Tobago and have declined in the last two decades. Nearly 200 marbles terms found in Trinidad and Tobago English Creole are documented. Although most are British in origin, there are East Indian, French Creole, and possible African influences on this…

  11. Biogeography, phylogeny, and morphological evolution of central Texas cave and spring salamanders

    PubMed Central

    2013-01-01

    Background Subterranean faunal radiations can result in complex patterns of morphological divergence involving both convergent or parallel phenotypic evolution and cryptic species diversity. Salamanders of the genus Eurycea in central Texas provide a particularly challenging example with respect to phylogeny reconstruction, biogeography and taxonomy. These predominantly aquatic species inhabit karst limestone aquifers and spring outflows, and exhibit a wide range of morphological and genetic variation. We extensively sampled spring and cave populations of six Eurycea species within this group (eastern Blepsimolge clade), to reconstruct their phylogenetic and biogeographic history using mtDNA and examine patterns and origins of cave- and surface-associated morphological variation. Results Genetic divergence is generally low, and many populations share ancestral haplotypes and/or show evidence of introgression. This pattern likely indicates a recent radiation coupled with a complex history of intermittent connections within the aquatic karst system. Cave populations that exhibit the most extreme troglobitic morphologies show no or very low divergence from surface populations and are geographically interspersed among them, suggesting multiple instances of rapid, parallel phenotypic evolution. Morphological variation is diffuse among cave populations; this is in contrast to surface populations, which form a tight cluster in morphospace. Unexpectedly, our analyses reveal two distinct and previously unrecognized morphological groups encompassing multiple species that are not correlated with spring or cave habitat, phylogeny or geography, and may be due to developmental plasticity. Conclusions The evolutionary history of this group of spring- and cave-dwelling salamanders reflects patterns of intermittent isolation and gene flow influenced by complex hydrogeologic dynamics that are characteristic of karst regions. Shallow genetic divergences among several species

  12. HEMATOLOGY AND PLASMA BIOCHEMISTRY INTERVALS FOR CAPTIVE-BORN CALIFORNIA TIGER SALAMANDERS (AMBYSTOMA CALIFORNIENSE).

    PubMed

    Brady, Sean; Burgdorf-Moisuk, Anne; Kass, Philip H; Brady, Jacqueline; Wack, Raymund F

    2016-09-01

    Hematology and plasma biochemistry parameters were determined for 34 captive-born California tiger salamanders ( Ambystoma californiense ). The animals were manually restrained for general examination and venipuncture. This is the first comprehensive report of hematology and plasma biochemistry parameters in apparently healthy California tiger salamanders and may serve as a reference for clinical assessment and future study of this species.

  13. [Selective processes and adaptive evolution of the cytochrome b gene in salamanders of the genus Salamandrella].

    PubMed

    Maliarchuk, B A

    2012-06-01

    Sequence analysis of the cytochrome b gene fragment in the salamanders of the genus Salamandrella, Siberian salamander and Schrenk salamander was performed with the purpose to elucidate the effect of natural selection on the evolution of mitochondrial DNA (mtDNA) in these species. It was demonstrated that despite of notable influence of negative selection (expressed as very low dN/dS values), speciation and intraspecific divergence in salamanders was accompanied by the appearance of radical amino acid substitutions, caused by the influence of positive (directional) selection. To examine the evolutionary pattern of synonymous mtDNA sites, distribution of conservative and non-conservative substitutions was analyzed. The rates of conservative and non-conservative substitutions were nearly equal, pointing to neutrality of mutation process at synonymous mtDNA sites of salamanders. Analysis of conservative and non-conservative synonymous substitution distributions in different parts of phylogenetic trees showed that the differences between the synonymous groups compared were statistically significant only in one phylogenetic group of Siberian salamander (haplogroup C) (P = 0.02). In the group of single substitutions, located at terminal phylogenetic branches of Siberian salamanders from group C, increased rate of conservative substitutions was observed. Based on these findings, it was suggested that selective processes could have an influence on the formation of the synonymous substitution profile in the Siberian salamander mtDNA fragment examined.

  14. Evaluation of Slip Potentials on Bilecik Beige Marble with Pendulum Method

    NASA Astrophysics Data System (ADS)

    Erdem Çerçevik, Ali; Yerel Kandemir, Suheyla; Ozgur Yayli, M.

    2016-10-01

    This study deals with the determining of slip resistance and classification of slip potential for 5 different type of Bilecik Beige Marble were applied tumbling. TS EN 14231 Standard “Determination of Slip Resistance with Pendulum Friction Test Equipment” was basically utilized in determining the slip resistances of Bilecik Beige Marble with wet and dry surfaces. After tumbling process, by depending on the Bilecik Beige Marble type reduce slip potential, especially wet conditions. Slip resistance values on marble sample plates were specified to be considerably change by depending on both the applied surface processing techniques and dry/wet of surface characteristics. Finally, marbles used in this research have been classified according to safety applications by taking into account their slip resistance values.

  15. Effect of grain size and heavy metals on As immobilization by marble particles.

    PubMed

    Simón, M; García, I; González, V; Romero, A; Martín, F

    2015-05-01

    The effect of grain size and the interaction of heavy metals on As sorption by marble waste with different particle sizes was investigated. Acidic solutions containing only arsenic and a mixture of arsenic, lead, zinc, and cadmium were put in contact with the marble waste. The amount of metal(loid)s that were immobilized was calculated using the difference between the concentration in the acidic solution and in the liquid phase of the suspensions. Approximately 420 μg As m(-2) was sorbed onto the marble grains, both nonspecifically and specifically, where ≥ 80 % of the total arsenic in the acidic solution remained soluble, which suggests that this amendment is not effective to immobilize arsenic. However, in mixed contamination, relatively stable Pb-Ca arsenates were formed on the surface of the marble particles, and the soluble arsenic was reduced by 95 %, which indicates that marble particles can effectively immobilize arsenic and lead when both appear together.

  16. Extinction debt as a driver of amphibian declines: An example with imperiled flatwoods salamanders

    USGS Publications Warehouse

    Semiltsch, Raymond D; Walls, Susan; Barichivich, William J.; O'Donnell, Katherine

    2017-01-01

    A comprehensive view of population declines and their underlying causes is necessary to reverse species loss. Historically, in many cases, a narrow view may have allowed species declines to continue, virtually undetected, for long periods of time (perhaps even decades). We suggest that extinction debt is likely responsible for numerous (perhaps most) amphibian declines and that this perspective should be incorporated into the structure of amphibian research and management. Extinction debt, originally proposed to explain changes in species richness following environmental disturbance, also may refer to the proportion of populations of an individual species that is expected to eventually be lost because of habitat change. A conservation framework to address extinction debt focuses research on threats at the individual, population, and metapopulation levels. This approach will help enhance, restore, and protect specific processes and habitats at the proper scale by directing management to the most vulnerable level and stage of a species. We illustrate this approach using Flatwoods Salamanders, Ambystoma cingulatumand Ambystoma bishopi, which occurred historically throughout the Coastal Plain of the southeastern United States but have experienced a greater than 85% loss of populations in recent years. Reversal of these losses is possible only if conservation and recovery efforts encompass individual, population, and metapopulation levels. We illustrate our framework by outlining actions that could be taken at each of these levels to help guide conservation and management of amphibians with complex life cycles and provide options for how to prioritize conservation actions in the face of logistical and budgetary shortfalls.

  17. An examination of intergenomic exchanges in A. laterale-dependent unisexual salamanders in the genus Ambystoma.

    PubMed

    Bi, K; Bogart, J P; Fu, J

    2009-01-01

    The evolutionary longevity of unisexual salamanders in the genus Ambystoma may be attributed to their flexible reproductive system and meiotic intergenomic interactions. More than 20 different unisexual genomic combinations have been found and all the unisexuals live with at least one of the sexual species A. laterale, A. jeffersonianum, A. texanum, and A. tigrinum. Most unisexuals rely on A. laterale orA. jeffersonianum as sperm donors. Intergenomic exchanges were previously reported in A. jeffersonianum-dependent unisexual populations from southern Ontario and are believed to be an important meiotic mechanism that provides genetic diversity. The situations of intergenomic exchanges in many of A. laterale-dependent unisexual populations, however, remain unknown. In this study we collected specimens from populations where unisexuals use A. laterale as sperm donors, including mainly triploid A. 2 laterale--jeffersonianum (or LLJ), and employed genomic in situ hybridization (GISH) to examine the intergenomic exchanges. Five patterns of intergenomic exchanges were detected. Intergenomic exchanges are less frequent and lack association among populations in A. laterale-dependent than in A. jeffersonianum- dependent unisexual populations, but more recombined homeologues were observed in LLJ unisexuals. Our observations show that the patterns and frequencies of intergenomic exchanges are different when unisexuals use different sexual species as sperm donors. We propose a few possible mechanisms that may account for these different observations.

  18. Linking extinction–colonization dynamics to genetic structure in a salamander metapopulation

    PubMed Central

    Cosentino, Bradley J.; Phillips, Christopher A.; Schooley, Robert L.; Lowe, Winsor H.; Douglas, Marlis R.

    2012-01-01

    Theory predicts that founder effects have a primary role in determining metapopulation genetic structure. However, ecological factors that affect extinction–colonization dynamics may also create spatial variation in the strength of genetic drift and migration. We tested the hypothesis that ecological factors underlying extinction–colonization dynamics influenced the genetic structure of a tiger salamander (Ambystoma tigrinum) metapopulation. We used empirical data on metapopulation dynamics to make a priori predictions about the effects of population age and ecological factors on genetic diversity and divergence among 41 populations. Metapopulation dynamics of A. tigrinum depended on wetland area, connectivity and presence of predatory fish. We found that newly colonized populations were more genetically differentiated than established populations, suggesting that founder effects influenced genetic structure. However, ecological drivers of metapopulation dynamics were more important than age in predicting genetic structure. Consistent with demographic predictions from metapopulation theory, genetic diversity and divergence depended on wetland area and connectivity. Divergence was greatest in small, isolated wetlands where genetic diversity was low. Our results show that ecological factors underlying metapopulation dynamics can be key determinants of spatial genetic structure, and that habitat area and isolation may mediate the contributions of drift and migration to divergence and evolution in local populations. PMID:22113029

  19. Changes in the chemical composition of an acidic soil treated with marble quarry and marble cutting wastes.

    PubMed

    Tozsin, Gulsen; Oztas, Taskin; Arol, Ali Ihsan; Kalkan, Ekrem

    2015-11-01

    Soil acidity greatly affects the availability of plant nutrients. The level of soil acidity can be adjusted by treating the soil with certain additives. The objective of this study was to determine the effect of marble quarry waste (MQW) and marble cutting waste (MCW) on the chemical composition and the acidity of a soil. Marble wastes at different rates were applied to an acid soil. Their effectiveness in neutralizing the soil pH was compared with that of agricultural lime. The changes in the chemical composition of the soil were also evaluated with column test at the end of a 75-day incubation period. The results indicated that the MQW and MCW applications significantly increased the soil pH (from 4.71 up to 6.54), the CaCO3 content (from 0.33% up to 0.75%), and the exchangeable Ca (from 14.79 cmol kg(-1) up to 21.18 cmol kg(-1)) and Na (from 0.57 cmol kg(-1) up to 1.07 cmol kg(-1)) contents, but decreased the exchangeable K (from 0.46 cmol kg(-1) down to 0.28 cmol kg(-1)), the plant-available P (from 25.56 mg L(-1) down to 16.62 mg L(-1)), and the extractable Fe (from 259.43 mg L(-1) down to 55.4 mg L(-1)), Cu (from 1.97 mg L(-1) down to 1.42 mg L(-1)), Mn (from 17.89 mg L(-1) down to 4.61 mg L(-1)) and Zn (from 7.88 mg L(-1) down to 1.56 mg L(-1)) contents. In addition, the Cd (from 0.060 mg L(-1) down to 0.046 mg L(-1)), Ni (from 0.337 mg L(-1) down to 0.092 mg L(-1)) and Pb (from 28.00 mg L(-1) down to 20.08 mg L(-1)) concentrations decreased upon the treatment of the soil with marble wastes.

  20. Early Miocene origin and cryptic diversification of South American salamanders

    PubMed Central

    2013-01-01

    Background The currently recognized species richness of South American salamanders is surprisingly low compared to North and Central America. In part, this low richness may be due to the salamanders being a recent arrival to South America. Additionally, the number of South American salamander species may be underestimated because of cryptic diversity. The aims of our present study were to infer evolutionary relationships, lineage diversity, and timing of divergence of the South American Bolitoglossa using mitochondrial and nuclear sequence data from specimens primarily from localities in the Andes and upper Amazon Basin. We also estimated time of colonization of South America to test whether it is consistent with arrival via the Panamanian Isthmus, or land bridge connection, at its traditionally assumed age of 3 million years. Results Divergence time estimates suggest that Bolitoglossa arrived in South America from Central America by at least the Early Miocene, ca. 23.6 MYA (95% HPD 15.9-30.3 MYA), and subsequently diversified. South American salamanders of the genus Bolitoglossa show strong phylogeographic structure at fine geographic scales and deep divergences at the mitochondrial gene cytochrome b (Cytb) and high diversity at the nuclear recombination activating gene-1 (Rag1). Species often contain multiple genetically divergent lineages that are occasionally geographically overlapping. Single specimens from two southeastern localities in Ecuador are sister to the equatoriana-peruviana clade and genetically distinct from all other species investigated to date. Another single exemplar from the Andes of northwestern Ecuador is highly divergent from all other specimens and is sister to all newly studied samples. Nevertheless, all sampled species of South American Bolitoglossa are members of a single clade that is one of several constituting the subgenus Eladinea, one of seven subgenera in this large genus. Conclusions The ancestors of South American salamanders

  1. Rare earths in the Leadville Limestone and its marble derivates

    USGS Publications Warehouse

    Jarvis, J.C.; Wildeman, T.R.; Banks, N.G.

    1975-01-01

    Samples of unaltered and metamorphosed Leadville Limestone (Mississippian, Colorado) were analyzed by neutron activation for ten rare-earth elements (REE). The total abundance of the REE in the least-altered limestone is 4-12 ppm, and their distribution patterns are believed to be dominated by the carbonate minerals. The abundances of the REE in the marbles and their sedimentary precursors are comparable, but the distribution patterns are not. Eu is enriched over the other REE in the marbles, and stratigraphically upward in the formation (samples located progressively further from the heat source), the light REE become less enriched relative to the heavy REE. The Eu anomaly is attributed to its ability, unique among the REE, to change from the 3+ to 2+ oxidation state. Whether this results in preferential mobilization of the other REE or whether this reflects the composition of the pore fluid during metamorphism is unknown. Stratigraphically selective depletion of the heavy REE may be attributed to more competition for the REE between fluid and carbonate minerals in the lower strata relative to the upper strata. This competition could have been caused by changes in the temperature of the pore fluid or to the greater resistance to solution of the dolomite in the lower parts of the formation than the calcite in the upper parts. ?? 1975.

  2. Metamorphism of the Murphy belt, Marble Hill, GA

    SciTech Connect

    La Tour, T.E.; Gray, J. . Geology Dept.)

    1993-03-01

    Rocks of the Murphy belt consist of marble and metamorphosed mafic and highly aluminous pelitic rocks. The aluminous rocks contain sillimanite + kyanite + staurolite + garnet (gt) + muscovite + biotite + plagioclase + quartz [+-] tourmaline. Staurolite and kyanite are relict and closely intergrown. Garnet occurs as two generations, gt 1 and gt 2. Gt 1 and the biotite schistosity are coeval. Sillimanite needles and large porphyroblasts of muscovite (0.5--2.0 cm), formed from kyanite-staurolite aggregates coevally with gt 2, and both contain inclusions of relict kyanite and staurolite. Both are younger than the primary biotite schistosity and grew at sillimanite-muscovite grade. Muscovite porphyroblasts are partially recrystallized, leaving mica fish with thin trails of fine-grained muscovite. Kyanite [+-] staurolite are partially to completely recrystallized to spindle shaped aggregates and fine-grained muscovite. Some fine muscovite mantles the earlier phases and defined the new foliation. No sillimanite occurs in the recrystallized muscovite. This extreme grain size reduction occurred during medium-T retrograde metamorphism and converted many rocks into button schists or phyllonites. The above indicate extreme internal deformation following the metamorphic peak, during which primary sedimentary structures were destroyed. Also, competent mafic lithologies were dismembered into pods and discontinuous layers. Lithologic boundaries are no longer sedimentary, but tectonic. The association of aluminous schists and mafic rocks suggests deep-marine deposition, probably along a convergent margin. Conversely, the association is inconsistent with shallow deposition along a stable passive margin. The marble probably represents discontinuous reefs associated with the volcanic arc.

  3. Large outbreaks of ciguatera after consumption of brown marbled grouper.

    PubMed

    Chan, Thomas Y K

    2014-07-11

    Brown marbled grouper (Epinephelus fuscoguttatus) is an apex predator from coral reefs of the Indo-Pacific region. All five published case series of ciguatera after consumption of brown marbled grouper were reviewed to characterize the types, severity and chronicity of ciguatera symptoms associated with its consumption. Three of these case series were from large outbreaks affecting over 100-200 subjects who had eaten this reef fish served at banquets. Affected subjects generally developed a combination of gastrointestinal, neurological and, less commonly, cardiovascular symptoms. Gastrointestinal symptoms occurred early and generally subsided in 1-2 days. Some neurological symptoms (e.g., paresthesia of four limbs) could last for weeks or months. Sinus bradycardia and hypotension occurred early, but could be severe and prolonged, necessitating the timely use of intravenous fluids, atropine and dopamine. Other cardiovascular and neurological features included atrial ectopics, ventricular ectopics, dyspnea, chest tightness, PR interval >0.2 s, ST segment changes, polymyositis and coma. Concomitant alcohol consumption was associated with a much higher risk of developing bradycardia, hypotension and altered skin sensation. The public should realize that consumption of the high-risk fish (especially the ciguatoxin-rich parts and together with alcohol use) and repeated ciguatoxin exposures will result in more severe and chronic illness.

  4. Large Outbreaks of Ciguatera after Consumption of Brown Marbled Grouper

    PubMed Central

    Chan, Thomas Y. K.

    2014-01-01

    Brown marbled grouper (Epinephelus fuscoguttatus) is an apex predator from coral reefs of the Indo-Pacific region. All five published case series of ciguatera after consumption of brown marbled grouper were reviewed to characterize the types, severity and chronicity of ciguatera symptoms associated with its consumption. Three of these case series were from large outbreaks affecting over 100–200 subjects who had eaten this reef fish served at banquets. Affected subjects generally developed a combination of gastrointestinal, neurological and, less commonly, cardiovascular symptoms. Gastrointestinal symptoms occurred early and generally subsided in 1–2 days. Some neurological symptoms (e.g., paresthesia of four limbs) could last for weeks or months. Sinus bradycardia and hypotension occurred early, but could be severe and prolonged, necessitating the timely use of intravenous fluids, atropine and dopamine. Other cardiovascular and neurological features included atrial ectopics, ventricular ectopics, dyspnea, chest tightness, PR interval >0.2 s, ST segment changes, polymyositis and coma. Concomitant alcohol consumption was associated with a much higher risk of developing bradycardia, hypotension and altered skin sensation. The public should realize that consumption of the high-risk fish (especially the ciguatoxin-rich parts and together with alcohol use) and repeated ciguatoxin exposures will result in more severe and chronic illness. PMID:25019942

  5. Deep divergences and extensive phylogeographic structure in a clade of lowland tropical salamanders

    PubMed Central

    2012-01-01

    Background The complex geological history of Mesoamerica provides the opportunity to study the impact of multiple biogeographic barriers on population differentiation. We examine phylogeographic patterns in a clade of lowland salamanders (Bolitoglossa subgenus Nanotriton) using two mitochondrial genes and one nuclear gene. We use several phylogeographic analyses to infer the history of this clade and test hypotheses regarding the geographic origin of species and location of genetic breaks within species. We compare our results to those for other taxa to determine if historical events impacted different species in a similar manner. Results Deep genetic divergence between species indicates that they are relatively old, and two of the three widespread species show strong phylogeographic structure. Comparison of mtDNA and nuclear gene trees shows no evidence of hybridization or introgression between species. Isolated populations of Bolitoglossa rufescens from Los Tuxtlas region constitute a separate lineage based on molecular data and morphology, and divergence between Los Tuxtlas and other areas appears to predate the arrival of B. rufescens in other areas west of the Isthmus of Tehuantepec. The Isthmus appears responsible for Pliocene vicariance within B. rufescens, as has been shown for other taxa. The Motagua-Polochic fault system does not appear to have caused population vicariance, unlike in other systems. Conclusions Species of Nanotriton have responded to some major geological events in the same manner as other taxa, particularly in the case of the Isthmus of Tehuantepec. The deep divergence of the Los Tuxtlas populations of B. rufescens from other populations highlights the contribution of this volcanic system to patterns of regional endemism, and morphological differences observed in the Los Tuxtlas populations suggests that they may represent an undescribed species of Bolitoglossa. The absence of phylogeographic structure in B. nympha, in contrast to the

  6. Immunohistological classification of ionocytes in the external gills of larval Japanese black salamander, Hynobius nigrescens Stejneger.

    PubMed

    Uchiyama, Minoru; Kumano, Tomoko; Komiyama, Makiko; Yoshizawa, Hideki; Matsuda, Kouhei

    2011-08-01

    In this cytological and immunohistological study, we clarified the localization of the membrane transporters Na(+) , K(+) -ATPase (NKA), vacuolar-type H(+) -ATPase (VHA), and epithelial sodium channel (ENaC) and distinguished ionocyte subtypes in the gill of the Japanese salamander (Hynobius nigrescens). In larvae (IY stages 43-65), NKA immunoreactivity was observed on the basolateral plasma membrane in more than 60% cells and less than 20% cells in the primary filaments and secondary lamellae of the external gills, respectively. VHA immunoreactivity was observed on the apical membrane of some epithelial cells in the secondary lamellae of the external gills. High ENaCα immunoreactivity was widely observed on the apical cell membrane of a population of squamous cells, presumably pavement cells (PVCs), and mitochondria-rich cells (MRCs), in the primary filaments and secondary lamellae of the external gills. Using double immunofluorescence microscopy, epithelial cell types involved in ionic regulation were characterized and divided into three ionocyte types: NKA-, NKA- and ENaC-, and VHA-positive cells. VHA-immunoreactive cells as well as NKA-positive cells were observed during IY stages 43-65 of the salamander larvae. During late stages of metamorphosis, NKA, VHA, and ENaCα immunoreactivities in the external gills decreased and finally disappeared during the completion of metamorphosis (IY stage 68). PVCs and MRCs in the external gills are probably involved in acid-base balance regulation and osmoregulation in urodele amphibian larvae. The results are discussed in relation to the ionocytes previously reported in fish gills and the frog skin epithelium.

