Science.gov

Sample records for marbled salamander populations

  1. Efficacy of land-cover models in predicting isolation of marbled salamander populations in a fragmented landscape.

    PubMed

    Greenwald, Katherine R; Gibbs, H Lisle; Waite, Thomas A

    2009-10-01

    Amphibians worldwide are facing rapid declines due to habitat loss and fragmentation, disease, and other causes. Where habitat alteration is implicated, there is a need for spatially explicit conservation plans. Models built with geographic information systems (GIS) are frequently used to inform such planning. We explored the potential for using GIS models of functional landscape connectivity as a reliable proxy for genetically derived measures of population isolation. We used genetic assignment tests to characterize isolation of marbled salamander populations and evaluated whether the relative amount of modified habitat around breeding ponds was a reliable indicator of population isolation. Using a resampling analysis, we determined whether certain land-cover variables consistently described population isolation. We randomly drew half the data for model building and tested the performance of the best models on the other half 100 times. Deciduous forest was consistently associated with lower levels of population isolation, whereas salamander populations in regions of agriculture and anthropogenic development were more isolated. Models that included these variables and pond size explained 65-70% of variation in genetically inferred isolation across sites. The resampling analysis confirmed that these habitat variables were consistently good predictors of isolation. Used judiciously, simple GIS models with key land-cover variables can be used to estimate population isolation if field sampling and genetic analysis are not possible.

  2. Catastrophic reproductive failure, terrestrial survival, and persistence of the marbled salamander.

    PubMed

    Taylor, Barbara E; Scott, David E; Gibbons, J Whitfield

    2006-06-01

    Wide variation in reproductive success is common among amphibians that breed in seasonal ponds, but persistence of adults can buffer against these fluctuations, particularly for long-lived species. We hypothesized that the frequent episodes of catastrophic failure of the marbled salamander (Ambystoma opacum) enhance the importance of high terrestrial survival. At Rainbow Bay in South Carolina reproductive success was poor (< 1 metamorph/breeding female) in nearly half of the 22 years that the species bred. Complete failure occurred in 6 of 22 years. To study catastrophic failure, we adapted an age-structured, individual-based model with density-dependent growth and survival of larvae. The model was based on extensive data from local field studies and experiments. With consistently good survival in the pond stages, the simulated population required survival probabilities in the upland stages (juveniles and adults) near 0.5/year to persist and near 0.8/year to achieve the increases observed. Catastrophic failure, occurring randomly with probability 0.5/year created additional fluctuations in the population, raised the thresholds of survival required for persistence, and caused extinction under conditions that were otherwise favorable. The marbled salamander at Rainbow Bay is not at great risk of extinction because of catastrophic failure, but the risk increases dramatically if life span is decreased or frequency of failure is increased. Any reduction in terrestrial survival will have deleterious consequences by reducing the breeding populations at equilibrium, even if it does not jeopardize persistence. Our model provides assessments of risk that can be applied to poorly studied species with similar life histories, such as the endangered flatwoods salamander (A. cingulatum). PMID:16909572

  3. Temporally Adaptive Sampling: A Case Study in Rare Species Survey Design with Marbled Salamanders (Ambystoma opacum)

    PubMed Central

    Charney, Noah D.; Kubel, Jacob E.; Eiseman, Charles S.

    2015-01-01

    Improving detection rates for elusive species with clumped distributions is often accomplished through adaptive sampling designs. This approach can be extended to include species with temporally variable detection probabilities. By concentrating survey effort in years when the focal species are most abundant or visible, overall detection rates can be improved. This requires either long-term monitoring at a few locations where the species are known to occur or models capable of predicting population trends using climatic and demographic data. For marbled salamanders (Ambystoma opacum) in Massachusetts, we demonstrate that annual variation in detection probability of larvae is regionally correlated. In our data, the difference in survey success between years was far more important than the difference among the three survey methods we employed: diurnal surveys, nocturnal surveys, and dipnet surveys. Based on these data, we simulate future surveys to locate unknown populations under a temporally adaptive sampling framework. In the simulations, when pond dynamics are correlated over the focal region, the temporally adaptive design improved mean survey success by as much as 26% over a non-adaptive sampling design. Employing a temporally adaptive strategy costs very little, is simple, and has the potential to substantially improve the efficient use of scarce conservation funds. PMID:25799224