  7. Gene lineages and eastern North American palaeodrainage basins: phylogeography and speciation in salamanders of the Eurycea bislineata species complex.

    PubMed

    Kozak, Kenneth H; Blaine, Russell A; Larson, Allan

    2006-01-01

    Contemporary North American drainage basins are composites of formerly isolated drainages, suggesting that fragmentation and fusion of palaeodrainage systems may have been an important factor generating current patterns of genetic and species diversity in stream-associated organisms. Here, we combine traditional molecular-phylogenetic, multiple-regression, nested clade, and molecular-demographic analyses to investigate the relationship between phylogeographic variation and the hydrogeological history of eastern North American drainage basins in semiaquatic plethodontid salamanders of the Eurycea bislineata species complex. Four hundred forty-two sequences representing 1108 aligned bases from the mitochondrial genome are reported for the five formally recognized species of the E. bislineata complex and three outgroup taxa. Within the in-group, 270 haplotypes are recovered from 144 sampling locations. Geographic patterns of mtDNA-haplotype coalescence identify 13 putatively independent population-level lineages, suggesting that the current taxonomy of the group underestimates species-level diversity. Spatial and temporal patterns of phylogeographic divergence are strongly associated with historical rather than modern drainage connections, indicating that shifts in major drainage patterns played a pivotal role in the allopatric fragmentation of populations and build-up of lineage diversity in these stream-associated salamanders. More generally, our molecular genetic results corroborate geological and faunistic evidence suggesting that palaeodrainage connections altered by glacial advances and headwater erosion occurring between the mid-Miocene and Pleistocene epochs explain regional patterns of biodiversity in eastern North American streams.

  8. The importance of comparative phylogeography in diagnosing introduced species: a lesson from the seal salamander, Desmognathus monticola

    PubMed Central

    Bonett, Ronald M; Kozak, Kenneth H; Vieites, David R; Bare, Alison; Wooten, Jessica A; Trauth, Stanley E

    2007-01-01

    Background In most regions of the world human influences on the distribution of flora and fauna predate complete biotic surveys. In some cases this challenges our ability to discriminate native from introduced species. This distinction is particularly critical for isolated populations, because relicts of native species may need to be conserved, whereas introduced species may require immediate eradication. Recently an isolated population of seal salamanders, Desmognathus monticola, was discovered on the Ozark Plateau, ~700 km west of its broad continuous distribution in the Appalachian Mountains of eastern North America. Using Nested Clade Analysis (NCA) we test whether the Ozark isolate results from population fragmentation (a natural relict) or long distance dispersal (a human-mediated introduction). Results Despite its broad distribution in the Appalachian Mountains, the primary haplotype diversity of D. monticola is restricted to less than 2.5% of the distribution in the extreme southern Appalachians, where genetic diversity is high for other co-distributed species. By intensively sampling this genetically diverse region we located haplotypes identical to the Ozark isolate. Nested Clade Analysis supports the hypothesis that the Ozark population was introduced, but it was necessary to include haplotypes that are less than or equal to 0.733% divergent from the Ozark population in order to arrive at this conclusion. These critical haplotypes only occur in < 1.2% of the native distribution and NCA excluding them suggest that the Ozark population is a natural relict. Conclusion Our analyses suggest that the isolated population of D. monticola from the Ozarks is not native to the region and may need to be extirpated rather than conserved, particularly because of its potential negative impacts on endemic Ozark stream salamander communities. Diagnosing a species as introduced may require locating nearly identical haplotypes in the known native distribution, which may be

  9. Extensive unidirectional introgression between two salamander lineages of ancient divergence and its evolutionary implications

    PubMed Central

    Canestrelli, Daniele; Bisconti, Roberta; Nascetti, Giuseppe

    2014-01-01

    Hybridization and introgression, contrary to previous beliefs, are now considered to be widespread processes even among animal species. Nonetheless, the range of their possible outcomes and roles in moulding biodiversity patterns are still far from being fully appraised. Here we investigated the pattern of hybridization and introgression between Salamandrina perspicillata and S. terdigitata, two salamanders endemic to the Italian peninsula. Using a set of diagnostic or differentiated genetic markers (9 nuclear and 1 mitochondrial), we documented extensive unidirectional introgression of S. terdigitata alleles into the S. perspicillata gene pool in central Italy, indicating that barriers against hybridization were permeable when they came into secondary contact, and despite their ancient divergence. Nonetheless, purebred S. terdigitata, as well as F1, F2, and backcrosses were not found within the hybrid zone. Moreover, Bayesian analyses of population structure identified admixed populations belonging to a differentiated gene pool with respect to both parental populations. Overall, the observed genetic structure, together with their geographic pattern of distribution, suggests that Salamandrina populations in central Italy could have entered a distinct evolutionary pathway. How far they have gone along this pathway will deserve future investigation. PMID:25269625

  10. Extensive unidirectional introgression between two salamander lineages of ancient divergence and its evolutionary implications.

    PubMed

    Canestrelli, Daniele; Bisconti, Roberta; Nascetti, Giuseppe

    2014-10-01

    Hybridization and introgression, contrary to previous beliefs, are now considered to be widespread processes even among animal species. Nonetheless, the range of their possible outcomes and roles in moulding biodiversity patterns are still far from being fully appraised. Here we investigated the pattern of hybridization and introgression between Salamandrina perspicillata and S. terdigitata, two salamanders endemic to the Italian peninsula. Using a set of diagnostic or differentiated genetic markers (9 nuclear and 1 mitochondrial), we documented extensive unidirectional introgression of S. terdigitata alleles into the S. perspicillata gene pool in central Italy, indicating that barriers against hybridization were permeable when they came into secondary contact, and despite their ancient divergence. Nonetheless, purebred S. terdigitata, as well as F1, F2, and backcrosses were not found within the hybrid zone. Moreover, Bayesian analyses of population structure identified admixed populations belonging to a differentiated gene pool with respect to both parental populations. Overall, the observed genetic structure, together with their geographic pattern of distribution, suggests that Salamandrina populations in central Italy could have entered a distinct evolutionary pathway. How far they have gone along this pathway will deserve future investigation.

  11. The bovine fatty acid binding protein 4 gene is significantly associated with marbling and subcutaneous fat depth in Wagyu x Limousin F2 crosses.

    PubMed

    Michal, J J; Zhang, Z W; Gaskins, C T; Jiang, Z

    2006-08-01

    Fatty acid binding protein 4 (FABP4), which is expressed in adipose tissue, interacts with peroxisome proliferator-activated receptors and binds to hormone-sensitive lipase and therefore, plays an important role in lipid metabolism and homeostasis in adipocytes. The objective of this study was to investigate associations of the bovine FABP4 gene with fat deposition. Both cDNA and genomic DNA sequences of the bovine gene were retrieved from the public databases and aligned to determine its genomic organization. Primers targeting two regions of the FABP4 gene were designed: from nucleotides 5433-6106 and from nucleotides 7417-7868 (AAFC01136716). Direct sequencing of polymerase chain reaction (PCR) products on two DNA pools from high- and low-marbling animals revealed two single nucleotide polymorphisms (SNPs): AAFC01136716.1:g.7516G>C and g.7713G>C. The former SNP, detected by PCR-restriction fragment length polymorphism using restriction enzyme MspA1I, was genotyped on 246 F2 animals in a Waygu x Limousin F2 reference population. Statistical analysis showed that the FABP4 genotype significantly affected marbling score (P = 0.0398) and subcutaneous fat depth (P = 0.0246). The FABP4 gene falls into a suggestive/significant quantitative trait loci interval for beef marbling that was previously reported on bovine chromosome 14 in three other populations.

  12. Kittlitz's and Marbled Murrelets in Kenai Fjords National Park, South-Central Alaska: At-Sea Distribution, Abundance, and Foraging Habitat, 2006-08

    USGS Publications Warehouse

    Arimitsu, M.L.; Piatt, J.F.; Romano, Marc D.; Madison, E.N.; Conaway, J.S.

    2010-01-01

    Kittlitz's murrelets (Brachyramphus brevirostris) and marbled murrelets (B. marmoratus) are small diving seabirds and are of management concern because of population declines in coastal Alaska. In 2006-08, we conducted a study in Kenai Fjords National Park, south-central Alaska, to estimate the recent population size of Brachyramphus murrelets, to evaluate productivity based on juvenile to adult ratios during the fledgling season, and to describe and compare their use of marine habitat. We also attempted a telemetry study to examine Kittlitz's murrelet nesting habitat requirements and at-sea movements. We estimated that the Kittlitz's murrelet population was 671 ? 144 birds, and the marbled murrelet population was 5,855 ? 1,163 birds. Kittlitz's murrelets were limited to the heads of three fjords with tidewater glaciers, whereas marbled murrelets were more widely distributed. Population estimates for both species were lower in 2007 than in 2006 and 2008, possibly because of anomalous oceanographic conditions that may have delayed breeding phenology. During late season surveys, we observed few hatch-year marbled murrelets and only a single hatch-year Kittlitz's murrelet over the course of the study. Using radio telemetry, we found a likely Kittlitz's murrelet breeding site on a mountainside bordering one of the fjords. We never observed radio-tagged Kittlitz's murrelets greater than 10 kilometer from their capture sites, suggesting that their foraging range during breeding is narrow. We observed differences in oceanography between fjords, reflecting differences in sill characteristics and orientation relative to oceanic influence. Acoustic biomass, a proxy for zooplankton and small schooling fish, generally decreased with distance from glaciers in Northwestern Lagoon, but was more variable in Aialik Bay where dense forage fish schools moved into glacial areas late in the summer. Pacific herring (Clupea pallasii), capelin (Mallotus villosus) and Pacific sand lance

  13. Petrogenesis of polygenic marbles, Baqi-Abad region, Yazd, central Iran

    NASA Astrophysics Data System (ADS)

    Ayati, Farimah; Mackizadeh, Mohammad Ali

    2017-01-01

    Mineralogy, minerals paragenesis and evolution of polygenic marbles were investigated in the Baqi-Abad region (Yazd province). The area is located in the central Iran. Studied marbles are classified as calcitic marbles, brucite-bearing marbles and forsterite- serpentine bearing marbles. The following mineral assemblages have been determined: calcite + dolomite + forsterite + serpentine + talc + brucite + hydromagnesite. Based on calcite twin's geometry, marbles underwent the temperature formation between 200 and 300°C. Two mineral assemblages which have been defined in marbles are related to two stages of contact- metamorphism and metasomatism. In the first stage, de-carbonation reactions have been taken place in high fCO2 so anhydrous minerals are formed. The Second stage is characterized by invading H2O bearing fluids, leading to the formation of hydrous paragenesis. Brucite is probably formed by the de-silicification of serpentines at the first stage. On the other hand, due to the influence of hydrothermal fluids, olivines can be directly altered to brucite. It is obvious that hydromagnesite was formed at the expense of dolomite, brucite and serpentine. Its formation is associated with final carbonation reactions. As a whole, it can be concluded that based on the paragenetic relationships of minerals, there are four stages in mineral evolution system including carbonation, dehydration, de-carbonation and final dehydration processes.

  14. Deformation of ferrofluid marbles in the presence of a permanent magnet.

    PubMed

    Nguyen, Nam-Trung

    2013-11-12

    This paper investigates the deformation of ferrofluid marbles in the presence of a permanent magnet. Ferrofluid marbles are formed using a water-based ferrofluid and 1 μm hydrophobic polytetrafluoride particles. A marble placed on a Teflon coated glass plate deforms under gravity. In the presence of a permanent magnet, the marble is further deformed with a larger contact area. The geometric parameters are normalized by the radius of an undistorted spherical marble. The paper first discusses a scaling relationship between the dimensionless radius of the contact area as well as the dimensionless height and the magnetic Bond number. The dimensionless contact radius is proportional to the fourth root of the magnetic bond number. The dimensionless height scales with the inverse square root of the magnetic Bond number. In the case of a moving marble dragged by a permanent magnet, the deformation is evaluated as the difference between advancing and receding curvatures of the top view. The dimensionless height and the contact diameter of the marble do not significantly depend on the speed or the capillary number. The scaling analysis and experimental data show that the deformation is proportional to the capillary number.

  15. Characterization of Genes for Beef Marbling Based on Applying Gene Coexpression Network

    PubMed Central

    Lim, Dajeong; Kim, Nam-Kuk; Lee, Seung-Hwan; Park, Hye-Sun; Cho, Yong-Min; Chai, Han-Ha; Kim, Heebal

    2014-01-01

    Marbling is an important trait in characterization beef quality and a major factor for determining the price of beef in the Korean beef market. In particular, marbling is a complex trait and needs a system-level approach for identifying candidate genes related to the trait. To find the candidate gene associated with marbling, we used a weighted gene coexpression network analysis from the expression value of bovine genes. Hub genes were identified; they were topologically centered with large degree and BC values in the global network. We performed gene expression analysis to detect candidate genes in M. longissimus with divergent marbling phenotype (marbling scores 2 to 7) using qRT-PCR. The results demonstrate that transmembrane protein 60 (TMEM60) and dihydropyrimidine dehydrogenase (DPYD) are associated with increasing marbling fat. We suggest that the network-based approach in livestock may be an important method for analyzing the complex effects of candidate genes associated with complex traits like marbling or tenderness. PMID:24624372

  16. Multi-approach characterization of the Rhodope marbles, Greece used in monuments

    NASA Astrophysics Data System (ADS)

    Dotsika, Elissavet; Raco, Brunella; Psomiadis, David; Poutoukis, Dimitrios; Zisi, Nikoleta

    2010-05-01

    Northern Greece has many archaeological sites featuring buildings and objects entirely or partly constructed from marble whose provenance is doubtful. In Northern Greece, the most probable source of such marble is the Rhodope Mountains. For the purpose of supporting further provenance studies, these marbles are fully scientifically characterized. The sampling took place in several ancient quarries which were on trade routes of Hellenistic, Roman or Byzantine settlements. Trade of marble in N. Greece is proved to have been equally important as in S. Greece, comparing the qualitative marble of Thassos with the best marbles of the south (e.g. Paros, Naxos etc.). The techniques used are petrographic and geochemical (microscope, X-Ray diffraction patterns, Scanning Electron Microscope) methods and stable isotope ratio analysis (δ13C and δ18O). The use of a multi-technique approach with combined parameters allows the best possible discrimination. This scientific investigation both supplements the isotopic database and proves that in N. Greece people used also imported marbles.

  17. Strength Behavior, Creep Failure and Permeability Change of a Tight Marble Under Triaxial Compression

    NASA Astrophysics Data System (ADS)

    Liu, Zaobao; Shao, Jianfu

    2017-03-01

    The coupled hydro-mechanical behaviors of a tight marble are investigated by a series of laboratory tests with continuous gas injection during the hydrostatic compression, triaxial compression and compressive creep tests. Hydrostatic compression tests are firstly carried out in three steps to identify the viscous effect of hydrostatic stress on deformation and permeability of the marble. Coupled triaxial tests are then conducted at a constant axial strain rate under five different confining pressures ( P c) with continuous gas injection. Coupled creep behaviors of the marble are also characterized by a constant deviatoric stress test under P c = 30 MPa with gas flowing at a constant injection pressure. The high-stress unloading failure behavior of the marble is finally investigated by an unloading test with a previous multi-step creep phase to realize a high-stress state as well as to investigate the time-dependent deformation of marble under different deviatoric stresses. Experimental results reveal that gas permeability of the marble shows an evident rate-dependent effect in hydrostatic compression. Mechanical behaviors of the tight marble are closely depended on the applied P c in triaxial tests, and its permeability exhibits a decrease phase at initial deviatoric loading and turns to increase at a critical stress corresponding to the initial yield stress. Marble can withstand more important plastic deformation under high P c than under lower ones. Gas flow seems to be more sensitive than the strains to characterize the creep behaviors of the marble. No time-dependent strains are observed when deviatoric creep stress is lower than 50% of its peak strength under P c = 30 MPa.

  18. Discrepant Results in a 2-D Marble Collision

    NASA Astrophysics Data System (ADS)

    Kalajian, Peter

    2013-03-01

    Video analysis of 2-D collisions is an excellent way to investigate conservation of linear momentum. The often-desired experimental design goal is to minimize the momentum loss in order to demonstrate the conservation law. An air table with colliding pucks is an ideal medium for this experiment, but such equipment is beyond the budget of many schools. Substituting marbles on a table for air pucks introduces angular momentum and sliding friction so that simple video analysis will demonstrate that linear momentum is not conserved.1,2 Nevertheless, these labs offer students insights into the real-world application of physics. During a recent classroom trial, an unexpected result forced my students to think creatively and critically about what happened in the experiment.

  19. Grain Boundary Microstructures of Wet and Dry Recrystallizing Marble

    NASA Astrophysics Data System (ADS)

    de Bresser, H.; Urai, J.; Olgaard, D.

    2003-12-01

    We analyzed 2D grain boundary maps of samples of marble that were deformed at high temperature with and without added water. Our aim was to relate the grain boundary geometry of wet and dry marble to the observed mechanical behavior, and to obtain criteria that can help interpretation of natural calcite rocks in terms of the influence of water on their deformation. We made use of cylindrical samples of pure white, microporous Carrara marble that were axially compressed in a gas medium deformation apparatus at temperatures (T) ranging 600-1000° C, a constant confining pressure of 300 MPa and strain rates around 10-5 s-1. Samples were jacketed in sealed Pt-capsules with or without the addition of 0.4-2.1 wt% water. Microstructural analysis was carried out using Scanning Electron Microscopy (SEM) and Light Optical Microscopy. Traced grain boundary maps were made from ultra thin sections of samples, and were quantitatively analyzed using Image Analysis techniques. The strength of water-added samples was found to be slightly less than of dry samples at all temperatures investigated (weakening ~40% at T=600° C, decreasing to ˜10% at higher T), with one exception at T=800° C. Microstructurally, the samples showed grain flattening and twinning at T=600° C and development of new grains by dynamic recrystallization at higher T, dominated by grain boundary migration. Grain boundaries in wet samples showed isolated or locally continuous remnants of fluid pockets in SEM. Quantitatively, the mean grain size and grain size distribution were found to only marginally vary between dry and wet samples. Average roundness of grains in wet recrystallized samples is systematically better than in dry samples. The fractal dimension D for the relationship between grain diameter d and grain perimeter P (expressed P ˜dD) for wet samples is systematically lower than for dry samples. Thus, grain boundaries in wet-deformed samples have less irregular shapes than in dry samples. Average

  20. Large scale Hugoniot material properties for Danby Marble

    SciTech Connect

    Rinehart, E.J.

    1993-11-01

    This paper presents the results of simulation experiments of nuclear underground testing carried out using the HYDROPLUS methodology for yield verifications of non-standard tests. The objective of this test series was to demonstrate the accuracy of stress and velocity measurements in hard, low porosity rock, to obtain comparisons of large-scale material properties with those obtained from laboratory testing of the same material, and to address the problems posed by a material having a clear precursor wave preceding the main shock wave. The test series consisted of three individual experimental tests. The first established material properties of the Danby marble selected for use in the experiments. The second and third tests looked at stress and velocity gage errors obtained when gages were placed in boreholes and grouted into place.

  1. Exposure to ultraviolet radiation (290-400 nm) causes oxidative stress, DNA damage, and expression of p53/p73 in laboratory experiments on embryos of the spotted salamander, Ambystoma maculatum.

    PubMed

    Lesser, M P; Turtle, S L; Farrell, J H; Walker, C W

    2001-01-01

    Developing embryos of the spotted salamander, Ambystoma maculatum, exposed to ultraviolet radiation (UVR; 290-400 nm) in the laboratory show a significant sensitivity to UVB (290-320 nm) radiation. Embryos in laboratory experiments exhibited significant DNA damage during exposures to UVR despite a significant increase in the production of the protective pigment melanin in response to UVR exposure. DNA damage occurs as a result of both the direct effects of exposure to UVR, and the indirect effects are mediated by the production of reduced oxygen intermediates. The production of reactive oxygen species initiates the expression of p53/p73 that leads to either DNA repair or apoptosis. When similar experiments are conducted on salamander embryos exposed to solar UVR in vernal pools, the embryos show significantly less sensitivity and higher survivorship. The differences between laboratory and field experiments are a result of the attenuation of UVR caused by the accumulation of dissolved organic carbon within the pools of these wooded areas. These findings suggest that northeastern populations of spotted salamanders are sensitive to UVR but are not significantly affected by present-day irradiances of UVR in the field. These results do suggest that continued decreases in stratospheric ozone over temperate latitudes have the potential to affect spotted salamanders in their natural habitats.

  2. Range-wide phylogeography and conservation genetics of a narrowly endemic stream salamander, Pachyhynobius shangchengensis (Caudata, Hynobiidae): implications for conservation.