  4. Temporally adaptive sampling: a case study in rare species survey design with marbled salamanders (Ambystoma opacum).

    PubMed

    Charney, Noah D; Kubel, Jacob E; Eiseman, Charles S

    2015-01-01

    Improving detection rates for elusive species with clumped distributions is often accomplished through adaptive sampling designs. This approach can be extended to include species with temporally variable detection probabilities. By concentrating survey effort in years when the focal species are most abundant or visible, overall detection rates can be improved. This requires either long-term monitoring at a few locations where the species are known to occur or models capable of predicting population trends using climatic and demographic data. For marbled salamanders (Ambystoma opacum) in Massachusetts, we demonstrate that annual variation in detection probability of larvae is regionally correlated. In our data, the difference in survey success between years was far more important than the difference among the three survey methods we employed: diurnal surveys, nocturnal surveys, and dipnet surveys. Based on these data, we simulate future surveys to locate unknown populations under a temporally adaptive sampling framework. In the simulations, when pond dynamics are correlated over the focal region, the temporally adaptive design improved mean survey success by as much as 26% over a non-adaptive sampling design. Employing a temporally adaptive strategy costs very little, is simple, and has the potential to substantially improve the efficient use of scarce conservation funds. PMID:25799224

  5. Temporally adaptive sampling: a case study in rare species survey design with marbled salamanders (Ambystoma opacum).

    PubMed

    Charney, Noah D; Kubel, Jacob E; Eiseman, Charles S

    2015-01-01

    Improving detection rates for elusive species with clumped distributions is often accomplished through adaptive sampling designs. This approach can be extended to include species with temporally variable detection probabilities. By concentrating survey effort in years when the focal species are most abundant or visible, overall detection rates can be improved. This requires either long-term monitoring at a few locations where the species are known to occur or models capable of predicting population trends using climatic and demographic data. For marbled salamanders (Ambystoma opacum) in Massachusetts, we demonstrate that annual variation in detection probability of larvae is regionally correlated. In our data, the difference in survey success between years was far more important than the difference among the three survey methods we employed: diurnal surveys, nocturnal surveys, and dipnet surveys. Based on these data, we simulate future surveys to locate unknown populations under a temporally adaptive sampling framework. In the simulations, when pond dynamics are correlated over the focal region, the temporally adaptive design improved mean survey success by as much as 26% over a non-adaptive sampling design. Employing a temporally adaptive strategy costs very little, is simple, and has the potential to substantially improve the efficient use of scarce conservation funds.

  6. Comparing population size estimators for plethodontid salamanders

    USGS Publications Warehouse

    Bailey, L.L.; Simons, T.R.; Pollock, K.H.

    2004-01-01

    Despite concern over amphibian declines, few studies estimate absolute abundances because of logistic and economic constraints and previously poor estimator performance. Two estimation approaches recommended for amphibian studies are mark-recapture and depletion (or removal) sampling. We compared abundance estimation via various mark-recapture and depletion methods, using data from a three-year study of terrestrial salamanders in Great Smoky Mountains National Park. Our results indicate that short-term closed-population, robust design, and depletion methods estimate surface population of salamanders (i.e., those near the surface and available for capture during a given sampling occasion). In longer duration studies, temporary emigration violates assumptions of both open- and closed-population mark-recapture estimation models. However, if the temporary emigration is completely random, these models should yield unbiased estimates of the total population (superpopulation) of salamanders in the sampled area. We recommend using Pollock's robust design in mark-recapture studies because of its flexibility to incorporate variation in capture probabilities and to estimate temporary emigration probabilities.