    PubMed

    Pan, T; Wang, H; Hu, C-C; Shi, W-B; Zhao, K; Huang, X; Zhang, B-W

    2014-02-13

    The Shangcheng stout salamander (Pachyhynobius shangchengensis) is an endangered amphibian endemic to the Dabie Mountains, southeast China, and is currently threatened by habitat loss and illegal poaching. Here we used the mitochondrial DNA control region sequence (768 bp) to conduct a comprehensive investigation of genetic diversity, phylogeographic pattern, and demographic history of the species across its geographic distribution to assist its conservation. We concluded that the levels of genetic variation are relatively low in all four populations. Analysis of molecular variance indicated that the most likely phylogeographic pattern is [JGT] [KHJ] [TM, BYM]. Two distinct clades were identified in the phylogenetic tree of 28 haplotypes, corresponding to the two southern populations (TM, BYM) and two northern populations (JGT, KHJ). Significant population differentiation (FST) was detected among all populations. Among the four populations, historical demographic analyses (e.g., the g parameter, the Tajima D test, and the Fu Fs test) did not reveal definite information on population expansion except for the BYM population, which had undergone a strong population expansion event. Based on the analysis of a Bayesian skyline plot, the total population underwent a significant population fluctuation around 20 kya. This may have been triggered by the end of the last glacial maximum. In conclusion, the existence of three evolutionarily significant units (BMY-TM, KHJ, and JGT) and four management units (BMY, TM, KHJ, and JGT) is supported by our study.

  3. Salamander paedomorphosis: linking thyroid hormone to life history and life cycle evolution.

    PubMed

    Johnson, Carlena K; Voss, S Randal

    2013-01-01

    Many salamanders have biphasic life cycles with aquatic larval and terrestrial adult phases. In these species, the transition between phases-metamorphosis-requires thyroid hormone (TH) activation of transcriptional programs that cause regression of larval traits and development of adult traits. During salamander evolution, TH signaling pathways have been altered in biphasic species to yield paedomorphic salamanders that retain larval traits and attain sexual maturity in larval aquatic habitats. We review literature concerning the ecology, evolution, and hormonal regulation of metamorphic, paedomorphic, and facultative salamander life histories. We then discuss recent microarray results that detail gene expression signatures of metamorphosis and paedomorphosis, and genetic results that establish TH responsiveness as a continuous trait with a quantitative trait locus (QTL) basis. TH-responsive QTL from ambystomatid salamanders explain variation in metamorphic timing, expression of metamorphosis versus paedomorphosis, and adult fitness traits. We propose a model for salamander life history evolution that links adaptation to aquatic habitats with TH-responsive loci that pleiotropically alter metamorphic timing and adult body size. Future studies that adopt genetic and genomic approaches will further establish salamanders as ideal models for investigating TH signaling mechanisms that regulate postembryonic development and the expression of alternate life histories.

  4. Telocytes in ileum of the Chinese giant salamander: ultrastructural evidence.

    PubMed

    Zhang, Hui; Zhong, Shengwei; Ge, Tingting; Peng, Shasha; Yu, Pengcheng; Zhou, Zuohong; Guo, Xiaoquan

    2016-03-01

    Telocytes (TCs) and their telopodes (Tps) have been found in various organs of many mammals, including in lower animals. However, knowledge of TCs in lower animals is still very limited. This study identified TCs and their Tps in the ileum of the Chinese giant salamander, Andrias davidianus (Amphibia: Caudata), by transmission electron microscopy. The TCs/Tps were found near epithelial cells, glandular cells and unmyelinated nerve fibres. Moreover, exosomes were also found to be present in between TCs/Tps and these cells.

  5. What Do Owls, Salamanders, Flycatchers and Cuckoos Have In Common?

    SciTech Connect

    Musgrave, Maria A.

    2016-09-27

    This is an article from the Los Alamos Living magazine. Los Alamos National Laboratory sits on a beautiful and unique landscape that provides important protected habitat to many species, including a few that are federally-listed as threatened or endangered. These species are the Jemez Mountains Salamander, the Mexican Spotted Owl, the Southwestern Willow Flycatcher, the Yellow-billed Cuckoo, and the New Mexico Meadow Jumping Mouse. Part of the job of the Laboratory's wildlife biologists is to survey for these species each year and determine what actions need to be taken if they are found.

  6. Biology of tiny animals: three new species of minute salamanders (Plethodontidae: Thorius) from Oaxaca, Mexico.

    PubMed

    Parra-Olea, Gabriela; Rovito, Sean M; García-París, Mario; Maisano, Jessica A; Wake, David B; Hanken, James

    2016-01-01

    We describe three new species of minute salamanders, genus Thorius, from the Sierra Madre del Sur of Oaxaca, Mexico. Until now only a single species, T. minutissimus, has been reported from this region, although molecular data have long shown extensive genetic differentiation among geographically disjunct populations. Adult Thorius pinicola sp. nov., T. longicaudus sp. nov., and T. tlaxiacus sp. nov. are larger than T. minutissimus and possess elliptical rather than oval nostrils; T. pinicola and T. longicaudus also have longer tails. All three new species occur west of the range of T. minutissimus, which has the easternmost distribution of any member of the genus. The new species are distinguished from each other and from other named Thorius in Oaxaca by a combination of adult body size, external morphology and osteology, and by protein characters (allozymes) and differences in DNA sequences. In addition, we redescribe T. minutissimus and a related species, T. narisovalis, to further clarify the taxonomic status of Oaxacan populations and to facilitate future studies of the remaining genetically differentiated Thorius that cannot be satisfactorily assigned to any named species. Populations of all five species considered here appear to have declined dramatically over the last one or two decades and live specimens are difficult to find in nature. Thorius may be the most endangered genus of amphibians in the world. All species may go extinct before the end of this century.

  7. Understanding positional cues in salamander limb regeneration: implications for optimizing cell-based regenerative therapies.

    PubMed

    McCusker, Catherine D; Gardiner, David M

    2014-06-01

    Regenerative medicine has reached the point where we are performing clinical trials with stem-cell-derived cell populations in an effort to treat numerous human pathologies. However, many of these efforts have been challenged by the inability of the engrafted populations to properly integrate into the host environment to make a functional biological unit. It is apparent that we must understand the basic biology of tissue integration in order to apply these principles to the development of regenerative therapies in humans. Studying tissue integration in model organisms, where the process of integration between the newly regenerated tissues and the 'old' existing structures can be observed and manipulated, can provide valuable insights. Embryonic and adult cells have a memory of their original position, and this positional information can modify surrounding tissues and drive the formation of new structures. In this Review, we discuss the positional interactions that control the ability of grafted cells to integrate into existing tissues during the process of salamander limb regeneration, and discuss how these insights could explain the integration defects observed in current cell-based regenerative therapies. Additionally, we describe potential molecular tools that can be used to manipulate the positional information in grafted cell populations, and to promote the communication of positional cues in the host environment to facilitate the integration of engrafted cells. Lastly, we explain how studying positional information in current cell-based therapies and in regenerating limbs could provide key insights to improve the integration of cell-based regenerative therapies in the future.

  8. Male pheromone protein components activate female vomeronasal neurons in the salamander Plethodon shermani

    PubMed Central

    Wirsig-Wiechmann, Celeste R; Houck, Lynne D; Wood, Jessica M; Feldhoff, Pamela W; Feldhoff, Richard C

    2006-01-01

    Background The mental gland pheromone of male Plethodon salamanders contains two main protein components: a 22 kDa protein named Plethodon Receptivity Factor (PRF) and a 7 kDa protein named Plethodon Modulating Factor (PMF), respectively. Each protein component individually has opposing effects on female courtship behavior, with PRF shortening and PMF lengthening courtship. In this study, we test the hypothesis that PRF or PMF individually activate vomeronasal neurons. The agmatine-uptake technique was used to visualize chemosensory neurons that were activated by each protein component individually. Results Vomeronasal neurons exposed to agmatine in saline did not demonstrate significant labeling. However, a population of vomeronasal neurons was labeled following exposure to either PRF or PMF. When expressed as a percent of control level labeled cells, PRF labeled more neurons than did PMF. These percentages for PRF and PMF, added together, parallel the percentage of labeled vomeronasal neurons when females are exposed to the whole pheromone. Conclusion This study suggests that two specific populations of female vomeronasal neurons are responsible for responding to each of the two components of the male pheromone mixture. These two neural populations, therefore, could express different receptors which, in turn, transmit different information to the brain, thus accounting for the different female behavior elicited by each pheromone component. PMID:16553953

  9. Biology of tiny animals: three new species of minute salamanders (Plethodontidae: Thorius) from Oaxaca, Mexico

    PubMed Central

    Rovito, Sean M.; García-París, Mario; Maisano, Jessica A.; Wake, David B.

    2016-01-01

    We describe three new species of minute salamanders, genus Thorius, from the Sierra Madre del Sur of Oaxaca, Mexico. Until now only a single species, T. minutissimus, has been reported from this region, although molecular data have long shown extensive genetic differentiation among geographically disjunct populations. Adult Thorius pinicola sp. nov., T. longicaudus sp. nov., and T. tlaxiacus sp. nov. are larger than T. minutissimus and possess elliptical rather than oval nostrils; T. pinicola and T. longicaudus also have longer tails. All three new species occur west of the range of T. minutissimus, which has the easternmost distribution of any member of the genus. The new species are distinguished from each other and from other named Thorius in Oaxaca by a combination of adult body size, external morphology and osteology, and by protein characters (allozymes) and differences in DNA sequences. In addition, we redescribe T. minutissimus and a related species, T. narisovalis, to further clarify the taxonomic status of Oaxacan populations and to facilitate future studies of the remaining genetically differentiated Thorius that cannot be satisfactorily assigned to any named species. Populations of all five species considered here appear to have declined dramatically over the last one or two decades and live specimens are difficult to find in nature. Thorius may be the most endangered genus of amphibians in the world. All species may go extinct before the end of this century. PMID:27896029

  10. Streambed microstructure predicts evolution of development and life history mode in the plethodontid salamander Eurycea tynerensis

    PubMed Central

    Bonett, Ronald M; Chippindale, Paul T

    2006-01-01

    Background Habitat variation strongly influences the evolution of developmentally flexible traits, and may drive speciation and diversification. The plethodontid salamander Eurycea tynerensis is endemic to the geologically diverse Ozark Plateau of south-central North America, and comprises both strictly aquatic paedomorphic populations (achieving reproductive maturity while remaining in the larval form) and more terrestrial metamorphic populations. The switch between developmental modes has occurred many times, but populations typically exhibit a single life history mode. This unique system offers an opportunity to study the specific ecological circumstances under which alternate developmental and life history modes evolve. We use phylogenetic independent contrasts to test for relationships between a key microhabitat feature (streambed sediment) and this major life history polymorphism. Results We find streambed microstructure (sediment particle size, type and degree of sorting) to be highly correlated with life-history mode. Eurycea tynerensis is paedomorphic in streams containing large chert gravel, but metamorphoses in nearby streams containing poorly sorted, clastic material such as sandstone or siltstone. Conclusion Deposits of large chert gravel create loosely associated streambeds, which provide access to subsurface water during dry summer months. Conversely, streambeds composed of more densely packed sandstone and siltstone sediments leave no subterranean refuge when surface water dries, presumably necessitating metamorphosis and use of terrestrial habitats. This represents a clear example of the relationship between microhabitat structure and evolution of a major developmental and life history trait, and has broad implications for the role of localized ecological conditions on larger-scale evolutionary processes. PMID:16512919

  11. Generalisation within specialization: inter-individual diet variation in the only specialized salamander in the world.

    PubMed

    Costa, Andrea; Salvidio, Sebastiano; Posillico, Mario; Matteucci, Giorgio; De Cinti, Bruno; Romano, Antonio

    2015-08-21

    Specialization is typically inferred at population and species level but in the last decade many authors highlighted this trait at the individual level, finding that generalist populations can be composed by both generalist and specialist individual. Despite hundreds of reported cases of individual specialization there is a complete lack of information on inter-individual diet variation in specialist species. We studied the diet of the Italian endemic Spectacled Salamander (Salamandrina perspicillata), in a temperate forest ecosystem, to disclose the realised trophic niche, prey selection strategy in function of phenotypic variation and inter-individual diet variation. Our results showed that Salamandrina is highly specialized on Collembola and the more specialized individuals are the better performing ones. Analyses of inter-individual diet variation showed that a subset of animals exhibited a broader trophic niche, adopting different foraging strategies. Our findings reflects the optimal foraging theory both at population and individual level, since animals in better physiological conditions are able to exploit the most profitable prey, suggesting that the two coexisting strategies are not equivalent. At last this species, feeding on decomposers of litter detritus, could play a key role determining litter retention rate, nutrient cycle and carbon sequestration.

  12. Breeding biology of the spotted salamander Ambystoma maculatum (Shaw) in acidic temporary ponds at Cape Cod, USA

    USGS Publications Warehouse

    Portnoy, J.W.

    1990-01-01

    The relationship between water chemistry and breeding success of spotted salamanders Ambystoma maculatum (Shaw) was examined in temporary woodland ponds on outer Cape Cod, Massachusetts in 1985 and 1986. Most pond waters were dilute (3median coductivity = 57 umhos cm-1 (1 umhos cm-1 = 0?1 mSm-1)), acidic (median pH = 4?82), and highly colored (median = 140 Pt-Co units). Most acidity was due to abundant organic acids. Salamander survival to hatching was over 80% at 8 of 12 ponds monitored. Complete mortality, preceded by gross abnormalities, was observed only among embryos in the most acidic spawning pond (pH 4?3-4?5) in both years. Embryo transfers between ponds and laboratory studies indicated that reduced survival was due to the interaction of low pH with high tannin-lignin concentration. The use of amphibian embryonic survival to indicate acid rain effects is complicated by multiple habitat parameters and should only be attempted in conjunction with long-term population monitoring.

  13. A field test of the effect of acidic rain on ion balance in a woodland salamander

    SciTech Connect

    Frisbie, M.P.; Wyman, R.L. )

    1994-06-01

    Earlier laboratory studies demonstrated that red-backed salamanders, Plethodon cinereus, are susceptible to osmotic disruption by low pH substrates. In natural systems, however, acidic input from precipitation may be mediated by soils before it impacts salamanders. We tested the effect of acidic rain on sodium balance in salamanders by confining individuals in enclosure in two forest types (hemlock, beech) for 34 d. Enclosures received artificial rain of either pH 3 or 5 every 3-4 d. Soils inside enclosures in the hemlock forest were more acidic than those in the beech forest at the outset. At termination, [H[sup +

  14. Extreme negative temperatures and body mass loss in the Siberian salamander (Salamandrella keyserlingii, amphibia, hynobiidae).

    PubMed

    Berman, D I; Meshcheryakova, E N; Bulakhova, N A

    2016-05-01

    Frozen Siberian salamander safely tolerates long (45 days) stay at-35°C. Short-term (3 days) cooling down to-50°C was tolerable for 40% of adult individuals; down to-55°C, for 80% of the underyearlings. Generally, the salamanders lose about 28% of the body mass during the pre-hibernating period (before winter, at temperatures as low as 0°C) and during the process of freezing (as low as-5°C). The body weight remained constant upon further cooling (to-35°C). The frozen salamanders have no physiological mechanisms protecting from sublimation.

  15. A new species of salamander (Caudata: Plethodontidae, Bolitoglossa) from Sierra Nevada de Mérida, Venezuela.

    PubMed

    García-Gutiérrez, Javier; Escalona, Moisés; Mora, Andrés; Díaz De Pascual, Amelia; Fermin, Gustavo

    2013-01-01

    In this article, a new species of salamander of the genus Bolitoglossa (Eladinea) from the cloud forest near La Mucuy in Sierra Nevada de Mérida, Venezuelan Andes, is described. Bolitoglossa mucuyensis sp. nov. differs from all Venezuelan salamanders, except B. orestes, by a larger SVL/TL ratio, and from La Culata salamander B. orestes by a reduced webbing extension of the front and hind limbs. Additionally, B. mucuyensis sp. nov. and B. orestes diverge 3.12% in terms of the nucleotide sequence of the 16S rRNA gene, as previously reported, and in 8.1% for the cytb gene as shown in this study.

  16. Potential rapid evolution of foot morphology in Italian plethodontid salamanders (Hydromantes strinatii) following the colonization of an artificial cave.

    PubMed

    Salvidio, S; Crovetto, F; Adams, D C

    2015-07-01

    How organisms respond to environmental change is a long-standing question in evolutionary biology. Species invading novel habitats provide an opportunity to examine contemporary evolution in action and decipher the pace of evolutionary change over short timescales. Here, we characterized phenotypic evolution in the Italian plethodontid salamander, Hydromantes strinatii, following the recent colonization of an artificial cave by a forest floor population. When compared with a nearby and genetically related population in the natural forest floor and a nearby cave population, the artificial cave population displayed significant differences in overall foot shape, with more interdigital webbing relative to the other populations. Further, this population evolved significantly larger feet, which corresponded more closely to those found in other cave populations than to forest floor populations to which the cave population is closely related. Finally, we quantified the rate of evolution for both foot shape and foot area, and found that both traits displayed large and significant evolutionary rates, at levels corresponding to other classic cases of rapid evolution in vertebrates. Together, these findings reveal that the response to novel environmental pressures can be large and rapid and that the anatomical shifts observed in the artificial cave population of H. strinatii may represent a case of rapid evolution in response to novel environmental pressures.

  17. Science Review for the Scott Bar Salamander (Plethodon asupak) and the Siskiyou Mountains Salamander (P. stormi): Biology, Taxonomy, Habitat, and Detection Probabilities/Occupancy

    USGS Publications Warehouse

    DeGross, Douglas J.; Bury, R. Bruce

    2007-01-01

    The Plethodon elongatus Complex in the Klamath-Siskiyou Ecoregion of southern Oregon and northern California includes three species: the Del Norte salamander, Plethodon elongatus; the Siskiyou Mountains salamander, P. stormi; and the Scott Bar salamander, P. asupak. This review aims to summarize the current literature and information available on select topics for P. stormi and P. asupak. These are both terrestrial salamanders belonging to the Family Plethodontidae, which contains more species and has a wider geographic distribution than any other family of salamanders (Wake 1966, 2006; Pough 1989). The genera of this family have greatly diversified ecologically across North America, Central America, northern South America, Sardinia, southeastern France and northwestern Italy, and have recently been discovered on the Korean peninsula (Min et al. 2005). The genus Plethodon is found exclusively in North America and is split into three distinct clades, based upon morphology and phylogenetics (Highton and Larson 1979): eastern small Plethodon, eastern large Plethodon, and the western Plethodon. The western Plethodon are the greatest representation of Plethodontidae in the Pacific Northwest, with 8 species. The two species with the most restricted ranges of these regional congeners are the Siskiyou Mountains and Scott Bar salamanders. These salamanders occupy the interior of the Klamath-Siskiyou Ecoregion which straddles the California and Oregon state lines, between Siskiyou County (CA) and Jackson and Josephine Counties (OR). The relatively recent discovery of P. asupak (Mead et al. 2005) and the limited range of both species have created an environment of uncertain conservation status for these species. This review will focus on four central topics of concern for land and resource managers: Biology; Taxonomy; Habitat; and Detection Probabilities/Occupancy.

  18. Utah Marbles and Mars Blueberries: Comparitive Terrestrial Analogs for Hematite Concretions on Mars

    NASA Astrophysics Data System (ADS)

    Chan, M. A.; Beitler, B.; Parry, W. T.; Ormö, J.; Komatsu, G.

    2005-03-01

    Compelling comparisons show why Utah iron oxide-cemented "marbles" are a good analog for Mars hematite "blueberries". Terrestrial examples offer valuable models for interpreting the diagenetic history and importance of water on Mars.

  19. Methods for tracing the origin of white marbles used in antiquity

    NASA Astrophysics Data System (ADS)

    Prochaska, Walter; Grillo, Silvana Maria

    2013-04-01

    The topic of this paper is to given an overview of the methods to pinpoint the origin of white marbles and to discuss the progress made in this field during the last years. To pinpoint the place of origin of the marble to an area or even to a special quarry may be of appreciable importance in investigating ancient trading routes and trade relations. A material-specific classification can be conducive to understand if the workshops of an area used marbles of acceptable quality from a local quarry or quarrying areas or if they used imported marbles in or without combination with local ones. Furthermore during restoration activities the knowledge of the origin of the marbles used in architecture may be of importance for supplying more or less original types of marbles. It may also be of interest for evaluating the authenticity of artifact information on the provenance of the used material. The first attempt to discriminate between different marbles used petrographic methods followed by instrumental chemical analyses, especially the analysis of trace elements. In the last decades multi-element neutron activation analysis (NAA) of various trace elements was attempted to pinpoint the origins of marbles. A few decades ago stable isotope analysis seemed to be the solution of this problem and became the standard methods for investigation the origin of white marbles. However, with the rapidly increasing number of historical marble quarrying sites and with the increasing number of analyzed samples in general, the compositional fields in the isotope diagram became larger and many classical marbles show large ranges of overlap. Therefore special attention is drawn to a new method to characterize the chemical properties of microinclusiones of the marbles additional to the conventionally used methods to ascribe their origin to a special quarry or at least to a defined geological formation of a given area. Several case studies will be presented: Different types of marbles were

  20. Using marble wastes as a soil amendment for acidic soil neutralization.

    PubMed

    Tozsin, Gulsen; Arol, Ali Ihsan; Oztas, Taskin; Kalkan, Ekrem

    2014-01-15

    One of the most important factors limiting plant growth is soil pH. The objective of this study is to determine the effectiveness of marble waste applications on neutralization of soil acidity. Marble quarry waste (MQW) and marble cutting waste (MCW) were applied to an acid soil at different rates and their effectiveness on neutralization was evaluated by a laboratory incubation test. The results showed that soil pH increased from 4.71 to 6.36 and 6.84 by applications of MCW and MQW, respectively. It was suggested that MQW and MCW could be used as soil amendments for the neutralization of acid soils and thus the negative impact of marble wastes on the environment could be reduced.

  1. Marble tombstone in national cemeteries as indicators of stone damage: general methods

    SciTech Connect

    Baer, N.S.; Berman, S.M.

    1983-01-01

    The role of acid deposition in damage to materials exposed to the environment is a matter of national concern. Marble tombstones are an example of widely distributed materials of uniform composition which have known times of exposure. A study of marble tombstones in 23 national cemeteries and soldiers lots in private cemeteries identified the marble source, the method of cutting, historical data, and physical measurements. The results show that fine-grained Vermont marble should be used as a standard in short-term exposure studies because it weathers more rapidly. A comparison of the weathering rates for rural, suburban, and urban cemeteries with comparable climates with high annual precipitation levels indicates that the urban environment causes significant damage beyond that observed in rural environments and that local sources dominate the deposition of damaging pollutants. 16 references, 6 figures, 4 tables.

  2. Weight losses of marble and limestone briquettes exposed to outdoor environments in the eastern United States

    SciTech Connect

    Youngdahl, C.A.

    1987-08-01

    Weight losses of marble and limestone samples exposed to outdoor environments at field sites in the eastern United States have been monitored in studies initiated in 1984. The prodcedures are described, and the results are tabulated and discussed. A rate of marble loss approximately equivalent to 16 ..mu..m of surface recession per year was found in North Carolina, and losses of this order were also observed in New Jersey, New York, and Washington, DC. Limestone weight losses were much higher than for marble in the first year; loss of extraneous materials from the porous limestone appeared to be a likely contributor to the overall loss. The rate of limestone loss diminished in the second year, though it continued to be higher than for marble. Exposures are continuing in a planned 10-yr program of tests. 8 refs., 3 figs., 5 tabs.

  3. Spermatogenic cycle of a plethodontid salamander, Eurycea longicauda (Amphibia, Urodela).

    PubMed

    Siegel, Dustin S; Alvino, Sam; Trauth, Stanley E; Sever, David M; Gribbins, Kevin M

    2014-01-01

    Previous investigators have described the spermatogenic cycles of numerous species of plethodontid salamanders. Most studies describe a fairly stereotypical cycle with meiotic divisions of spermatogenesis commencing in the spring/summer. However, many studies lack details obtainable from histological examination and/or testicular squashes and, instead, provide only mensural data from the testes. Studies that lacked microscopic evaluation often revealed spermatogenic cycles that varied greatly from that of the stereotypical cycle with meiotic divisions commencing in the fall/winter. Those studies hamper comparisons between the spermatogenic cycles of different species and their environments, as they do not provide a correlation between testicular size and any aspect of the spermatogenic cycle. In the following manuscript, we elucidate the spermatogenic cycle of Eurycea longicauda longicauda in an effort to outline an appropriate protocol for analyzing spermatogenesis in salamanders that will facilitate future comparative studies. Like many Nearctic plethodontids, E. l. longicauda exhibits a meiotic wave that travels through the testes during the summer; this process is followed by spermiogenesis, spermiation, and recrudescence in the fall, winter, and spring.

  4. Sensitivity of two salamander (Ambystoma) species to ultraviolet radiation

    USGS Publications Warehouse

    Calfee, R.D.; Bridges, C.M.; Little, E.E.

    2006-01-01

    Increased ultraviolet-B (UV-B) radiation reaching the Earth's surface has been implicated in amphibian declines. Recent studies have shown that many amphibian species have differences in sensitivity depending on developmental stage. Embryos and larvae of Ambystoma maculatum (Spotted Salamander) and larvae of Ambystoma talpoideum (Mole Salamander) were exposed to five simulated UV-B treatments in controlled laboratory experiments to determine the relative sensitivity of different lifestages. Hatching success of the embryos exceeded 95% in all treatments; however, the larvae of both species exhibited greater sensitivity to UV-B exposure. Older larvae of A. maculatum that were not exposed to UV-B as embryos were more sensitive than larvae that had hatched during exposure to UV-B. Growth of surviving larvae of A. maculatum was significantly reduced as UV-B intensity increased, whereas growth of A. talpoideum was unaffected. These results were compared to ambient UV-B conditions in natural environments. It appears that the embryo stage is relatively unaffected by UV-B levels observed in natural habitats, probably because of protection from vegetation, organic matter in the water column, oviposition depth, and egg jelly. The larval stage of these species may be at greater risk, particularly if there is an increase in UV-B radiation exposure caused by increases in water clarity and/or decreases in dissolved organic carbon.

  5. Spermatogenic cycle of a plethodontid salamander, Eurycea longicauda (Amphibia, Urodela)

    PubMed Central

    Siegel, Dustin S; Alvino, Sam; Trauth, Stanley E; Sever, David M; Gribbins, Kevin M

    2014-01-01

    Previous investigators have described the spermatogenic cycles of numerous species of plethodontid salamanders. Most studies describe a fairly stereotypical cycle with meiotic divisions of spermatogenesis commencing in the spring/summer. However, many studies lack details obtainable from histological examination and/or testicular squashes and, instead, provide only mensural data from the testes. Studies that lacked microscopic evaluation often revealed spermatogenic cycles that varied greatly from that of the stereotypical cycle with meiotic divisions commencing in the fall/winter. Those studies hamper comparisons between the spermatogenic cycles of different species and their environments, as they do not provide a correlation between testicular size and any aspect of the spermatogenic cycle. In the following manuscript, we elucidate the spermatogenic cycle of Eurycea longicauda longicauda in an effort to outline an appropriate protocol for analyzing spermatogenesis in salamanders that will facilitate future comparative studies. Like many Nearctic plethodontids, E. l. longicauda exhibits a meiotic wave that travels through the testes during the summer; this process is followed by spermiogenesis, spermiation, and recrudescence in the fall, winter, and spring. PMID:26413402

  6. Variation in mating systems of salamanders: mate guarding or territoriality?

    PubMed

    Deitloff, Jennifer; Alcorn, Michael A; Graham, Sean P

    2014-07-01

    Two of the most common mating tactics in vertebrates are mate guarding and territoriality, yet much of the research on these strategies has focused on mating systems in birds, despite novel insights gained from studying less traditional systems. North American stream salamanders that comprise the Eurycea bislineata complex represent an excellent nontraditional system for comparing mating strategies because these species exhibit a continuum of male morphologies, diverse habitat associations, and various potential mating strategies. We studied two species within this complex that exhibit the extremes of this continuum, Eurycea aquatica (robust morph) and Eurycea cirrigera (slender morph). The larger head in males of E. aquatica is due to larger musculature around the jaw and may be associated with aggressive behavior. Therefore, we hypothesized that the robust morphology exhibited by males of E. aquatica provides benefits during either territorial defense or mate defense and that males of E. cirrigera would not exhibit aggression in either scenario. We found that neither species exhibited aggressive behavior to defend a territory. However, in the presence of a female, males of E. aquatica were significantly more aggressive toward intruding males than were males of E. cirrigera. Therefore, mate-guarding behavior occurs in E. aquatica, and the enlarged head of males likely aids in deterring rivals. This is the first demonstration of mate-guarding behavior in a plethodontid, the most speciose family of salamanders.

  7. Elevated plasma corticosterone increases metabolic rate in a terrestrial salamander.

    PubMed

    Wack, Corina L; DuRant, Sarah E; Hopkins, William A; Lovern, Matthew B; Feldhoff, Richard C; Woodley, Sarah K

    2012-02-01

    Plasma glucocorticoid hormones (GCs) increase intermediary metabolism, which may be reflected in whole-animal metabolic rate. Studies in fish, birds, and reptiles have shown that GCs may alter whole-animal energy expenditure, but results are conflicting and often involve GC levels that are not physiologically relevant. A previous study in red-legged salamanders found that male courtship pheromone increased plasma corticosterone (CORT; the primary GC in amphibians) concentrations in males, which could elevate metabolic processes to sustain courtship behaviors. To understand the possible metabolic effect of elevated plasma CORT, we measured the effects of male courtship pheromone and exogenous application of CORT on oxygen consumption in male red-legged salamanders (Plethodon shermani). Exogenous application of CORT elevated plasma CORT to physiologically relevant levels. Compared to treatment with male courtship pheromone and vehicle, treatment with CORT increased oxygen consumption rates for several hours after treatment, resulting in 12% more oxygen consumed (equivalent to 0.33 J) during our first 2h sampling period. Contrary to our previous work, treatment with pheromone did not increase plasma CORT, perhaps because subjects used in this study were not in breeding condition. Pheromone application did not affect respiration rates. Our study is one of the few to evaluate the influence of physiologically relevant elevations in CORT on whole-animal metabolism in vertebrates, and the first to show that elevated plasma CORT increases metabolism in an amphibian.

  8. Liquid marbles prepared from pH-responsive sterically stabilized latex particles.

    PubMed

    Fujii, Syuji; Suzaki, Motomichi; Armes, Steven P; Dupin, Damien; Hamasaki, Sho; Aono, Kodai; Nakamura, Yoshinobu

    2011-07-05

    Submicrometer-sized pH-responsive sterically stabilized polystyrene (PS) latex particles were synthesized by dispersion polymerization in isopropyl alcohol with a poly[2-(diethylamino)ethyl methacrylate]- (PDEA-) based macroinitiator. These PDEA-PS latexes were extensively characterized with respect to their particle size distribution, morphology, chemical composition, and pH-responsive behavior. Millimeter- and centimeter-sized "liquid marbles" with aqueous volumes varying between 15 μL and 2.0 mL were readily prepared by rolling water droplets on the dried PDEA-PS latex powder. The larger liquid marbles adopted nonspherical shapes due to gravitational forces; analysis of this deformation enabled the surface tension to be estimated. Scanning electron microscopy and fluorescence microscopy studies indicated that flocs of the PDEA-PS particles were adsorbed at the surface of these water droplets, leading to stable liquid marbles. The relative mechanical integrity of the liquid marbles prepared from alkaline aqueous solution (pH 10) was higher than those prepared from acidic aqueous solution (pH 2) as judged by droplet roller experiments. These liquid marbles exhibited long-term stability (over 1 h) when transferred onto the surface of liquid water, provided that the solution pH of the subphase was above pH 8. In contrast, the use of acidic solutions led to immediate disintegration of these liquid marbles within 10 min, with dispersal of the PDEA-PS latex particles in the aqueous solution. Thus the critical minimum solution pH required for long-term liquid marble stability correlates closely with the known pK(a) value of 7.3 for the PDEA stabilizer chains. Stable liquid marbles were also successfully prepared from aqueous Gellan gum solution and glycerol.

  9. Microsatellite mutation rates in the eastern tiger salamander (Ambystoma tigrinum tigrinum) differ 10-fold across loci.

    PubMed

    Bulut, Zafer; McCormick, Cory R; Gopurenko, David; Williams, Rod N; Bos, David H; DeWoody, J Andrew

    2009-07-01

    Microsatellites are commonly used for mapping and population genetics because of their high heterozygosities and allelic variability (i.e., polymorphism). Microsatellite markers are generally more polymorphic than other types of molecular markers such as allozymes or SNPs because the insertions/deletions that give rise to microsatellite variability are relatively common compared to nucleotide substitutions. Nevertheless, direct evidence of microsatellite mutation rates (MMRs) is lacking in most vertebrate groups despite the importance of such estimates to key population parameters (e.g., genetic differentiation or theta = 4N (e)micro). Herein, we present empirical data on MMRs in eastern tiger salamanders (Ambystoma tigrinum tigrinum). We conducted captive breeding trials and genotyped over 1,000 offspring at a suite of microsatellite loci. These data on 7,906 allele transfers provide the first direct estimates of MMRs in amphibians, and they illustrate that MMRs can vary by more than an order of magnitude across loci within a given species (one locus had ten mutations whereas the others had none).

  10. Lignin-AuNPs liquid marble for remotely-controllable detection of Pb2+

    PubMed Central

    Han, Guocheng; Wang, Xiaoying; Hamel, Jonathan; Zhu, Hongli; Sun, Runcang

    2016-01-01

    This work reported the green and facile fabrication of a versatile lignin-AuNP composite, which was readily and remotely encapsulated to form novel liquid marbles. The marbles can stay suspended in water, and show excellent photothermal conversion properties, as well as visual detection and adsorption towards Pb2+. More importantly, the marbles can simultaneously remotely detect and adsorb Pb2+ via co-precipitation by simply controlling the near infrared (NIR) irradiation. It is believed that the remotely-controllable NIR-responsive lignin-AuNPs liquid marble can be used in Pb2+-related reactions. The liquid marble can be placed in the system at the very beginning of the reaction and stably stays on the surface until the reaction has ended. After reacting, upon remote NIR irradiation, the liquid marble bursts to adsorb Pb2+, and the residual Pb2+ can be collected. This facile manipulation strategy does not use complicated nanostructures or sophisticated equipment, so it has potential applications for channel-free microfluidics, smart microreactors, microengines, and so on. PMID:27909335

  11. Laboratory Investigations for the Role of Flushing Media in Diamond Drilling of Marble

    NASA Astrophysics Data System (ADS)

    Bhatnagar, A.; Khandelwal, Manoj; Rao, K. U. M.

    2011-05-01

    Marble is used as a natural stone for decorative purposes from ages. Marble is a crystalline rock, composed predominantly of calcite, dolomite or serpentine. The presence of impurities imparts decorative pattern and colors. The diamond-based operations are extensively used in the mining and processing of marble. Marble is mined out in the form of blocks of cuboids shape and has to undergo extensive processing to make it suitable for the end users. The processing operation includes slabbing, sizing, polishing, etc. Diamond drilling is also commonly used for the exploration of different mineral deposits throughout the world. In this paper an attempt has been made to enhance the performance of diamond drilling on marble rocks by adding polyethylene-oxide (PEO) in the flushing water. The effect of PEO added with the drilling water was studied by varying different machine parameters and flushing media concentration in the laboratory. The responses were rate of penetration and torque at bit-rock interface. Different physico-mechanical properties of marble were also determined. It was found that flushing water added with PEO can substantially enhance the penetration rates and reduce the torque developed at the bit-rock interface as compared to plain flushing water.

  12. Proteome Analysis of Bovine Longissimus dorsi Muscle Associated with the Marbling Score

    PubMed Central

    Shen, Y. N.; Kim, S. H.; Yoon, D. H.; Lee, H. G.; Kang, H. S.; Seo, K. S.

    2012-01-01

    The breeding value of marbling score in skeletal muscle is an important factor for evaluating beef quality. In the present study, we investigated proteins associated with the breeding value of the marbling score for bovine sirloin to select potential biomarkers to improve meat quality through comparative proteomic analysis. Proteins isolated from muscle were separated by two-dimensional gel electrophoresis. After analyzing images of the stained gel, seven protein spots for the high marbling score group were identified corresponding to changes in expression that were at least two-fold compared to the low marbling score group. Four spots with increased intensities in the high marbling score group were identified as phosphoglycerate kinase 1, triosephophate isomerase, acidic ribosomal phosphoprotein PO, and capping protein (actin filament) Z-line alpha 2. Spots with decreased intensities in the high marbling score group compared to the low score group were identified as 14-3-3 epsilon, carbonic anhydrase II, and myosin light chain 1. Expression of myosin light chain 1 and carbonic anhydrase 2 was confirmed by Western blotting. Taken together, these data could help improve the economic performance of cattle and provide useful information about the underlying the function of bovine skeletal muscle. PMID:25049666

  13. Switchable Opening and Closing of a Liquid Marble via Ultrasonic Levitation.

    PubMed

    Zang, Duyang; Li, Jun; Chen, Zhen; Zhai, Zhicong; Geng, Xingguo; Binks, Bernard P

    2015-10-27

    Liquid marbles have promising applications in the field of microreactors, where the opening and closing of their surfaces plays a central role. We have levitated liquid water marbles using an acoustic levitator and, thereby, achieved the manipulation of the particle shell in a controlled manner. Upon increasing the sound intensity, the stable levitated liquid marble changes from a quasi-sphere to a flattened ellipsoid. Interestingly, a cavity on the particle shell can be produced on the polar areas, which can be completely healed when decreasing the sound intensity, allowing it to serve as a microreactor. The integral of the acoustic radiation pressure on the part of the particle surface protruding into air is responsible for particle migration from the center of the liquid marble to the edge. Our results demonstrate that the opening and closing of the liquid marble particle shell can be conveniently achieved via acoustic levitation, opening up a new possibility to manipulate liquid marbles coated with non-ferromagnetic particles.

  14. Development of tailored ceramic microstructures using recycled marble processing residue as pore-former

    NASA Astrophysics Data System (ADS)

    Domopoulou, A.; Spiliotis, X.; Charalampides, G.; Baklavaridis, A.; Papapolymerou, G.; Karayannis, V.

    2016-06-01

    Recycling of marble processing residue is significant since marble processing constitutes an important industrial sector. Therefore, the sustainable management and the valorisation, in an economically profitable manner, of this industrial by-product should be considered. In this work, the potential use of marble residue as pore-former into clayey mixtures for the production of lightweight, porous and thermal insulating ceramics is investigated. Four samples consisting of clayey ceramic body incorporating up to 50 wt.% fine marble residue powder were produced. The final ceramic products were produced upon firing (sintering) at 950oC. Porosity and thermal conductivity measurements were carried out in order to assess the thermal insulating behavior of the produced sintered ceramics. The porosity of the sintered ceramics increases substantially by increasing the marble residue admixture loading. This, in turn, leads to a decrease in thermal conductivity. Consequently, the marble residue can be successfully employed as pore-forming agent, in order to improve the insulating behavior of the ceramic materials.

  15. Lignin-AuNPs liquid marble for remotely-controllable detection of Pb2+

    NASA Astrophysics Data System (ADS)

    Han, Guocheng; Wang, Xiaoying; Hamel, Jonathan; Zhu, Hongli; Sun, Runcang

    2016-12-01

    This work reported the green and facile fabrication of a versatile lignin-AuNP composite, which was readily and remotely encapsulated to form novel liquid marbles. The marbles can stay suspended in water, and show excellent photothermal conversion properties, as well as visual detection and adsorption towards Pb2+. More importantly, the marbles can simultaneously remotely detect and adsorb Pb2+ via co-precipitation by simply controlling the near infrared (NIR) irradiation. It is believed that the remotely-controllable NIR-responsive lignin-AuNPs liquid marble can be used in Pb2+-related reactions. The liquid marble can be placed in the system at the very beginning of the reaction and stably stays on the surface until the reaction has ended. After reacting, upon remote NIR irradiation, the liquid marble bursts to adsorb Pb2+, and the residual Pb2+ can be collected. This facile manipulation strategy does not use complicated nanostructures or sophisticated equipment, so it has potential applications for channel-free microfluidics, smart microreactors, microengines, and so on.

  16. Life history differences influence the impacts of drought on two pond-breeding salamanders.

    PubMed

    Anderson, Thomas L; Ousterhout, Brittany H; Peterman, William E; Drake, Dana L; Semlitsch, Raymond D

    2015-10-01

    Drought is a strong density-independent environmental filter that contributes to population regulation and other ecological processes. Not all species respond similarly to drought, and the overall impacts can vary depending on life histories. Such differences can necessitate management strategies that incorporate information on individual species to maximize conservation success. We report the effects of a short-term drought on occupancy and reproductive success of two pond-breeding salamanders that differ in breeding phenology (fall vs. spring breeder) across an active military base landscape in Missouri, USA: We surveyed ~200 ponds for the presence of eggs, larvae, and metamorphs from 2011 to 2013. This period coincided with before, during, and after a severe drought that occurred in 2012. The two species showed contrasting responses to drought, where high reproductive failure (34% of ponds) was observed for the spring breeder during a single drought year. Alternatively, the fall breeder only showed a cumulative 8% failure over two years. The number of breeding ponds available for use in the fall decreased during the drought due to pond drying and/or a lack of re-filling. Estimates of occupancy probability declined for the fall-breeding salamander between 2012 and 2013, whereas occupancy probability estimates of the spring breeder increased post-drought. The presence of fish, hydroperiod, the amount of forest cover surrounding ponds, and canopy cover were all found to affect estimates of occupancy probabilities of each species. Pond clustering (distance to nearest pond and the number of ponds within close proximity), hydroperiod, forest cover, and canopy cover influenced both estimates of colonization and extinction probabilities. Our results show life history variation can be important in determining the relative susceptibility of a species to drought conditions, and that sympatric species experiencing the same environmental conditions can respond differently

  17. Population.

    ERIC Educational Resources Information Center

    King, Pat; Landahl, John

    This pamphlet has been prepared in response to a new problem, a rapidly increasing population, and a new need, population education. It is designed to help teachers provide their students with some basic population concepts with stress placed on the elements of decision making. In the first section of the pamphlet, some of the basic concepts of…

  18. [Population].

    PubMed

    1979-01-01

    Data on the population of Venezuela between 1975 and 1977 are presented in descriptive tables and graphs. Information is included on the employed population according to category, sex, and type of economic activity, and by sex, age, and area on the employment rate and the total, the economically active, and the unemployed population.

  19. [Phylogenetic relationships among Asiatic salamanders of the genus Salamandrella based on variability of nuclear genes].

    PubMed

    Maliarchuk, B A; Derenko, M V; Denisova, G A

    2015-01-01

    Based on sequence variation of three nuclear genome genes (BDNF, POMC, and RAG1), the phylogenetic relationships among Asiatic salamanders of the genus Salamandrella, Siberian salamander (S. keyserlingii) and Schrenk salamander (S. schrenkii), were examined. Both species demonstrated high levels of heterozygosity determined by intraspecific polymorphism. Fixed interspecific differences were revealed at one nucleotide position of the RAG1 gene, and thus the level of interspecific divergence over the three genes constituted only 0.04%. Analysis of the RAG1 polymorphism across the whole range of S. keyserlingii showed that only one gene variant, encoding for modified RAG1 recombinase, had the highest distribution to the north of the Amur region (west and northeast of Siberia). It is possible that the changes in the RAG1 gene in Siberian salamander are of an adaptive nature. However, cases of interspecific hybridization were identified in Jewish autonomous oblast (JAO), which contains one of the range borders between the two Salamandrella species.

  20. Larval salamanders and channel geomorphology are indicators of hydrologic permanence in forested headwater streams

    EPA Science Inventory

    Regulatory agencies need rapid indicators of hydrologic permanence for jurisdictional determinations of headwater streams. Our study objective was to assess the utility of larval salamander presence and assemblage structure and habitat variables for determining stream permanence ...

  1. Overwintered Bullfrog tadpoles negatively affect Salamanders and Anurans in native amphibian communities

    USGS Publications Warehouse

    Boone, M.D.; Little, E.E.; Semlitsch, R.D.