  7. Population dynamics and regulation in the cave salamander Speleomantes strinatii

    NASA Astrophysics Data System (ADS)

    Salvidio, Sebastiano

    2007-05-01

    Time series analysis has been used to evaluate the mechanisms regulating population dynamics of mammals and insects, but has been rarely applied to amphibian populations. In this study, the influence of endogenous (density-dependent) and exogenous (density-independent) factors regulating population dynamics of the terrestrial plethodontid salamander Speleomantes strinatii was analysed by means of time series and multiple regression analyses. During the period 1993 2005, S. strinatii population abundance, estimated by a standardised temporary removal method, displayed relatively low fluctuations, and the autocorrelation function (ACF) analysis showed that the time series had a noncyclic structure. The partial rate correlation function (PRCF) indicated that a strong first-order negative feedback dominated the endogenous dynamics. Stepwise multiple regression analysis showed that the only climatic factor influencing population growth rate was the minimum winter temperature. Thus, at least during the study period, endogenous, density-dependent negative feedback was the main factor affecting the growth rate of the salamander population, whereas stochastic environmental variables, such as temperature and rainfall, seemed to play a minor role in regulation. These results stress the importance of considering both exogenous and endogenous factors when analysing amphibian long-term population dynamics.

  8. Estimation of stream salamander (Plethodontidae, Desmognathinae and Plethodontinae) populations in Shenandoah National Park, Virginia, USA

    USGS Publications Warehouse

    Jung, R.E.; Royle, J. Andrew; Sauer, J.R.; Addison, C.; Rau, R.D.; Shirk, J.L.; Whissel, J.C.

    2005-01-01

    Stream salamanders in the family Plethodontidae constitute a large biomass in and near headwater streams in the eastern United States and are promising indicators of stream ecosystem health. Many studies of stream salamanders have relied on population indices based on counts rather than population estimates based on techniques such as capture-recapture and removal. Application of estimation procedures allows the calculation of detection probabilities (the proportion of total animals present that are detected during a survey) and their associated sampling error, and may be essential for determining salamander population sizes and trends. In 1999, we conducted capture-recapture and removal population estimation methods for Desmognathus salamanders at six streams in Shenandoah National Park, Virginia, USA. Removal sampling appeared more efficient and detection probabilities from removal data were higher than those from capture-recapture. During 2001-2004, we used removal estimation at eight streams in the park to assess the usefulness of this technique for long-term monitoring of stream salamanders. Removal detection probabilities ranged from 0.39 to 0.96 for Desmognathus, 0.27 to 0.89 for Eurycea and 0.27 to 0.75 for northern spring (Gyrinophilus porphyriticus) and northern red (Pseudotriton ruber) salamanders across stream transects. Detection probabilities did not differ across years for Desmognathus and Eurycea, but did differ among streams for Desmognathus. Population estimates of Desmognathus decreased between 2001-2002 and 2003-2004 which may be related to changes in stream flow conditions. Removal-based procedures may be a feasible approach for population estimation of salamanders, but field methods should be designed to meet the assumptions of the sampling procedures. New approaches to estimating stream salamander populations are discussed.

  9. Leaf litter bags as an index to populations of northern two-lined salamanders (Eurycea bislineata)

    USGS Publications Warehouse

    Chalmers, R.J.; Droege, S.

    2002-01-01

    Concern about recent amphibian declines has led to research on amphibian populations, but few statistically tested, standardized methods of counting amphibians exist. We tested whether counts of northern two-lined salamander larvae (Eurycea bislineata) sheltered in leaf litter bags--a relatively new, easily replicable survey technique--had a linear correlation to total number of larvae. Using experimental enclosures placed in streams, we compared number of salamanders found in artificial habitat (leaf litter bags) with total number of salamanders in each enclosure. Low numbers of the animals were found in leaf litter bags, and the relative amount of variation in the index (number of animals in leaf litter bags compared to total number of animals in stream enclosures) was high. The index of salamanders in leaf litter bags was not significantly related to total number of salamanders in enclosures for two-thirds of the replicates or with pooled replicates (P= 0.066). Consequently, we cannot recommend using leaf litter bags to index populations of northern two-lined salamanders.

  10. Three decades of urbanization: Estimating the impact of land-cover change on stream salamander populations

    USGS Publications Warehouse

    Price, S.J.; Dorcas, M.E.; Gallant, A.L.; Klaver, R.W.; Willson, J.D.