    2004-01-01

    We examined the interactive effects of overwintered Bullfrog (Rana catesbeiana) tadpoles and pond hydroperiod on a community of larval amphibians in outdoor mesocosms including American Toads (Bufo americanus), Southern Leopard Frogs (Rana sphenocephala), and Spotted Salamanders (Ambystoma maculatum) - species within the native range of Bullfrogs. Spotted Salamanders and Southern Leopard Frogs were negatively influenced by the presence of overwintered Bullfrogs. Spotted Salamanders had shorter larval periods and slightly smaller masses at metamorphosis, and Southern Leopard Frogs had smaller masses at metamorphosis when reared with Bullfrogs than without. Presence of overwintered Bullfrogs, however, did not significantly affect American Toads. Longer pond hydroperiods resulted in greater survival, greater size at metamorphosis, longer larval periods, and later time until emergence of the first metamorphs for Southern Leopard Frog tadpoles and Spotted Salamander larvae. Our study demonstrated that overwintered Bullfrog tadpoles can respond to changing pond hydroperiods and can negatively impact metamorphosis of native amphibians.

  2. Salamander regeneration as a model for developing novel regenerative and anticancer therapies.

    PubMed

    Fior, Jonathan

    2014-01-01

    Among vertebrates, urodele amphibians are the only tetrapods with the ability to regenerate complex structures such as limbs, tail, and spinal cord throughout their lives. Furthermore, the salamander regeneration process has been shown to reverse tumorigenicity. Fibroblasts are essential for salamander regeneration, but the mechanisms underlying their role in the formation of a regeneration blastema remain unclear. Here, I review the role of fibroblasts in salamander limb regeneration and how their activity compares with that of human fibroblasts. In addition, the question of whether salamander blastema tissue could induce regeneration and tumor regression in animals with a limited regeneration ability is discussed. A deeper understanding of these processes may lead to the development of novel regenerative and anticancer therapies.

  3. Diagnostic and molecular evaluation of three iridovirus-associated salamander mortality events.

    PubMed

    Docherty, Douglas E; Meteyer, Carol U; Wang, Jun; Mao, Jinghe; Case, Steven T; Chinchar, V Gregory

    2003-07-01

    In 1998 viruses were isolated from tiger salamander larvae (Ambystoma tigrinum diaboli and A. tigrinum melanostictum) involved in North Dakota and Utah (USA) mortality events and spotted salamander (A. maculatum) larvae in a third event in Maine (USA). Although sympatric caudates and anurans were present at all three sites only ambystomid larvae appeared to be affected. Mortality at the North Dakota site was in the thousands while at the Utah and Maine sites mortality was in the hundreds. Sick larvae were lethargic and slow moving. They swam in circles with obvious buoyancy problems and were unable to remain upright. On the ventral surface, near the gills and hind limbs, red spots or swollen areas were noted. Necropsy findings included: hemorrhages and ulceration of the skin, subcutaneous and intramuscular edema, swollen and pale livers with multifocal hemorrhage, and distended fluid-filled intestines with areas of hemorrhage. Light microscopy revealed intracytoplasmic inclusions, suggestive of a viral infection, in a variety of organs. Electron microscopy of ultra thin sections of the same tissues revealed iridovirus-like particles within the inclusions. These viruses were isolated from a variety of organs, indicating a systemic infection. Representative viral isolates from the three mortality events were characterized using molecular assays. Characterization confirmed that the viral isolates were iridoviruses and that the two tiger salamander isolates were similar and could be distinguished from the spotted salamander isolate. The spotted salamander isolate was similar to frog virus 3, the type species of the genus Ranavirus, while the tiger salamander isolates were not. These data indicate that different species of salamanders can become infected and die in association with different iridoviruses. Challenge assays are required to determine the fish and amphibian host range of these isolates and to assess the susceptibility of tiger and spotted salamanders to

  4. Diagnostic and molecular evaluation of three iridovirus-associated salamander mortality events

    USGS Publications Warehouse

    Docherty, D.E.; Meteyer, C.U.; Wang, Jingyuan; Mao, J.; Case, S.T.; Chinchar, V.G.

    2003-01-01

    In 1998 viruses were isolated from tiger salamander larvae (Ambystoma tigrinum diaboli and A. tigrinum melanostictum) involved in North Dakota and Utah (USA) mortality events and spotted salamander (A. maculatum) larvae in a third event in Maine (USA). Although sympatric caudates and anurans were present at all three sites only ambystomid larvae appeared to be affected. Mortality at the North Dakota site was in the thousands while at the Utah and Maine sites mortality was in the hundreds. Sick larvae were lethargic and slow moving. They swam in circles with obvious buoyancy problems and were unable to remain upright. On the ventral surface, near the gills and hind limbs, red spots or swollen areas were noted. Necropsy findings included: hemorrhages and ulceration of the skin, subcutaneous and intramuscular edema, swollen and pale livers with multifocal hemorrhage, and distended fluid-filled intestines with areas of hemorrhage. Light microscopy revealed intracytoplasmic inclusions, suggestive of a viral infection, in a variety of organs. Electron microscopy of ultra thin sections of the same tissues revealed iridovirus-like particles within the inclusions. These viruses were isolated from a variety of organs, indicating a systemic infection. Representative viral isolates from the three mortality events were characterized using molecular assays. Characterization confirmed that the viral isolates were iridoviruses and that the two tiger salamander isolates were similar and could be distinguished from the spotted salamander isolate. The spotted salamander isolate was similar to frog virus 3, the type species of the genus Ranavirus, while the tiger salamander isolates were not. These data indicate that different species of salamanders can become infected and die in association with different iridoviruses. Challenge assays are required to determine the fish and amphibian host range of these isolates and to assess the susceptibility of tiger and spotted salamanders to

  5. Local and landscape scale factors influencing edge effects on woodland salamanders.

    PubMed

    Moseley, Kurtis R; Ford, W Mark; Edwards, John W

    2009-04-01

    We examined local and landscape-scale variable influence on the depth and magnitude of edge effects on woodland salamanders in mature mixed mesophytic and northern hardwood forest adjacent to natural gas well sites maintained as wildlife openings. We surveyed woodland salamander occurrence from June-August 2006 at 33 gas well sites in the Monongahela National Forest, West Virginia. We used an information-theoretic approach to test nine a priori models explaining landscape-scale effects on woodland salamander capture proportion within 20 m of field edge. Salamander capture proportion was greater within 0-60 m than 61-100 m of field edges. Similarly, available coarse woody debris proportion was greater within 0-60 m than 61-100 m of field edge. Our ASPECT model, that incorporated the single variable aspect, received the strongest support for explaining landscape-scale effects on salamander capture proportion within 20 m of opening edge. The ASPECT model indicated that fewer salamanders occurred within 20 m of opening edges on drier, hotter southwestern aspects than in moister, cooler northeastern aspects. Our results suggest that forest habitat adjacent to maintained edges and with sufficient cover still can provide suitable habitat for woodland salamander species in central Appalachian mixed mesophytic and northern hardwood forests. Additionally, our modeling results support the contention that edge effects are more severe on southwesterly aspects. These results underscore the importance of distinguishing among different edge types as well as placing survey locations within a landscape context when investigating edge impacts on woodland salamanders.

  6. Tiger salamanders' (Ambystoma tigrinum) response learning and usage of visual cues.

    PubMed

    Kundey, Shannon M A; Millar, Roberto; McPherson, Justin; Gonzalez, Maya; Fitz, Aleyna; Allen, Chadbourne

    2016-05-01

    We explored tiger salamanders' (Ambystoma tigrinum) learning to execute a response within a maze as proximal visual cue conditions varied. In Experiment 1, salamanders learned to turn consistently in a T-maze for reinforcement before the maze was rotated. All learned the initial task and executed the trained turn during test, suggesting that they learned to demonstrate the reinforced response during training and continued to perform it during test. In a second experiment utilizing a similar procedure, two visual cues were placed consistently at the maze junction. Salamanders were reinforced for turning towards one cue. Cue placement was reversed during test. All learned the initial task, but executed the trained turn rather than turning towards the visual cue during test, evidencing response learning. In Experiment 3, we investigated whether a compound visual cue could control salamanders' behaviour when it was the only cue predictive of reinforcement in a cross-maze by varying start position and cue placement. All learned to turn in the direction indicated by the compound visual cue, indicating that visual cues can come to control their behaviour. Following training, testing revealed that salamanders attended to stimuli foreground over background features. Overall, these results suggest that salamanders learn to execute responses over learning to use visual cues but can use visual cues if required. Our success with this paradigm offers the potential in future studies to explore salamanders' cognition further, as well as to shed light on how features of the tiger salamanders' life history (e.g. hibernation and metamorphosis) impact cognition.

  7. Delayed life history effects, multilevel selection, and evolutionary trade-offs in the California tiger salamander.

    PubMed

    Searcy, Christopher A; Gray, Levi N; Trenham, Peter C; Shaffer, H Bradley

    2014-01-01

    Delayed life history effects (DLHEs) occur when fitness in one life stage affects fitness in subsequent life stages. Given their biphasic life cycle, pond-breeding amphibians provide a natural system for studying DLHEs, although these effects are not restricted to species with biphasic life histories. In this study, we used multiple mark-recapture techniques enabled by a large trapping array to monitor components of fitness and resulting DLHEs in a population of the endangered California tiger salamander (Ambystoma californiense). We found that DLHEs are prominent across all life stage transitions and that there is variation in whether selection acts primarily at the individual or cohort level. We also demonstrated that there is more than an order of magnitude variation in mean cohort fitness, providing tremendous variation for DLHEs to act upon. We documented an evolutionary trade-off between mass at emergence and date of emergence, which may play a role in maintaining the variation in mass (fitness) at emergence. A literature review revealed that such high levels of intercohort variation occur in many other pond-breeding amphibians, and that appropriately documenting the magnitude of intercohort variation requires long-term studies (roughly two population turnovers). Given the profound effect that DLHEs can have on population dynamics, quantifying intercohort variation in mean fitness and the level(s) at which selection acts will be very important for developing accurate models of population dynamics. In general, when developing models of population dynamics, more attention should be paid to variation in mean fitness and not just variation in total numbers.

  8. Woodland salamander responses to a shelterwood harvest-prescribed burn silvicultural treatment within Appalachian mixed-oak forests

    USGS Publications Warehouse

    Ford, W. Mark; Mahoney, Kathleen R.; Russell, Kevin R.; Rodrigue, Jane L.; Riddle, Jason D.; Schuler, Thomas M.; Adams, Mary Beth

    2015-01-01

    Forest management practices that mimic natural canopy disturbances, including prescribed fire and timber harvests, may reduce competition and facilitate establishment of favorable vegetative species within various ecosystems. Fire suppression in the central Appalachian region for almost a century has contributed to a transition from oak-dominated to more mesophytic, fire-intolerant forest communities. Prescribed fire coupled with timber removal is currently implemented to aid in oak regeneration and establishment but responses of woodland salamanders to this complex silvicultural system is poorly documented. The purpose of our research was to determine how woodland salamanders respond to shelterwood harvests following successive burns in a central Appalachian mixed-oak forest. Woodland salamanders were surveyed using coverboard arrays in May, July, and August–September 2011 and 2012. Surveys were conducted within fenced shelterwood-burn (prescribed fires, shelterwood harvest, and fencing to prevent white-tailed deer [Odocoileus virginianus] herbivory), shelterwood-burn (prescribed fires and shelterwood harvest), and control plots. Relative abundance was modeled in relation to habitat variables measured within treatments for mountain dusky salamanders (Desmognathus ochrophaeus), slimy salamanders (Plethodon glutinosus), and eastern red-backed salamanders (Plethodon cinereus). Mountain dusky salamander relative abundance was positively associated with canopy cover and there were significantly more individuals within controls than either shelterwood-burn or fenced shelterwood-burn treatments. Conversely, habitat variables associated with slimy salamanders and eastern red-backed salamanders did not differ among treatments. Salamander age-class structure within controls did not differ from shelterwood-burn or fenced shelterwood-burn treatments for any species. Overall, the woodland salamander assemblage remained relatively intact throughout the shelterwoodburn

  9. Mineralogical characterization of the Shelburne Marble and the Salem limestone: Test stones used to study the effects of acid rain

    SciTech Connect

    McGee, E.S.

    1989-01-01

    The Salem Limestone and the Shelburne Marble are representative of limestones and marbles commonly used in buildings and monuments. Both stones are composed predominantly of calcite. The Salem Limestone is homogeneous in composition and mineralogic characteristics throughout the test block. The Shelburne Marble has compositionally homogeneous mineral phases, but the distribution of those phases within the test block is random. The mineralogy and physical characteristics of the Shelburne Marble and Salem Limestone test blocks described in the study provide a baseline for future studies of the weathering behavior of these stones. Because the Shelburne Marble and the Salem Limestone are representative of typical commercial marbles and limestones, they are likely to be useful in a consortium study of the effects of acid precipitation on these two types of building stones.

  10. Pathology, isolation, and preliminary molecular characterization of a novel iridovirus from tiger salamanders in Saskatchewan.

    PubMed

    Bollinger, T K; Mao, J; Schock, D; Brigham, R M; Chinchar, V G

    1999-07-01

    All iridovirus was confirmed to be the cause of an epizootic in larval and adult tiger salamanders (Ambystoma tigrinum diaboli) from four separate ponds in southern Saskatchewan (Canada) during the summer of 1997. This organism also is suspected, based on electron microscopic findings, to be the cause of mortality of larval tiger salamanders in a pond over 200 km to the north during the same year. Salamanders developed a generalized viremia which resulted in various lesions including: necrotizing, vesicular and ulcerative dermatitis; gastrointestinal ulceration; and necrosis of hepatic, splenic, renal, lymphoid, and hematopoietic tissues. In cells associated with these lesions, large lightly basophilic cytoplasmic inclusions and vacuolated nuclei with marginated chromatin were consistently found. Virus was isolated from tissue homogenates of infected salamanders following inoculation of epithelioma papilloma cyprini (EPC) cells. The virus, provisionally designated Regina ranavirus (RRV), was initially identified as an iridovirus by electron microscopy. Subsequent molecular characterization, including partial sequence analysis of the major capsid protein (MCP) gene, confirmed this assignment and established that RRV was a ranavirus distinct from frog virus 3 (FV3) and other members of the genus Ranavirus. Intraperitoneal inoculation of 5 x 10(6.23) TCID50 of the field isolate caused mortality in inoculated salamanders at 13 days post infection. Field, clinical, and molecular studies jointly suggest that the etiological agent of recent salamander mortalities is a highly infectious novel ranavirus.

  11. Soil acidity affects distribution, behavior, and physiology of the salamander Plethodon cinereus

    SciTech Connect

    Wyman, R.L.; Hawksley-Lescault, D.S.

    1987-12-01

    Censuses at two sites in Delaware County, New York from spring 1981 through spring 1985 indicated that the density and distribution of Plethodon cinereus were influenced by soil pH but not by soil temperature or moisture. Of 1044 1-m/sup 2/ quadrats of forest litter searched, 284 had a pH of 3.7 or less and only 25 of these (8.8%) contained salamanders. Of 760 quadrats with a pH 3.8 or more, 386 (50.8%) contained salamanders. Juvenile salamanders were never found on soils with a pH less than or equal to 3.7. Seasonal salamander density was correlated (r = -0.92) with the percentage of quadrats with a pH of 3.7 and less. Salamanders apparently were excluded from 27% of forest habitat because of low soil pH. In the laboratory, P. cinereus preferred to occupy substrates near neutral pH when given a choice among three levels of substrate acidity. The acutely lethal pH was between 2.5 and 3 and the 8-mo chronically lethal pH was between 3 and 4. Growth and respiration were reduced at low pHs. The influence of soil pH on salamander distribution might fundamentally change the forest floor decomposer food web of which P. cinereus is an upper-level consumer.

  12. Mercury bioaccumulation in northern two-lined salamanders from streams in the northeastern United States.

    PubMed

    Bank, Michael S; Loftin, Cynthia S; Jung, Robin E

    2005-03-01

    Mercury (Hg) bioaccumulation in salamanders has received little attention despite widespread Hg contamination of aquatic ecosystems and worldwide amphibian declines. Here we report concentrations of methyl Hg (MeHg) and total Hg in larval northern two-lined salamanders (Eurycea bislineata bislineata) collected from streams in Acadia National Park (ANP), Maine, and Bear Brook Watershed, Maine (BBWM; a paired, gauged watershed treated with bimonthly applications (25 kg/ha/yr) of ammonium sulfate [(NH4)2SO4]) since 1989), and Shenandoah National Park (SNP), Virginia. MeHg comprised 73-97% of total Hg in the larval salamander composite samples from ANP. At BBWM we detected significantly higher total. Hg levels in larvae from the (NH4)2SO4 treatment watershed. At ANP total Hg concentrations in salamander larvae were significantly higher from streams in unburned watersheds in contrast with larval samples collected from streams located in watersheds burned by the 1947 Bar Harbor fire. Additionally, total Hg levels were significantly higher in salamander larvae collected at ANP in contrast with SNP. Our results suggest that watershed-scale attributes including fire history, whole-catchment (NH4)2SO4 additions, wetland extent, and forest cover type influence mercury bioaccumulation in salamanders inhabiting lotic environments. We also discuss the use of this species as an indicator of Hg bioaccumulation in stream ecosystems.

  13. Thermal equilibrium and temperature differences among body regions in European plethodontid salamanders.

    PubMed

    Lunghi, Enrico; Manenti, Raoul; Canciani, Giancarlo; Scarì, Giorgio; Pennati, Roberta; Ficetola, Gentile Francesco

    2016-08-01

    Information on species thermal physiology is extremely important to understand species responses to environmental heterogeneity and changes. Thermography is an emerging technology that allows high resolution and accurate measurement of body temperature, but until now it has not been used to study thermal physiology of amphibians in the wild. Hydromantes terrestrial salamanders are strongly depending on ambient temperature for their activity and gas exchanges, but information on their body temperature is extremely limited. In this study we tested if Hydromantes salamanders are thermoconform, we assessed whether there are temperature differences among body regions, and evaluated the time required to reach the thermal equilibrium. During summers of 2014 and 2015 we analysed 56 salamanders (Hydromantes ambrosii and Hydromantes italicus) using infrared thermocamera. We photographed salamanders at the moment in which we found them and 1, 2, 3, 4, 5 and 15min after having kept them in the hands. Body temperature was equal to air temperature; salamanders attained the equilibrium with air temperature in about 8min, the time required to reach equilibrium was longer in individuals with large body size. We detected small temperature differences between body parts, the head being slightly warmer than the body and the tail (mean difference: 0.05°C). These salamanders quickly reach the equilibrium with the environment, thus microhabitat measurement allows obtaining accurate information on their tolerance limits.

  14. Organisation of the spinal central pattern generators for locomotion in the salamander: biology and modelling.

    PubMed

    Chevallier, Stéphanie; Jan Ijspeert, Auke; Ryczko, Dimitri; Nagy, Frédéric; Cabelguen, Jean-Marie

    2008-01-01

    Among living tetrapods, salamanders are regarded as most closely resembling the first terrestrial vertebrates, and are therefore an interesting group in which the evolutionary changes in the locomotor behaviour from aquatic to terrestrial habitats can be inferred. Salamanders exhibit two locomotor modes: swimming and terrestrial stepping. The swimming is anguilliform and resembles closely that of the lamprey. On the ground, the salamander switches to a stepping gait with axial undulations that is also observed in many reptiles. The salamander is therefore ideally suited for examining the neural mechanisms for the generation of these two locomotor modes, as well as the neural mechanisms of gait transition. In the present paper, we describe the kinematics and patterns of activation of axial and limb muscles during stepping and swimming in adult salamanders. We then review the current neurobiological data about the organisation of the spinal networks underlying swimming and stepping, and the mechanisms of gait transition. Finally we report modelling studies aimed at understanding the organisation and operation of the salamander locomotor circuits. Altogether, the neurobiological and the modelling data support the hypothesis of a phylogenetic conservatism from agnathians to amphibians of the spinal locomotor networks generating axial motor patterns.

  15. Mercury bioaccumulation in northern two-lined salamanders from streams in the northeastern United States

    USGS Publications Warehouse

    Bank, M.S.; Loftin, C.S.; Jung, R.E.

    2005-01-01

    Mercury (Hg) bioaccumulation in salamanders has received little attention despite widespread Hg contamination of aquatic ecosystems and worldwide amphibian declines. Here we report concentrations of methyl Hg (MeHg) and total Hg in larval northern two-lined salamanders (Eurycea bislineata bislineata) collected from streams in Acadia National Park (ANP), Maine, and Bear Brook Watershed, Maine (BBWM; a paired, gauged watershed treated with bimonthly applications (25 kg/ha/yr) of ammonium sulfate [(NH4)(2)SO4]) since 1989), and Shenandoah National Park (SNP), Virginia. MeHg comprised 73-97% of total Hg in the larval salamander composite samples from ANP. At BBWM we detected significantly higher total Hg levels in larvae from the (NH4)(2)SO4 treatment watershed. At ANP total Hg concentrations in salamander larvae were significantly higher from streams in unburned watersheds in contrast with larval samples collected from streams located in watersheds burned by the 1947 Bar Harbor fire. Additionally, total Hg levels were significantly higher in salamander larvae collected at ANP in contrast with SNP. Our results suggest that watershed-scale attributes including. re history, whole-catchment (NH4)(2)SO4 additions, wetland extent, and forest cover type influence mercury bioaccumulation in salamanders inhabiting lotic environments. We also discuss the use of this species as an indicator of Hg bioaccumulation in stream ecosystems.

  16. A Multi-analytical Approach for the Characterization of Marbles from Lesser Himalayas (Northwest Pakistan)

    NASA Astrophysics Data System (ADS)

    Fahad, M.; Iqbal, Y.; Riaz, M.; Ubic, R.; Redfern, S. A. T.

    2015-12-01

    The KP province of Pakistan hosts widespread deposits of thermo-metamorphic marbles that were extensively used as a building and ornamental stones since the time of earliest flourishing civilization in this region known as Indus Valley Civilization (2500 BC). The macroscopic characteristics of 22 marble varieties collected from three different areas of Lesser Himalayas (Northwest Pakistan), its chemical, mineralogical, petrographic features, temperature conditions of metamorphic re-crystallization, and the main physical properties are presented in order to provide a solid basis for possible studies on the provenance and distribution of building stones from this region. The results provide a set of diagnostic parameters that allow discriminating the investigated marbles and quarries. Studied marbles overlap in major phase assemblage, but the accessory mineral content, chemistry, the maximum grain size (MGS) and other petrographic characteristics are particularly useful in the distinction between them. On the basis of macroscopic features, the studied marbles can be classifies into four groups: (i) white (ii) grey-to-brown veined, (iii) brown-reddish to yellowish and (iv) dark-grey to blackish veined marbles. The results show that the investigated marbles are highly heterogeneous in both their geochemical parameters and minero-petrographic features. Microscopically, the white, grey-to-brown and dark-grey to blackish marbles display homeoblastic/granoblastic texture, and the brown-reddish to yellowish marbles display a heteroblastic texture with traces of slightly deformed polysynthetic twining planes. Minero-petrography, XRD, SEM and EPMA revealed that the investigated marbles chiefly consist of calcite along with dolomite, quartz, muscovite, pyrite, K-feldspar, Mg, Ti and Fe-oxides as subordinates. The magnesium content of calcite coexisting with dolomite was estimated by both XRD and EPMA/EDS, indicating the metamorphic temperature of re-crystallization from 414

  17. Marine Habitat Selection by Marbled Murrelets (Brachyramphus marmoratus) during the Breeding Season

    PubMed Central

    Lorenz, Teresa J.; Raphael, Martin G.; Bloxton, Thomas D.

    2016-01-01

    The marbled murrelet (Brachyramphus marmoratus) is a declining seabird that is well-known for nesting in coastal old-growth forests in the Pacific Northwest. Most studies of habitat selection have focused on modeling terrestrial nesting habitat even though marine habitat is believed to be a major contributor to population declines in some regions. To address this information gap, we conducted a 5-year study of marine resource selection by murrelets in Washington, which contains a population experiencing the steepest documented declines and where marine habitat is believed to be compromised. Across five years we tracked 157 radio-tagged murrelets during the breeding season (May to August), and used discrete choice models to examine habitat selection. Using an information theoretic approach, our global model had the most support, suggesting that murrelet resource selection at-sea is affected by many factors, both terrestrial and marine. Locations with higher amounts of nesting habitat (β = 21.49, P < 0.001) that were closer to shore (β = -0.0007, P < 0.001) and in cool waters (β = -0.2026, P < 0.001) with low footprint (β = -0.0087, P < 0.001) had higher probabilities of use. While past conservation efforts have focused on protecting terrestrial nesting habitat, we echo many past studies calling for future efforts to protect marine habitat for murrelets, as the current emphasis on terrestrial habitat alone may be insufficient for conserving populations. In particular, marine areas in close proximity to old-growth nesting habitat appear important for murrelets during the breeding season and should be priorities for protection. PMID:27681655

  18. Marine Habitat Selection by Marbled Murrelets (Brachyramphus marmoratus) during the Breeding Season.

    PubMed

    Lorenz, Teresa J; Raphael, Martin G; Bloxton, Thomas D

    The marbled murrelet (Brachyramphus marmoratus) is a declining seabird that is well-known for nesting in coastal old-growth forests in the Pacific Northwest. Most studies of habitat selection have focused on modeling terrestrial nesting habitat even though marine habitat is believed to be a major contributor to population declines in some regions. To address this information gap, we conducted a 5-year study of marine resource selection by murrelets in Washington, which contains a population experiencing the steepest documented declines and where marine habitat is believed to be compromised. Across five years we tracked 157 radio-tagged murrelets during the breeding season (May to August), and used discrete choice models to examine habitat selection. Using an information theoretic approach, our global model had the most support, suggesting that murrelet resource selection at-sea is affected by many factors, both terrestrial and marine. Locations with higher amounts of nesting habitat (β = 21.49, P < 0.001) that were closer to shore (β = -0.0007, P < 0.001) and in cool waters (β = -0.2026, P < 0.001) with low footprint (β = -0.0087, P < 0.001) had higher probabilities of use. While past conservation efforts have focused on protecting terrestrial nesting habitat, we echo many past studies calling for future efforts to protect marine habitat for murrelets, as the current emphasis on terrestrial habitat alone may be insufficient for conserving populations. In particular, marine areas in close proximity to old-growth nesting habitat appear important for murrelets during the breeding season and should be priorities for protection.

  19. MissMarble, a multi-user interdisciplinary data base of marble for archaeometric, art historian and restoration use

    NASA Astrophysics Data System (ADS)

    Zöldföldi, J.; Székely, B.; Hegedüs, P.

    2009-04-01

    assured via co-ordinated activity of the data producers. The aim of the MissMarble project was to develop an interdisciplinary data base management system for analytical results of marble occurrences (geological samples) and marble artefacts (archaeological and architectural objects). The system is characterised by user friendly interfaces for data entry, storage, continuous dissemination, and exchange. Furthermore the system provides practical hints to understand the techniques applied on various samples and relate them to other literature data. The goal of the developed system is to provide help for data comparison, provenance analyses and to reveal missing analytical results. The various user groups have different access rights. Beside of the Editors, Contributors are a special user group who are allowed to enter their own analytical results. Conceptually we intend to manage the results of analyses of both type of material (archaeological and geological samples) together to handle the data in the same manner. It enhances the overlaps and the gaps in the analytical results defining the further analyses to be done. The data entries are organized in the following scheme: sample identification; methods applied on the sample; colour and fabric; mineralogical composition; textural properties; chemical and isotope geochemical composition; engineering physical properties. Dependencies on the sample type: (in case of geological sample) geological classification (age, facies); (in case of archaeological samples) archaeological description of the objects; probable provenance (if determined); conservational and restoration experience. The system is designed so that further amendments and extensions are possible without data loss. It is updated and tailored according to the experience gathered during its use. To this end a pinboard is used for user feedback. The system functionalities, data structure and data content are regularly revised according to the requirements of the users

  20. Plethodon cinerius (eastern red-backed salamander) movement

    USGS Publications Warehouse

    Sterrett, Sean; Brand, Adrianne; Fields, William R.; Katz, Rachel A.; Grant, Evan H. Campbell

    2015-01-01

    Lungless salamanders (family Plethodontidae) are relatively sedentary and are presumed to have limited dispersal ability (Marsh et al. 2004. Ecology 85:3396–3405). Site fidelity in Plethodontidae is high, and individuals displaced 90 m return to home territories (Kleeberger and Werner 1982. Copeia 1982:409–415). Individuals defend territories (Jaeger et al. 1982. Anim. Behav. 30:490–496) and female home ranges have been estimated to be 24.34 m2 (Kleeberger and Werner 1982, op. cit.). Females may seek out suitable subsurface habitat to oviposit eggs, yet little is known about their maximum movement distances (Petranka 1998. Salamanders of the United States and Canada. Smithsonian Institution Press, Washington. 587 pp.).On 18 September 2014, a female P. cinereus (lead back morphotype; SVL = 44.68 mm; 0.89 g) was found under a coverboard during a standard sampling event and uniquely marked using visual implant elastomer at the S.O. Conte Anadromous Fish Research Center, Massachusetts, USA (42.59280°N, 72.58070°W, datum WGS84; elev. 74 m). This individual was subsequently recaptured at ~1500 h on 8 October 2014 under a coverboard within 3 m of the original capture location and then again ~1430 h on 16 October 2014 under a log, within the same forest patch, though in a 50 x 150 m area adjacent to the original study area. Because we found the marked salamander while collecting multiple individuals for a laboratory study, the exact recapture location of the marked individual is not known. However, the distance between the 8 October capture location and the nearest edge of the 16 October search area (i.e. 50 x 150 m) was 143 m, indicating a minimum movement distance. As far as we are aware, this is the longest recorded movement for P. cinereus by more than 53 m (Kleeberger and Werner 1982, op. cit.). This finding followed a rain event of 1.63 cm within 24 h and the second largest sustained rain event during October. The movement we observed may have been due to

  1. A Marble Embryo: Meanings of a Portrait from 1900

    PubMed Central

    Hopwood, Nick

    2012-01-01

    Portraits of scientists use attributes of discovery to construct identities; portraits that include esoteric accessories may fashion identities for these too. A striking example is a marble bust of the anatomist Wilhelm His by the Leipzig sculptor Carl Seffner. Made in 1900, it depicts the founder of modern human embryology looking down at a model embryo in his right hand. This essay reconstructs the design and viewing of this remarkable portrait in order to shed light on private and public relations between scientists, research objects and audiences. The bust came out of a collaboration to model the face of the composer Johann Sebastian Bach and embodies a shared commitment to anatomical exactitude in three dimensions. His’s research agendas and public character explain the contemplative pose and unprecedented embryo model, which he had laboriously constructed from material a midwife supplied. The early contexts of display in the His home and art exhibitions suggest interpretive resources for viewers and hence likely meanings. Seffner’s work remains exceptional, but has affinities to portraits of human embryologists and embryos produced since 1960. Embryo images have acquired such controversial prominence that the model may engage us more strongly now than it did exhibition visitors around 1900. PMID:22606754

  2. Electromagnetic and ultrasonic investigations on a roman marble slab

    NASA Astrophysics Data System (ADS)

    Capizzi, Patrizia; Cosentino, Pietro L.

    2010-05-01

    The archaeological Museum of Rome (Museo delle Terme di Diocleziano) asked our group about the physical consistency of a marble slab (II - III century AD) that has recently fallen down during the transportation for an exhibition. In fact, due to insurance conflict, it was necessary to control the new fractures due to the recent accident and distinguish them from the ancient ones. The sculptured slab (today's size is 1280 x 70 x 9 cm), cut at the ends for a re-use as an inscription in the rear face, was restored (assemblage of different broken parts and cleaning) in contemporary times. We used different methodologies to investigate the slab: namely a pacometer (Protovale Elcometer) to individuate internal coupling pins, GPR (2000 MHz) and Ultrasonic (55 kHz) tomographic high-density surveys to investigate the internal extension of all the visible fractures and to search for the unknown internal ones. For every methodology used the quality of the acquired data was relatively high. They have been processed and compared to give a set of information useful for the bureaucratic problems of the Museum. Later on, the data have been processed in depth, for studying how to improve the data processing and for extracting all the information contained in the whole set of experimental data. Finally, the results of such a study in depth are exposed in detail.

  3. Laboratory study of fault healing in Carrara marble

    NASA Astrophysics Data System (ADS)

    Lacey, Helen; Evans, Brian; Mok, Ulrich

    2016-04-01

    High-pressure fluids on a fault plane can trigger fault movement, but precipitation from these fluids can also lead to cementation, which may alter fault plane strength and permeability and may reduce the probability of reactivation. Chemically reactive rocks such as carbonates present us with the opportunity to study this healing in more detail. This work reports upon the influence of precipitation upon the strength and frictional response of the fault plane in Carrara marble. Hold-slide experiments were undertaken on cores with pre-cut faults in the presence of either water or argon at identical conditions; T = 450oC, Pc = 130MPa, Pp = 45MPa, hold time = 7200 s. When water was present, cementation occurred along the fault plane. When the fault plane was fully cemented, the sample was up to 16MPa stronger compared to those in experiments undertaken with argon as the pore fluid. In addition, the fully cemented faults produced a much more ductile response during slip. It is likely that in the presence of argon, the frictional strength depended on the asperities on the fault surface, i.e., fault roughness. In the presence of water, fault strengthening was accompanied by a major change in the fault topology. Apparently, slip along the cemented calcite grain contacts occurred in a much more ductile manner.

  4. Underwater Photogrammetry and 3d Reconstruction of Marble Cargos Shipwreck

    NASA Astrophysics Data System (ADS)

    Balletti, C.; Beltrame, C.; Costa, E.; Guerra, F.; Vernier, P.

    2015-04-01

    Nowadays archaeological and architectural surveys are based on the acquisition and processing of point clouds, allowing a high metric precision, essential prerequisite for a good documentation. Digital image processing and laser scanner have changed the archaeological survey campaign, from manual and direct survey to a digital one and, actually, multi-image photogrammetry is a good solution for the underwater archaeology. This technical documentation cannot operate alone, but it has to be supported by a topographical survey to georeference all the finds in the same reference system. In the last years the Ca' Foscari and IUAV University of Venice are conducting a research on integrated survey techniques to support underwater metric documentation. The paper will explain all the phases regarding the survey's design, images acquisition, topographic measure and the data processing of two Roman shipwrecks in south Sicily. The cargos of the shipwrecks are composed by huge marble blocks, but they are different for morphological characteristic of the sites, for the depth and for their distribution on the seabed. Photogrammetrical and topographical surveys were organized in two distinct methods, especially for the second one, due to the depth that have allowed an experimentation of GPS RTK's measurements on one shipwreck. Moreover, this kind of three-dimensional documentation is useful for educational and dissemination aspect, for the ease of understanding by wide public.

  5. Habituation of Backward Escape Swimming in the Marbled Crayfish.

    PubMed

    Kasuya, Azusa; Nagayama, Toshiki

    2016-02-01

    In the present study, we performed behavioral analyses of the habituation of backward escape swimming in the marbled crayfish, Procambarus fallax. Application of rapid mechanical stimulation to the rostrum elicited backward swimming following rapid abdominal flexion of crayfish. Response latency was very short-tens of msec-suggesting that backward swimming is mediated by MG neurons. When stimulation was repeated with 10 sec interstimulus intervals the MG-like tailflip did not occur, as the animals showed habituation. Retention of habituation was rather short, with most animals recovering from habituation within 10 min. Previous experience of habituation was remembered and animals habituated faster during a second series of experiments with similar repetitive stimuli. About half the number of stimulus trials was necessary to habituate in the second test compared to the first test. This promotion of habituation was observed in animals with delay periods of rest within 60 min following the first habituation. After 90 min of rest from the first habitation, animals showed a similar time course for the second habituation. With five stimuli at 15 min interval during 90 min of the rest, trained animals showed rapid habituation, indicating reinforcement of the memory of previous experiments. Crayfish also showed dishabituation when mechanical stimulation was applied to the tail following habituation.

  6. Genetic analyses of historic and modern marbled murrelets suggest decoupling of migration and gene flow after habitat fragmentation

    PubMed Central

    Peery, M. Zachariah; Hall, Laurie A.; Sellas, Anna; Beissinger, Steven R.; Moritz, Craig; Bérubé, Martine; Raphael, Martin G.; Nelson, S. Kim; Golightly, Richard T.; McFarlane-Tranquilla, Laura; Newman, Scott; Palsbøll, Per J.

    2010-01-01

    The dispersal of individuals among fragmented populations is generally thought to prevent genetic and demographic isolation, and ultimately reduce extinction risk. In this study, we show that a century of reduction in coastal old-growth forests, as well as a number of other environmental factors, has probably resulted in the genetic divergence of marbled murrelets (Brachyramphus marmoratus) in central California, despite the fact that 7 per cent of modern-sampled murrelets in this population were classified as migrants using genetic assignment tests. Genetic differentiation appears to persist because individuals dispersing from northern populations contributed relatively few young to the central California population, as indicated by the fact that migrants were much less likely to be members of parent–offspring pairs than residents (10.5% versus 45.4%). Moreover, a recent 1.4 per cent annual increase in the proportion of migrants in central California, without appreciable reproduction, may have masked an underlying decline in the resident population without resulting in demographic rescue. Our results emphasize the need to understand the behaviour of migrants and the extent to which they contribute offspring in order to determine whether dispersal results in gene flow and prevents declines in resident populations. PMID:19906669

  7. Ruby-sapphire-spinel mineralization in marble of the middle and southern Urals: Geology, mineralogy, and genesis

    NASA Astrophysics Data System (ADS)

    Kisin, A. Yu.; Murzin, V. V.; Tomilina, A. V.; Pritchin, M. E.

    2016-07-01

    Ruby and spinel occurrences hosted in marble on the eastern slope of the Urals are considered. Ruby- and spinel-bearing marble is a specific rock in granite-gneiss complexes of the East Ural Megazone, which formed at the Late Paleozoic collision stage of the evolution of the Urals. Organogenic marine limestone is the protolith of the marble. No relict sedimentary bedding has been retained in the marble. The observed banding is a secondary phenomenon related to crystallization and is controlled by flow cleavage. Magnesian metasomatism of limestone with the formation of fine-grained dolomite enriched in Cr, V, Ti, Mn, Cu, Zn, Ga, and REE took place at the prograde stage of metamorphism. Dedolomitization of rocks with the formation of background calcite marble also developed at the prograde stage. Mg-calcite marble with spinel and ruby of the first type formed in the metamorphic fluid circulation zone. Magnesian metasomatism with the formation of bicarbonate marble with ruby, pink sapphire, and spinel of the second type developed at the early retrograde stage. The formation of mica-bearing mineralized zones with corundum and spinel of the third type controlled by cleavage fractures is related to the pneumatolytic-hydrothermal stage. The data on ruby-bearing marble in the Urals may be used for forecasting and prospecting of ruby and sapphire deposits hosted in marble worldwide.

  8. Stable isotope (C, O, H) characteristics and genesis of the Tazheran brucite marbles and skarns, Olkhon region, Russia

    NASA Astrophysics Data System (ADS)

    Doroshkevich, Anna; Sklyarov, Eugene; Starikova, Anastasia; Vasiliev, Vladimir; Ripp, German; Izbrodin, Ivan; Posokhov, Viktor

    2016-10-01

    Stable isotope compositions are examined for brucite marble and Mg-skarn that occur in the southern part of the Tazheran massif, Olkhon region, Russia. Brucite marble exhibits a narrow range in δ18O of +23.3 to +26.2 ‰ and shows carbon isotope depletion of -1.9 to -4.4 ‰) as compared with the country dolomite isotope compositions (+2.0 to +2.4 ‰) which is explained by both decarbonation processes and participation of fluids depleted in 13C. The emplacement of brucite marble was accompanied by the formation of endo- and exoskarn at the contact between syenite and brucite marble. δ18O profiles across the contact show a typical decrease towards the syenite side interpreted as the result of fluid/rock interaction and influx of magmatic fluids. Finally, we discuss the mechanisms of brucite marble emplacement and consider three possible ways of producing these rocks: (1) injection of dolomite with subsequent transformation to periclase marble and then to brucite marble; (2) injection of periclase marble with a following replacement of periclase by brucite or injection of brucite marble; (3) crustal water-rich carbonate melt. We favor models 2 and 3 and discuss their strengths and weaknesses.

  9. Strength, Deformability and X-ray Micro-CT Observations of Deeply Buried Marble Under Different Confining Pressures

    NASA Astrophysics Data System (ADS)

    Yang, Sheng-Qi; Ju, Yang; Gao, Feng; Gui, Yi-Lin

    2016-11-01

    In this research, a series of triaxial compression experiments and X-ray observations were conducted to explore the strength, deformability and internal damage mechanism of deeply buried marble. The results show that an increase in confining pressure results in obvious brittle-ductile transition characteristics of deeply buried marble. The Young's modulus of the marble increased nonlinearly with increasing confining pressure. The peak and residual strength of the marble exhibit a clear linear relationship with the confining pressure, which can be described by the linear Mohr-Coulomb criterion. The sensitivity of the residual strength on the confining pressure was clearly higher than that of the peak strength. After uniaxial and triaxial compression failure, marble specimens were analyzed using a three-dimensional X-ray micro-CT scanning system. Based on horizontal and vertical cross-sections, the marble specimen is mainly dominated by axial splitting tensile cracks under uniaxial compression, but under confining pressure, the marble specimen is mainly dominated by a single shear crack. To quantitatively evaluate the internal damage of the marble material, the crack area and aperture extent for each horizontal cross-section were calculated by analyzing the binarized pictures. The system of crack planes under uniaxial compression is more complicated than that under triaxial compression, which is also supported by the evolution of the crack area and aperture extent. Finally, the brittle-ductile transition mechanism of the marble is discussed and interpreted according to the proposed conceptual models.

  10. Innovative techniques for sampling stream-inhabiting salamanders

    SciTech Connect

    T.M. Luhring; C.A. Young

    2006-01-01

    Although salamanders are excellent indicators of environmental health, the ability to catch them efficiently without substantially disrupting their habitat is not always practical or even possible with current techniques. Ripping open logs and raking leaf packs onto shore (Bruce 1972) are examples of such practices that are disruptive but widely used by herpetologists who have no other means of efficient collection. Drift fences with pitfall traps are effective in catching animals moving within or between habitats but are time consuming and require an initial financial investment and constant upkeep to maintain functionality and prevent animal fatalities (Gibbons and Semlitsch 1981). One current alternative to drift fences is the use of coverboards (Grant et al. 1992), which require less maintenance and sampling effort than drift fences. However, coverboards do not integrate captures over a long time period and often result in a lower number of captures per trap (Grant et al. 1992).

  11. Predator-prey relationships among larval dragonflies, salamanders, and frogs.

    PubMed

    Caldwell, J P; Thorp, J H; Jervey, T O

    1980-09-01

    Tadpoles of the barking tree frog, Hyla gratiosa, are abundant in spring and summer in some ponds and Carolina bays on the Savannah River Plant near Aiken, South Carolina. To determine how these tadpoles survive in the presence of predaceous salamander larvae, Ambystoma talpoideum, and larvae of an aeshnid dragonfly, Anax junius, we determined fields densities and sizes of the predators and the prey and conducted predation experiments in the laboratory. Tadpoles rapidly grow to a size not captured by Ambystoma, although Anax larvae can capture slightly larger tadpoles. Differing habitat preferences among the tadpoles and the two predator species probably aid in reducing predation pressure. Preliminary work indicates that the tadpoles may have an immobility response to an attack by a predator. In addition, the smallest, most vulnerable tadpoles have a distinctive color pattern which may function to disrupt the body outline and make them indiscernable to predators.

  12. Road deicing salt irreversibly disrupts osmoregulation of salamander egg clutches.

    PubMed

    Karraker, Nancy E; Gibbs, James P

    2011-03-01

    It has been postulated that road deicing salts are sufficiently diluted by spring rains to ameliorate any physiological impacts to amphibians breeding in wetlands near roads. We tested this conjecture by exposing clutches of the spotted salamander (Ambystoma maculatum) to three chloride concentrations (1 mg/L, 145 mg/L, 945 mg/L) for nine days, then transferred clutches to control water for nine days, and measured change in mass at three-day intervals. We measured mass change because water uptake by clutches reduces risks to embryos associated with freezing, predation, and disease. Clutches in controls sequestered water asymptotically. Those in the moderate concentrations lost 18% mass initially and regained 14% after transfer to control water. Clutches in high concentration lost 33% mass and then lost an additional 8% after transfer. Our results suggest that spring rains do not ameliorate the effects of deicing salts in wetlands with extremely high chloride concentrations.