    2006-01-01

    Urbanization has become the dominant form of landscape disturbance in parts of the United States. Small streams in the Piedmont region of the eastern United States support high densities of salamanders and are often the first habitats to be affected by landscape-altering factors such as urbanization. We used US Geological Survey land cover data from 1972 to 2000 and a relation between stream salamanders and land cover, established from recent research, to estimate the impact of contemporary land-cover change on the abundance of stream salamanders near Davidson, North Carolina, a Piedmont locale that has experienced rapid urbanization during this time. Our analysis indicates that southern two-lined salamander (Eurycea cirrigera) populations have decreased from 32% to 44% while northern dusky salamanders (Desmognathus fuscus) have decreased from 21% to 30% over the last three decades. Our results suggest that the widespread conversion of forest to urban land in small catchments has likely resulted in a substantial decline of populations of stream salamanders and could have serious effects on stream ecosystems. ?? 2006 Elsevier Ltd. All rights reserved.

  11. Population genetic structure and conservation of marbled murrelets (Brachyramphus marmoratus)

    USGS Publications Warehouse

    Friesen, V.L.; Birt, T.P.; Piatt, J.F.; Golightly, R.T.; Newman, S.H.; Hebert, P.N.; Congdon, B.C.; Gissing, G.

    2005-01-01

    Marbled murrelets (Brachyramphus marmoratus) are coastal seabirds that nest from California to the Aleutian Islands. They are declining and considered threatened in several regions. We compared variation in the mitochondrial control region, four nuclear introns and three microsatellite loci among 194 murrelets from throughout their range except Washington and Oregon. Significant population genetic structure was found: nine private control region haplotypes and three private intron alleles occurred at high frequency in the Aleutians and California; global estimates of FST or ??ST and most pairwise estimates involving the Aleutians and/or California were significant; and marked isolation-by-distance was found. Given the available samples, murrelets appear to comprise five genetic management units: (1) western Aleutian Islands, (2) central Aleutian Islands, (3) mainland Alaska and British Columbia, (4) northern California, and (5) central California. ?? Springer 2005.

  12. Spatial variation in water loss predicts terrestrial salamander distribution and population dynamics.

    PubMed

    Peterman, W E; Semlitsch, R D

    2014-10-01

    Many patterns observed in ecology, such as species richness, life history variation, habitat use, and distribution, have physiological underpinnings. For many ectothermic organisms, temperature relationships shape these patterns, but for terrestrial amphibians, water balance may supersede temperature as the most critical physiologically limiting factor. Many amphibian species have little resistance to water loss, which restricts them to moist microhabitats, and may significantly affect foraging, dispersal, and courtship. Using plaster models as surrogates for terrestrial plethodontid salamanders (Plethodon albagula), we measured water loss under ecologically relevant field conditions to estimate the duration of surface activity time across the landscape. Surface activity time was significantly affected by topography, solar exposure, canopy cover, maximum air temperature, and time since rain. Spatially, surface activity times were highest in ravine habitats and lowest on ridges. Surface activity time was a significant predictor of salamander abundance, as well as a predictor of successful recruitment; the probability of a juvenile salamander occupying an area with high surface activity time was two times greater than an area with limited predicted surface activity. Our results suggest that survival, recruitment, or both are demographic processes that are affected by water loss and the ability of salamanders to be surface-active. Results from our study extend our understanding of plethodontid salamander ecology, emphasize the limitations imposed by their unique physiology, and highlight the importance of water loss to spatial population dynamics. These findings are timely for understanding the effects that fluctuating temperature and moisture conditions predicted for future climates will have on plethodontid salamanders.

  13. Lagged influence of North Atlantic Oscillation on population dynamics of a Mediterranean terrestrial salamander

    NASA Astrophysics Data System (ADS)

    Salvidio, Sebastiano; Oneto, Fabrizio; Ottonello, Dario; Pastorino, Mauro V.