  13. Positional identity of adult stem cells in salamander limb regeneration.

    PubMed

    Kumar, Anoop; Gates, Phillip B; Brockes, Jeremy P

    2007-01-01

    Limb regeneration in larval and adult salamanders proceeds from a mound of mesenchymal stem cells called the limb blastema. The blastema gives rise just to those structures distal to its level of origin, and this property of positional identity is reset to more proximal values by treatment with retinoic acid. We have identified a cell surface protein, called Prod1/CD59, which appears to be a determinant of proximodistal identity. Prod1 is expressed in an exponential gradient in an adult limb as determined by detection of both mRNA and immunoreactive protein. Prod1 protein is up-regulated after treatment of distal blastemas with RA and this is particularly marked in cells of the dermis. These cells have previously been implicated in pattern formation during limb regeneration.

  14. Population.

    ERIC Educational Resources Information Center

    International Planned Parenthood Federation, London (England).

    In an effort to help meet the growing interest and concern about the problems created by the rapid growth of population, The International Planned Parenthood Federation has prepared this booklet with the aim of assisting the study of the history and future trends of population growth and its impact on individual and family welfare, national,…

  15. Immunocytochemical analysis of photoreceptors in the tiger salamander retina.

    PubMed

    Zhang, Jian; Wu, Samuel M

    2009-01-01

    In the tiger salamander retina, visual signals are transmitted to the inner retina via six morphologically distinct types of photoreceptors: large/small rods, large/small single cones, and double cones composed of principal and accessory members. The objective of this study was to determine the morphology of these photoreceptors and their synaptic interconnection with bipolar cells and horizontal cells in the outer plexiform layer (OPL). Here we showed that glutamate antibodies labeled all photoreceptors and recovering antibodies strongly labeled all cones and weakly labeled all rods. Antibodies against calbindin selectively stained accessory members of double cones. Antibodies against S-cone opsin stained small rods, a subpopulation of small single cones, and the outer segments of accessory double cones and a subtype of unidentified single cones. On average, large rods and small S-cone opsin positive rods accounted for 98.6% and 1.4% of all rods, respectively. Large/small cones, principle/accessory double cones, S-cone opsin positive small single cones, and S-cone opsin positive unidentified single cones accounted for about 66.9%, 23%, 4.5%, and 5.6% of the total cones, respectively. Moreover, the differential connection between rods/cones and bipolar/horizontal cells and the wide distribution of AMPA receptor subunits GluR2/3 and GluR4 at the rod/cone synapses were observed. These results provide anatomical evidence for the physiological findings that bipolar/horizontal cells in the salamander retina are driven by rod/cone inputs of different weights, and that AMPA receptors play an important role in glutamatergic neurotransmission at the first visual synapses. The different photoreceptors selectively contacting bipolar and horizontal cells support the idea that visual signals may be conveyed to the inner retina by different functional pathways in the outer retina.

  16. Higher-level salamander relationships and divergence dates inferred from complete mitochondrial genomes.

    PubMed

    Zhang, Peng; Wake, David B

    2009-11-01

    Phylogenetic relationships among the salamander families have been difficult to resolve, largely because the window of time in which major lineages diverged was very short relative to the subsequently long evolutionary history of each family. We present seven new complete mitochondrial genomes representing five salamander families that have no or few mitogenome records in GenBank in order to assess the phylogenetic relationships of all salamander families from a mitogenomic perspective. Phylogenetic analyses of two data sets-one combining the entire mitogenome sequence except for the D-loop, and the other combining the deduced amino acid sequences of all 13 mitochondrial protein-coding genes-produce nearly identical well-resolved topologies. The monophyly of each family is supported, including the controversial Proteidae. The internally fertilizing salamanders are demonstrated to be a clade, concordant with recent results using nuclear genes. The internally fertilizing salamanders include two well-supported clades: one is composed of Ambystomatidae, Dicamptodontidae, and Salamandridae, the other Proteidae, Rhyacotritonidae, Amphiumidae, and Plethodontidae. In contrast to results from nuclear loci, our results support the conventional morphological hypothesis that Sirenidae is the sister-group to all other salamanders and they statistically reject the hypothesis from nuclear genes that the suborder Cryptobranchoidea (Cryptobranchidae+Hynobiidae) branched earlier than the Sirenidae. Using recently recommended fossil calibration points and a "soft bound" calibration strategy, we recalculated evolutionary timescales for tetrapods with an emphasis on living salamanders, under a Bayesian framework with and without a rate-autocorrelation assumption. Our dating results indicate: (i) the widely used rate-autocorrelation assumption in relaxed clock analyses is problematic and the accuracy of molecular dating for early lissamphibian evolution is questionable; (ii) the initial

  17. Olfactory effects of a hypervariable multicomponent pheromone in the red-legged salamander, Plethodon shermani

    PubMed Central

    Doty, Kari A.; Chouinard, Adam J.; Eddy, Sarah L.; Woodley, Sarah K.; Houck, Lynne D.; Feldhoff, Richard C.

    2017-01-01

    Chemical communication via chemosensory signaling is an essential process for promoting and modifying reproductive behavior in many species. During courtship in plethodontid salamanders, males deliver a mixture of non-volatile proteinaceous pheromones that activate chemosensory neurons in the vomeronasal epithelium (VNE) and increase female receptivity. One component of this mixture, Plethodontid Modulating Factor (PMF), is a hypervariable pheromone expressed as more than 30 unique isoforms that differ between individual males—likely driven by co-evolution with female receptors to promote gene duplication and positive selection of the PMF gene complex. Courtship trials with females receiving different PMF isoform mixtures had variable effects on female mating receptivity, with only the most complex mixtures increasing receptivity, such that we believe that sufficient isoform diversity allows males to improve their reproductive success with any female in the mating population. The aim of this study was to test the effects of isoform variability on VNE neuron activation using the agmatine uptake assay. All isoform mixtures activated a similar number of neurons (>200% over background) except for a single purified PMF isoform (+17%). These data further support the hypothesis that PMF isoforms act synergistically in order to regulate female receptivity, and different putative mechanisms are discussed. PMID:28358844

  18. Intergenomic translocations in unisexual salamanders of the genus Ambystoma (Amphibia, Caudata).

    PubMed

    Bi, K; Bogart, J P; Fu, J

    2007-01-01

    Intergenomic interactions that include homoeologous recombinations and intergenomic translocations are commonly observed in plant allopolyploids. Homoeologous recombinations have recently been documented in unisexual salamanders in the genus Ambystoma and revealed exchanged chromosomal segments between A. laterale and A.jeffersonianum genomes in individual unisexuals. We discovered intergenomic translocations in two widespread unisexual triploids A.laterale--2 jeffersonianum (or LJJ) and its tetraploid derivative A.laterale--3 jeffersonianum (or LJJJ) by genomic in situ hybridization (GISH). Two different types of intergenomic translocations were observed in two unisexual populations and one contained novel chromosomes generated by an intergenomic reciprocal translocation. We also observed chromosome deletions in several individuals and these chromosome fragmentations were all derived from the A. jeffersonianum genome. These observed intergenomic reciprocal translocations are believed to be caused by non-homologous pairing during meiosis followed by breakage-rejoining events. Genomes of unisexual Ambystoma undergo complicated structural changes that include various intergenomic exchanges that offer unisexuals genetic and phenotypic complexity to escape their evolutionary demise. Unisexual Ambystoma have persisted as natural nuclear genomic hybrids for about four million years. These unisexuals provide a vertebrate model system to examine the interaction of distinct genomes and to evaluate the corresponding genetic, developmental and evolutionary implications of intergenomic exchanges. Intergenomic translocations and homoeologous recombinations appear to be frequent chromosome reconstruction events among unisexual Ambystoma.

  19. Mitochondrial cytochrome B phylogeny and historical biogeography of the Tohoku salamander, Hynobius lichenatus (Amphibia, Caudata).

    PubMed

    Aoki, Gen; Matsui, Masafumi; Nishikawa, Kanto

    2013-03-01

    The Tohoku salamander, Hynobius lichenatus Boulenger, 1883, is a lentic breeding species widespread throughout montane regions of northeastern Japan. To explore intraspecific genetic variation and infer evolutionary history of H. lichenatus, we performed mitochondrial DNA analysis (complete 1141 bp sequences of the mitochondrial cytochrome b gene) using 215 adult and larval individuals collected from 75 localities, encompassing known distributional range of the species. Hynobius lichenatus proved to be monophyletic, including three well-supported and geographically structured clades (Clade I from northern Kanto, Clade II from southern Tohoku, and Clade III from northern Tohoku). These clades, respectively, comprise several subclades, and show genetic distances as large as those seen between different species of Hynobius. Results of population statistic analyses indicate that all clades and most subclades have maintained high genetic diversity and demographic stability over long periods. Molecular dating indicates divergence in H. lichenatus concords with topographic evolution of northeastern Japan from late Miocene to early Pleistocene, suggesting that paleogeographic events in this region, such as orogenesis, sea level change, and volcanic activity, have been crucial for shaping genetic patterns and diversity in this species. Hynobius lichenatus greatly differs from many other animal species from northeastern Japan in its much older periods and the pattern of genetic differentiation, and is suggested as an old faunal element in this region.

  20. Resistance to chytridiomycosis in European plethodontid salamanders of the genus Speleomantes.

    PubMed

    Pasmans, Frank; Van Rooij, Pascale; Blooi, Mark; Tessa, Giulia; Bogaerts, Sergé; Sotgiu, Giuseppe; Garner, Trenton W J; Fisher, Matthew C; Schmidt, Benedikt R; Woeltjes, Tonnie; Beukema, Wouter; Bovero, Stefano; Adriaensen, Connie; Oneto, Fabrizio; Ottonello, Dario; Martel, An; Salvidio, Sebastiano

    2013-01-01

    North America and the neotropics harbor nearly all species of plethodontid salamanders. In contrast, this family of caudate amphibians is represented in Europe and Asia by two genera, Speleomantes and Karsenia, which are confined to small geographic ranges. Compared to neotropical and North American plethodontids, mortality attributed to chytridiomycosis caused by Batrachochytrium dendrobatidis (Bd) has not been reported for European plethodontids, despite the established presence of Bd in their geographic distribution. We determined the extent to which Bd is present in populations of all eight species of European Speleomantes and show that Bd was undetectable in 921 skin swabs. We then compared the susceptibility of one of these species, Speleomantes strinatii, to experimental infection with a highly virulent isolate of Bd (BdGPL), and compared this to the susceptible species Alytes muletensis. Whereas the inoculated A. muletensis developed increasing Bd-loads over a 4-week period, none of five exposed S. strinatii were colonized by Bd beyond 2 weeks post inoculation. Finally, we determined the extent to which skin secretions of Speleomantes species are capable of killing Bd. Skin secretions of seven Speleomantes species showed pronounced killing activity against Bd over 24 hours. In conclusion, the absence of Bd in Speleomantes combined with resistance to experimental chytridiomycosis and highly efficient skin defenses indicate that the genus Speleomantes is a taxon unlikely to decline due to Bd.

  1. Tracking climate change in a dispersal-limited species: reduced spatial and genetic connectivity in a montane salamander.

    PubMed

    Velo-Antón, G; Parra, J L; Parra-Olea, G; Zamudio, K R

    2013-06-01

    Tropical montane taxa are often locally adapted to very specific climatic conditions, contributing to their lower dispersal potential across complex landscapes. Climate and landscape features in montane regions affect population genetic structure in predictable ways, yet few empirical studies quantify the effects of both factors in shaping genetic structure of montane-adapted taxa. Here, we considered temporal and spatial variability in climate to explain contemporary genetic differentiation between populations of the montane salamander, Pseudoeurycea leprosa. Specifically, we used ecological niche modelling (ENM) and measured spatial connectivity and gene flow (using both mtDNA and microsatellite markers) across extant populations of P. leprosa in the Trans-Mexican Volcanic Belt (TVB). Our results indicate significant spatial and genetic isolation among populations, but we cannot distinguish between isolation by distance over time or current landscape barriers as mechanisms shaping population genetic divergences. Combining ecological niche modelling, spatial connectivity analyses, and historical and contemporary genetic signatures from different classes of genetic markers allows for inference of historical evolutionary processes and predictions of the impacts future climate change will have on the genetic diversity of montane taxa with low dispersal rates. Pseudoeurycea leprosa is one montane species among many endemic to this region and thus is a case study for the continued persistence of spatially and genetically isolated populations in the highly biodiverse TVB of central Mexico.

  2. Switching deformation mode during natural faulting in Carrara marbles.

    NASA Astrophysics Data System (ADS)

    Molli, Giancarlo

    2010-05-01

    A study on meso- and microstructural features of a high angle normal fault observed in the Alpi Apuane NW Tuscany (Italy) is presented to document switching in the deformation mode during different evolutionary stages of a fault zone growth in naturally deformed Carrara marble. The studied fault was formed at c.3 Km of depth and belongs to structures related to the most recent deformation history of the Alpi Apuane metamorphic core (from c.4 Ma until now, Fellin et al. 2007; Molli, 2008). On the basis of deformation mechanisms and their chronology interpreted from cross-cutting relationships, different stages of the fault zone evolution have been recognized. An early stage of deformation (stage 1) was associated with extensional and shear veins now observable in both hangingwall and footwall blocks as part of the deformation zone developed at decameter-scale. Geochemical data indicate vein-development in a locally closed system where a "stationary" fluid phase migrates over meter scale distances (Molli et al., in press). During stage 2, a localization of the deformation, possibly in precursory coarse grained calcite/quartz shear veins of stage 1, took place. During this second stage crystal-plastic deformation affected areas at the head and along the hanging wall rim of fractures accommodating fault tip distorsions in a way recalling the mode-II geometry of stable crack propagation (Atkinson, 1987; Vermilye and Scholtz, 1993; Kim et al., 2004). Following pervasive cataclasis (stage 3) characterizes a plurimeter-wide dilational jog between two non-parallel main slip surfaces with brecciation and far-derived fluids channelling leading to significant geochemical alteration of the fault rocks with respect to the protolith (Molli et al., in press). Cataclastic deformation produced a grain size refinement and a decimetric thick fault core asymmetrically bounded by the upper main slip surface. Deformation was then localized within ultracataclasite of the fault core where

  3. THz imaging of majolica tiles and biological attached marble fragments

    NASA Astrophysics Data System (ADS)

    Catapano, Ilaria; Soldovieri, Francesco

    2016-04-01

    Devices exploiting waves in the frequency range from 0.1 THz to 10 THz (corresponding to a free-space wavelength ranging from 30 μm to 3 mm) deserve attention as diagnostic technologies for cultural heritage. THz waves are, indeed, non-ionizing radiations capable of penetrating into non-metallic materials, which are opaque to both visible and infrared waves, without implying long term risks to the molecular stability of the exposed objects and humans. Moreover, THz surveys involve low poewr probing waves, are performed without contact with the object and, thanks to the recent developments, which have allowed the commercialization of compact, flexible and portable systems, maybe performed in loco (i.e. in the place where the artworks are usually located). On the other hand, THz devices can be considered as the youngest among the sensing and imaging electromagnetic techniques and their actual potentialities in terms of characterization of artworks is an ongoing research activity. As a contribution within this context, we have performed time of flight THz imaging [1,2] on ceramic and marble objects. In particular, we surveyed majolica tiles produced by Neapolitan ceramists in the 18th and 19th centuries with the aim to gather information on their structure, constructive technique and conservation state. Moreover, we investigated a Marmo di Candoglia fragment in order to characterize the biological attach affecting it. All the surveys were carried out by using the Fiber-Coupled Terahertz Time Domain System (FICO) developed by Z-Omega and available at the Institute of Electromagnetic Sensing of the Environment (IREA). This system is equipped with fiber optic coupled transmitting and receiving probes and with an automatic positioning system enabling to scan a 150 mm x 150 mm area under a reflection measurement configuration. Based on the obtained results we can state that the use of THz waves allows: - the reconstruction of the object topography; - the geometrical

  4. Groundwater Flow in the Arthur Marble Aquifer, New Zealand

    NASA Astrophysics Data System (ADS)

    Stewart, M. K.

    2008-05-01

    Arthur Marble underlies the Takaka Valley and outcrops in Karst Uplands to east and west of the valley in the South Island of New Zealand. It is the principal groundwater aquifer in the region and host to the remarkable Waikoropupu Springs near the coast. With average flow of 13,300 L/s, the karstic springs have many interesting features including unusual size and clarity. This work uses rainfall and river level, natural tracer and chemical measurements to determine the recharge sources and nature of the flow system in the Arthur Marble Aquifer (AMA). Total recharge to the AMA of 19,750 L/s comes from three sources (Karst Uplands stream seepage, Takaka River seepage and Takaka Valley rainfall infiltration). Since 13,300 L/s is discharged at the springs, the remainder must escape via offshore springs (6,450 L/s). The oxygen-18 mass balance allows the contribution of each source to each spring to be determined; most of the flow to the Main Spring of the Waikoropupu Springs comes from the Karst Uplands. The offshore springs are mostly fed from the Takaka River. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, but varying with flow. This variation with flow shows that two water components (sea-water-bearing and non-sea-water-bearing) contribute to the spring's discharge. Tritium measurements spanning 40 years, and CFC-11 measurements, give a mean residence time of 8 years for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, oxygen-18, chloride and tritium measurements, reveals that two different flow systems with different recharge sources are needed to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 years and water volume 3 cubic kilometers, recharged from the Karst Uplands. The other, at shallow levels below the valley floor, has much younger water, with mean age 1.2 years and water volume 0.4 cubic kilometers

  5. Calcite-graphite thermometry of the Franklin Marble, New Jersey Highlands

    USGS Publications Warehouse

    Peck, W.H.; Volkert, R.A.; Meredith, M.T.; Rader, E.L.

    2006-01-01

    We present new stable-isotope data for the Mesoproterozoic Franklin Marble from outcrops along an 80-km traverse parallel to and across strike of the structural grain of the western New Jersey Highlands. Calcite and dolomite from marble have an average ??13C of 0.35??? ?? 0.73??? PDB (n = 46) and a more limited range than other Mesoproterozoic marbles from the Adirondacks and the Canadian Grenville Province. The small range of ??13C values from the New Jersey samples is consistent with the preservation of a primary marine isotopic signature and limited postdepositional isotopic modification, except proximal to Zn or Fe ore deposits and fault zones. Fractionations between calcite and well-formed graphite (??13C[Cal-Gr]) for analyzed Franklin Marble samples average 3.31???. ?? 0.25??? (n = 34), and dolomite-graphite fractionations average 3.07??? ?? 0.30??? (n = 6). Taken together, these indicate an average temperature of 769?? ?? 43??C during metamorphism associated with the Ottawan Orogeny in the New Jersey Highlands. Thus, carbon isotope fractionations demonstrate that the Franklin Marble was metamorphosed at granulite facies conditions. Metamorphic temperatures are relatively constant for the area sampled and overprint the metamorphosed carbonatehosted Zn-Fe-Mn ore deposits. The results of this study support recent work proposing that pressure and temperature conditions during Ottawan orogenesis did not vary greatly across faults that partition the Highlands into structural blocks. ?? 2006 by The University of Chicago. All rights reserved.

  6. Characteristics and Health Benefit of Highly Marbled Wagyu and Hanwoo Beef.

    PubMed

    Gotoh, Takafumi; Joo, Seon-Tea

    2016-01-01

    This review addresses the characteristics and health benefit of highly marbled Wagyu and Hanwoo beef. Marbling of Wagyu and Hanwoo beef has been increased in Japan and Korea to meet domestic consumer preferences. Wagyu and Hanwoo cattle have high potential of accumulating intramuscular fat (IMF) and producing highly marbled beef. The IMF content varies depending on the feeding of time, finishing diet, and breed type. IMF increases when feeding time is increased. The rate of IMF increase in grain-fed cattle is faster than that in pasture-fed cattle. Fatty acid composition are also different depending on breeds. Highly marbled Wagyu and Hanwoo beef have higher proportions of monounsaturated fatty acid (MUFA) due to higher concentrations of oleic acid. MUFAs have little effect on total cholesterol. They are heart-healthy dietary fat because they can lower low-density lipoprotein (LDL)-cholesterol while increasing high-density lipoprotein (HDL)-cholesterol. Clinical trials have indicated that highly marbled beef does not increase LDL-cholesterol. This review also emphasizes that high oleic acid beef such as Wagyu and Hanwoo beef might be able to reduce risk factors for cardiovascular disease.

  7. Characteristics and Health Benefit of Highly Marbled Wagyu and Hanwoo Beef

    PubMed Central

    Gotoh, Takafumi

    2016-01-01

    This review addresses the characteristics and health benefit of highly marbled Wagyu and Hanwoo beef. Marbling of Wagyu and Hanwoo beef has been increased in Japan and Korea to meet domestic consumer preferences. Wagyu and Hanwoo cattle have high potential of accumulating intramuscular fat (IMF) and producing highly marbled beef. The IMF content varies depending on the feeding of time, finishing diet, and breed type. IMF increases when feeding time is increased. The rate of IMF increase in grain-fed cattle is faster than that in pasture-fed cattle. Fatty acid composition are also different depending on breeds. Highly marbled Wagyu and Hanwoo beef have higher proportions of monounsaturated fatty acid (MUFA) due to higher concentrations of oleic acid. MUFAs have little effect on total cholesterol. They are heart-healthy dietary fat because they can lower low-density lipoprotein (LDL)-cholesterol while increasing high-density lipoprotein (HDL)-cholesterol. Clinical trials have indicated that highly marbled beef does not increase LDL-cholesterol. This review also emphasizes that high oleic acid beef such as Wagyu and Hanwoo beef might be able to reduce risk factors for cardiovascular disease. PMID:28115881

  8. Laboratory study on factors influencing nitrogen removal in marble chip biofilters incorporating nitritation and anammox.

    PubMed

    Tao, Wendong; Wen, Jianfeng; Norton, Christopher

    2011-01-01

    It remains challenging to integrate nitritation and anammox in ecologically engineered treatment systems such as passive biofilters that are packed with natural materials and have low energy inputs. This study explored the factors influencing nitritation-anammox through parallel operation of two laboratory-scale biofilters packed with large and small marble chips respectively. Clean marble chips (mainly CaCO3) had an alkalinity dissolution rate of 130 mg CaCO3/kg marble d when water pH approached 6.5. Marble chips effectively increased water pH and provided sufficient alkalinity to support nitritation-anammox in the biofilters. Ammonium and total nitrogen removal decreased by 47 and 26%, respectively, when nutrients were not amended to influent. An influent nitrite concentration above 8.9 mg N/L could inhibit anammox in thin biofilms of biofilters. Nitritation-anammox was enhanced with a hydraulic retention time of 2 d relative to 7 d, likely due to enhanced air entrainment. Size of marble chips rarely made a significant difference in nitrogen removal, possibly due to sufficient surface area available for bacterial attachment and alkalinity dissolution.

  9. Finite-element modelling of thermal micracking in fresh and consolidated marbles

    NASA Astrophysics Data System (ADS)

    Weiss, T.; Fuller, E.; Siegesmund, S.

    2003-04-01

    The initial stage of marble weathering is supposed to be controlled by thermal microcracking. Due to the anisotropy of the thermal expansion coefficients of calcite, the main rock forming mineral in marble, stresses are caused which lead to thermally-induced microcracking, especially along the grain boundaries. The so-called "granular disintegration" is a frequent weathering phenomenon observed for marbles. The controlling parameters are the grain size, grain shape and grain orientation. We use a finite-element approach to constrain magnitude and directional dependence of thermal degradation. Therefore, different assumptions are validated including the fracture toughness of the grain boundaries, the effects of the grain-to-grain orientation and bulk lattice preferred orientation (here referred to as texture). The resulting thermal microcracking and bulk rock thermal expansion anisotropy are validated. It is evident that thermal degradation depends on the texture. Strongly textured marbles exhibit a clear directional dependence of thermal degradation and a smaller bulk thermal degradation than randomly oriented ones. The effect of different stone consolidants in the pore space of degraded marble is simulated and its influence on mechanical properties such as tensile strength are evaluated.

  10. A connectionist central pattern generator for the aquatic and terrestrial gaits of a simulated salamander.

    PubMed

    Ijspeert, A J

    2001-05-01

    This article investigates the neural mechanisms underlying salamander locomotion, and develops a biologically plausible connectionist model of a central pattern generator capable of producing the typical aquatic and terrestrial gaits of the salamander. It investigates, in particular, what type of neural circuitry can produce and modulate the two locomotor programs identified within the salamander's spinal cord; namely, a traveling wave of neural activity for swimming and a standing wave for trotting. A two-dimensional biomechanical simulation of the salamander's body is developed whose muscle contraction is determined by the locomotion controller simulated as a leaky-integrator neural network. While the connectivity of the neural circuitry underlying locomotion in the salamander has not been decoded for the moment, this article presents the design of a neural circuit that has a general organization corresponding to that hypothesized by neurobiologists. In particular, the locomotion controller is based on a body central pattern generator (CPG) corresponding to a lamprey-like swimming controller, and is extended with a limb CPG for controlling the salamander's limbs. The complete controller is developed in three stages: first the development of segmental oscillators, second the development of intersegmental coupling for the making of a lamprey-like swimming CPG, and finally the development of the limb CPG and its coupling to the body CPG. A genetic algorithm is used to determine the parameters of the neural circuit for the different stages, given a high-level description of the desired state space trajectories of the different subnetworks. A controller is thus developed that can produce neural activities and locomotion gaits very similar to those observed in the real salamander. By varying the tonic (i.e. non-oscillating) excitation applied to the network, the speed, direction and type of gait can be varied.

  11. Declines in woodland salamander abundance associated with non-native earthworm and plant invasions.

    PubMed

    Maerz, John C; Nuzzo, Victoria A; Blossey, Bernd

    2009-08-01

    Factors that negatively affect the quality of wildlife habitat are a major concern for conservation. Non-native species invasions, in particular, are perceived as a global threat to the quality of wildlife habitat. Recent evidence indicates that some changes to understory plant communities in northern temperate forests of North America, including invasions by 3 non-native plant species, are facilitated by non-native earthworm invasion. Furthermore, non-native earthworm invasions cause a reduction in leaf litter on the forest floor, and the loss of forest leaf litter is commonly associated with declines in forest fauna, including amphibians. We conducted a mark-recapture study of woodland salamander abundance across plant invasion fronts at 10 sites to determine whether earthworm or plant invasions were associated with reduced salamander abundance. Salamander abundance declined exponentially with decreasing leaf litter volume. There was no significant relationship between invasive plant cover and salamander abundance, independent of the effects of leaf litter loss due to earthworm invasion. An analysis of selected salamander prey abundance (excluding earthworms) at 4 sites showed that prey abundance declined with declining leaf litter. The loss of leaf litter layers due to non-native earthworm invasions appears to be negatively affecting woodland salamander abundance, in part, because of declines in the abundance of small arthropods that are a stable resource for salamanders. Our results demonstrate that earthworm invasions pose a significant threat to woodland amphibian fauna in the northeastern United States, and that plant invasions are symptomatic of degraded amphibian habitat but are not necessarily drivers of habitat degradation.

  12. Weight losses of marble and limestone briquettes exposed to outdoor environments in the eastern United States

    SciTech Connect

    Reimann, K.J.

    1991-09-01

    Gravimetric changes in marble and limestone briquettes exposed to outdoor environment at five sites in the eastern United States have been monitored since 1984. An earlier report describes procedures and results obtained in 1984--1988. This report presents the results of the exposure period 1984--1988 and reviews and summarizes those of prior years. A linear relationship was found between cumulative gravimetric losses and exposure period or rain depth. These losses resulted in an average recession rate of 14 to 24 {mu}m/yr for marble and twice that for limestone. Variations in recession among the various exposure sites can be ascribed to differences in rain depth and hydrogen ion concentration. The annual recession rates obtained from gravimetry yielded rates that were for marble twice those obtained from runoff experiments, and more than three times those for limestone; this indicates that physical erosion plays an important role. Gravimetric monitoring of exposed briquettes is continuing in a planned 10-yr program.

  13. 76 FR 55413 - Proposed Safe Harbor Agreement for California Red-legged Frog, California Tiger Salamander, Smith...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-09-07

    ... Tiger Salamander, Smith's Blue Butterfly, and Yadon's Piperia at Palo Corona Regional Park, Monterey... californiense) and federally endangered Smith's blue butterfly (Euphilotes enoptes smithi) under the Endangered..., California tiger salamander, Smith's blue butterfly, and Yadon's piperia on the property subject to...

  14. 76 FR 44036 - Proposed Low-Effect Habitat Conservation Plan for the California Tiger Salamander, AT&T Portable...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-07-22

    ... Fish and Wildlife Service Proposed Low-Effect Habitat Conservation Plan for the California Tiger... potential for ``take'' of one Federally listed animal, the California tiger salamander. The applicant would... for the California tiger salamander into a new storage facility for portable generators within...

  15. IMPACT OF GUTHION ON SURVIVAL AND GROWTH OF THE FROG PSEUDACRIS REGILLA AND THE SALAMANDERS AMBYSTOMA GRACILE AND AMBYSTOMA MACULATUM

    EPA Science Inventory

    The effects of the insecticides Guthion (technical grade) and Guthion 2S(commercial formulation) on survival and growth of tadpoles of the Pacific treefrog Pseudacris regilla, and larvae of the Northwestern salamander Ambystoma gracile and the spotted salamander Ambystoma macula...

  16. Liquid marbles as a micro-reactor for efficient radical alternating copolymerization of diene monomer and oxygen.

    PubMed

    Sato, E; Yuri, M; Fujii, S; Nishiyama, T; Nakamura, Y; Horibe, H

    2015-12-18

    Liquid marbles have been shown to be a novel micro-reactor to synthesize polyperoxides by the radical alternating copolymerization of the 1,3-diene monomer with oxygen in a good yield. Oxygen gas is effectively absorbed as a comonomer by the large and permeable gas-liquid interface of the liquid marbles.

  17. Sequence capture and next-generation sequencing of ultraconserved elements in a large-genome salamander.

    PubMed

    Newman, Catherine E; Austin, Christopher C

    2016-12-01

    Amidst the rapid advancement in next-generation sequencing (NGS) technology over the last few years, salamanders have been left behind. Salamanders have enormous genomes-up to 40 times the size of the human genome-and this poses challenges to generating NGS data sets of quality and quantity similar to those of other vertebrates. However, optimization of laboratory protocols is time-consuming and often cost prohibitive, and continued omission of salamanders from novel phylogeographic research is detrimental to species facing decline. Here, we use a salamander endemic to the southeastern United States, Plethodon serratus, to test the utility of an established protocol for sequence capture of ultraconserved elements (UCEs) in resolving intraspecific phylogeographic relationships and delimiting cryptic species. Without modifying the standard laboratory protocol, we generated a data set consisting of over 600 million reads for 85 P. serratus samples. Species delimitation analyses support recognition of seven species within P. serratus sensu lato, and all phylogenetic relationships among the seven species are fully resolved under a coalescent model. Results also corroborate previous data suggesting nonmonophyly of the Ouachita and Louisiana regions. Our results demonstrate that established UCE protocols can successfully be used in phylogeographic studies of salamander species, providing a powerful tool for future research on evolutionary history of amphibians and other organisms with large genomes.

  18. Anatomy, function, and evolution of jaw and hyobranchial muscles in cryptobranchoid salamander larvae.

    PubMed

    Kleinteich, Thomas; Herzen, Julia; Beckmann, Felix; Matsui, Masafumi; Haas, Alexander

    2014-02-01

    Larval salamanders (Lissamphibia: Caudata) are known to be effective suction feeders in their aquatic environments, although they will eventually transform into terrestrial tongue feeding adults during metamorphosis. Early tetrapods may have had a similar biphasic life cycle and this makes larval salamanders a particularly interesting model to study the anatomy, function, development, and evolution of the feeding apparatus in terrestrial vertebrates. Here, we provide a description of the muscles that are involved in the feeding strike in salamander larvae of the Hynobiidae and compare them to larvae of the paedomorphic Cryptobranchidae. We provide a functional and evolutionary interpretation for the observed muscle characters. The cranial muscles in larvae from species of the Hynobiidae and Cryptobranchidae are generally very similar. Most notable are the differences in the presence of the m. hyomandibularis, a muscle that connects the hyobranchial apparatus with the lower jaw. We found this muscle only in Onychodactylus japonicus (Hynobiidae) but not in other hynobiid or cryptobranchid salamanders. Interestingly, the m. hyomandibularis in O. japonicus originates from the ceratobranchial I and not the ceratohyal, and thus exhibits what was previously assumed to be the derived condition. Finally, we applied a biomechanical model to simulate suction feeding in larval salamanders. We provide evidence that a flattened shape of the hyobranchial apparatus in its resting position is beneficial for a fast and successful suction feeding strike.

  19. Digits Lost or Gained? Evidence for Pedal Evolution in the Dwarf Salamander Complex (Eurycea, Plethodontidae)

    PubMed Central

    2012-01-01

    Change in digit number, particularly digit loss, has occurred repeatedly over the evolutionary history of tetrapods. Although digit loss has been documented among distantly related species of salamanders, it is relatively uncommon in this amphibian order. For example, reduction from five to four toes appears to have evolved just three times in the morphologically and ecologically diverse family Plethodontidae. Here we report a molecular phylogenetic analysis for one of these four-toed lineages – the Eurycea quadridigitata complex (dwarf salamanders) – emphasizing relationships to other species in the genus. A multilocus phylogeny reveals that dwarf salamanders are paraphyletic with respect to a complex of five-toed, paedomorphic Eurycea from the Edwards Plateau in Texas. We use this phylogeny to examine evolution of digit number within the dwarf−Edwards Plateau clade, testing contrasting hypotheses of digit loss (parallelism among dwarf salamanders) versus digit gain (re-evolution in the Edwards Plateau complex). Bayes factors analysis provides statistical support for a five-toed common ancestor at the dwarf-Edwards node, favoring, slightly, the parallelism hypothesis for digit loss. More importantly, our phylogenetic results pinpoint a rare event in the pedal evolution of plethodontid salamanders. PMID:22649536

  20. Salamanders increase their feeding activity when infected with the pathogenic chytrid fungus Batrachochytrium dendrobatidis.

    PubMed

    Hess, Alexandra; McAllister, Caroline; DeMarchi, Joseph; Zidek, Makenzie; Murone, Julie; Venesky, Matthew D

    2015-10-27

    Immune function is a costly line of defense against parasitism. When infected with a parasite, hosts frequently lose mass due to these costs. However, some infected hosts (e.g. highly resistant individuals) can clear infections with seemingly little fitness losses, but few studies have tested how resistant hosts mitigate these costly immune defenses. We explored this topic using eastern red-backed salamanders Plethodon cinereus and the fungal pathogen Batrachochytrium dendrobatidis (Bd). Bd is generally lethal for amphibians, and stereotypical symptoms of infection include loss in mass and deficits in feeding. However, individuals of P. cinereus can clear their Bd infections with seemingly few fitness costs. We conducted an experiment in which we repeatedly observed the feeding activity of Bd-infected and non-infected salamanders. We found that Bd-infected salamanders generally increased their feeding activity compared to non-infected salamanders. The fact that we did not observe any differences in mass change between the treatments suggests that increased feeding might help Bd-infected salamanders minimize the costs of an effective immune response.

  1. Natural images and contrast encoding in bipolar cells in the retina of the land- and aquatic-phase tiger salamander.

    PubMed

    Burkhardt, Dwight A; Fahey, Patrick K; Sikora, Michael A

    2006-01-01

    Intracellular recordings were obtained from 57 cone-driven bipolar cells in the light-adapted retina of the land-phase (adult) tiger salamander (Ambystoma tigrinum). Responses to flashes of negative and positive contrast for centered spots of optimum spatial dimensions were analyzed as a function of contrast magnitude. On average, the contrast/response curves of depolarizing and hyperpolarizing bipolar cells in the land-phase animals were remarkably similar to those of aquatic-phase animals. Thus, the primary retinal mechanisms mediating contrast coding in the outer retina are conserved as the salamander evolves from the aquatic to the land phase. To evaluate contrast encoding in the context of natural environments, the distribution of contrasts in natural images was measured for 65 scenes. The results, in general agreement with other reports, show that the vast majority of contrasts in nature are very small. The efficient coding hypothesis of Laughlin was examined by comparing the average contrast/response curves of bipolar cells with the cumulative probability distribution of contrasts in natural images. Efficient coding was found at 20 cd/m2 but at lower levels of light adaptation, the contrast/response curves were much too shallow. Further experiments show that two fundamental physiological factors-light adaptation and the nonlinear transfer across the cone-bipolar synapse are essential for the emergence of efficient contrast coding. For both land- and aquatic-based animals, the extent and symmetry of the dynamic range of the contrast/response curves of both classes of bipolar cells varied greatly from cell to cell. This apparent substrate for distributed encoding is established at the bipolar cell level, since it is not found in cones. As a result, the dynamic range of the bipolar cell population brackets the distribution of contrasts found in natural images.

  2. Significance of pre-Quaternary climate change for montane species diversity: insights from Asian salamanders (Salamandridae: Pachytriton).

    PubMed

    Wu, Yunke; Wang, Yuezhao; Jiang, Ke; Hanken, James

    2013-01-01

    Despite extensive focus on the genetic legacy of Pleistocene glaciation, impacts of earlier climatic change on biodiversity are poorly understood. Because amphibians are highly sensitive to variations in precipitation and temperature, we use a genus of Chinese montane salamanders (Salamandridae: Pachytriton) to study paleoclimatic change in East Asia, which experienced intensification of its monsoon circulation in the late Miocene associated with subsequent Pliocene warming. Using both nuclear and mitochondrial DNA sequences, we reconstruct the species tree under a coalescent model and demonstrate that all major lineages originated before the Quaternary. Initial speciation within the genus occurred after the summer monsoon entered a stage of substantial intensification. Heavy summer precipitation established temporary water connectivity through overflows between adjacent stream systems, which may facilitate geographic range expansion by aquatic species such as Pachytriton. Species were formed in allopatry likely through vicariant isolation during or after range expansion. To evaluate the influence of Pliocene warming on these cold-adapted salamanders, we construct a novel temperature buffer-zone model, which suggests widespread physiological stress or even extinction during the warming period. A significant deceleration of species accumulation rate is consistent with Pliocene range contraction, which affected P. granulosus and P. archospotus the most because they lack large temperature buffer zones. In contrast, demographic growth occurred in species for which refugia persist. The buffer-zone model reveals the Huangshan Mountain as a potential climatic refugium, which is similar to that found for other East Asian organisms. Our approach can incorporate future climatic data to evaluate the potential impact of ongoing global warming on montane species (particularly amphibians) and to predict possible population declines.

  3. Rapid method to determine actinides and 89/90Sr in limestone and marble samples

    DOE PAGES

    Maxwell, Sherrod L.; Culligan, Brian; Hutchison, Jay B.; ...

    2016-04-12

    A new method for the determination of actinides and radiostrontium in limestone and marble samples has been developed that utilizes a rapid sodium hydroxide fusion to digest the sample. Following rapid pre-concentration steps to remove sample matrix interferences, the actinides and 89/90Sr are separated using extraction chromatographic resins and measured radiometrically. The advantages of sodium hydroxide fusion versus other fusion techniques will be discussed. Lastly, this approach has a sample preparation time for limestone and marble samples of <4 hours.

  4. Provenance of white marbles from the nabatean sites of Qase Al Bint and colonnaded street baths at Petra, Jordan

    NASA Astrophysics Data System (ADS)

    Abu-Jaber, Nizar; al-Saad, Ziad; Shiyyab, Adnan; Degryse, Patrick

    Intercultural relations and trade are important components of understanding of historical interrelationships between regions and cultures. One of the most interesting objects of trade is stone, because of the expense and difficulty of its transport. Thus, the source of marble used in the Nabatean city of Petra was investigated using established petrological, geochemical and isotopic analyses. Specifically, marble from Qasr al Bint and the Colonnaded Street baths were sampled and investigated. The results of these analyses show that the marbles came from sources in Asia Minora and Greece. The most likely sources of the marble are the quarries of Thasos, Penteli, Prokennesos and Dokimeion. The choice of marble followed the desired utilitarian and aesthetic function of the stone. These results show that active trade in stone was part of the cultural interaction of the period.

  5. Comparison of the occupational safety applications in marble quarries of Carrara (Italy) and Iscehisar (Turkey) by using Elmeri method.

    PubMed

    Ersoy, Metin; Yesilkaya, Liyaddin

    2016-01-01

    In this paper, a brief summary is given about marble quarries in Carrara (Italy) and Iscehisar (Turkey), the Elmeri method is introduced, work accidents that can happen in marble quarries and their causes besides work safety behaviours in fields are explained, and the Elmeri monitoring method is applied and analysed. For this reason, marble quarries are divided into seven in terms of working conditions and active six quarries both in Carrara and Iscehisar areas, and work safety behaviours are analysed. Analysis process is based on True-False method; there are 18 items in total under six main topics; three items on each topic. The safety index for each section and the main topics are also calculated. According to the calculated safety indexes, Carrara area marble quarries (65.08%) are safer than Iscehisar area marble quarries (46.01%).

  6. Marble Canyon 1/sup 0/ x 2/sup 0/ NTMS area Arizona: data report

    SciTech Connect

    Heffner, J.D.

    1980-07-01

    Results of ground water and stream/surface sediment reconnaissance (HSSR) in the National Topographic Map Series (NTMS) Marble Canyon 1/sup 0/ x 2/sup 0/ quadrangle are presented. The target sampling density for all media collected was one site per 12 square kilometers. This resulted in 884 sediment samples being collected; however, dry conditions and sparse population resulted in the collection of only 2 ground water samples. Grand Canyon National Park, Glen Canyon National Recreation Area, and much Indian tribal land in the southern half of the quadrangle were not sampled. Neutron activation analysis (NAA) results are given for uranium and 16 other elements in sediments, and for uranium and 9 other elements in ground water. Mass spectrometry results are given for helium in ground water. Field measurements for sediment samples are presented in tables and maps. Statistical summaries of data and a brief description of results are given. A generalized geologic map and a summary of the geology of the area are included. Data from ground water include: water chemistry measurements (pH, conductivity, and alkalinity); physical measurements (water temperature, and scintillometer readings); and elemental analyses (U, Al, Br, Cl, Dy, F, He, Mg, Mn, Na, and V). Data from sediment sites include: water chemistry measurements (where available) for pH, conductivity, and alkalinity; and elemental analyses(U, Th, Hf, Al, Ce, Dy, Eu, Fe, La, Lu, Mn, Sc, Sm, Na, Ti, V, and Yb). Sample site descriptors (stream characteristics, vegetation, etc.) are also tabulated. Histograms, cumulative frequency, and areal distribution plots for most elements; Log U/Th, Log U/Hf, and Log U/(Th + Hf) ratios; and scintillometer readings are included.

  7. Genetic association of marbling score with intragenic nucleotide variants at selection signals of the bovine genome.

    PubMed

    Ryu, J; Lee, C

    2016-04-01

    Selection signals of Korean cattle might be attributed largely to artificial selection for meat quality. Rapidly increased intragenic markers of newly annotated genes in the bovine genome would help overcome limited findings of genetic markers associated with meat quality at the selection signals in a previous study. The present study examined genetic associations of marbling score (MS) with intragenic nucleotide variants at selection signals of Korean cattle. A total of 39 092 nucleotide variants of 407 Korean cattle were utilized in the association analysis. A total of 129 variants were selected within newly annotated genes in the bovine genome. Their genetic associations were analyzed using the mixed model with random polygenic effects based on identical-by-state genetic relationships among animals in order to control for spurious associations produced by population structure. Genetic associations of MS were found (P<3.88×10-4) with six intragenic