    2016-04-01

    The North Atlantic Oscillation (NAO) is a large-scale climatic pattern that strongly influences the atmospheric circulation in the northern Hemisphere and by consequence the long-term variability of marine and terrestrial ecosystem over great part of northern Europe and western Mediterranean. In the Mediterranean, the effects of the NAO on vertebrates has been studied mainly on bird populations but was rarely analysed in ectothermic animals, and in particular in amphibians. In this study, we investigated the relationships between winter, spring and summer NAO indexes and the long-term population dynamics of the plethodontid salamander Speleomantes strinatii. This terrestrial salamander was monitored inside an artificial cave in NW Italy for 24 consecutive years. The relationships between seasonal NAO indexes and the salamander dynamics were assessed by cross-correlation function (CCF) analysis, after prewhitening the time series by autoregressive moving average statistical modelling. Results of CCF analyses indicated that the salamander abundance varied in relation to the one-year ahead winter NAO ( P = 0.018), while no relationships were found with spring and summer indexes. These results strengthen some previous findings that suggested a high sensitivity of temperate terrestrial amphibians to wintertime climatic conditions.

  14. Decline of disjunct green salamander (Aneides aeneus) populations in the southern appalachians

    USGS Publications Warehouse

    Corser, J.D.

    2001-01-01

    Coincident with other amphibians around the world Aneides aeneus, a terrestrial plethodontid salamander, suffered a population collapse in a disjunct portion of its range in the mid-late 1970s. Long-term monitoring of seven historical green salamander populations throughout the 1990s showed a 98% decline in relative abundance since 1970. Three out of six populations first discovered in 1991 also crashed in 1996-1997. The synchronized suddenness of the declines, their region-wide impact, and effects on both small and larger populations, suggest the role of a novel agent of mortality beginning in the mid-late 1970s. Acting alone, but more likely in concert, habitat loss, overcollecting, epidemic disease and climate change could account for this region-wide decline.

  15. Survey for the pathogenic chytrid fungus Batrachochytrium dendrobatidis in southwestern North Carolina salamander populations.

    PubMed

    Keitzer, S Conor; Goforth, Reuben; Pessier, Allan P; Johnson, April J

    2011-04-01

    Batrachochytrium dendrobatidis is a fungal pathogen responsible for a potentially fatal disease of amphibians. We conducted a survey for B. dendrobatidis in the Appalachian Mountains of southwestern North Carolina, USA, from 10 June to 23 July 23 2009. Ventral skin swabs were collected from plethodontid salamanders (n=278) and real-time PCR was performed to test for the presence of B. dendrobatidis. We found no evidence of B. dendrobatidis, suggesting that B. dendrobatidis is absent or present in such low levels that it was undetected. If B. dendrobatidis was present at the time of our sampling, this survey supports evidence of low prevalence of B. dendrobatidis in North American headwater stream salamander populations. PMID:21441199

  16. Comparing Population Patterns to Processes: Abundance and Survival of a Forest Salamander following Habitat Degradation

    PubMed Central

    Otto, Clint R. V.; Roloff, Gary J.; Thames, Rachael E.

    2014-01-01

    Habitat degradation resulting from anthropogenic activities poses immediate and prolonged threats to biodiversity, particularly among declining amphibians. Many studies infer amphibian response to habitat degradation by correlating patterns in species occupancy or abundance with environmental effects, often without regard to the demographic processes underlying these patterns. We evaluated how retention of vertical green trees (CANOPY) and coarse woody debris (CWD) influenced terrestrial salamander abundance and apparent survival in recently clearcut forests. Estimated abundance of unmarked salamanders was positively related to CANOPY (Canopy  = 0.21 (0.02–1.19; 95% CI), but not CWD (CWD  = 0.11 (−0.13–0.35) within 3,600 m2 sites, whereas estimated abundance of unmarked salamanders was not related to CANOPY (Canopy  = −0.01 (−0.21–0.18) or CWD (CWD  = −0.02 (−0.23–0.19) for 9 m2 enclosures. In contrast, apparent survival of marked salamanders within our enclosures over 1 month was positively influenced by both CANOPY and CWD retention (Canopy  = 0.73 (0.27–1.19; 95% CI) and CWD  = 1.01 (0.53–1.50). Our results indicate that environmental correlates to abundance are scale dependent reflecting habitat selection processes and organism movements after a habitat disturbance event. Our study also provides a cautionary example of how scientific inference is conditional on the response variable(s), and scale(s) of measure chosen by the investigator, which can have important implications for species conservation and management. Our research highlights the need for joint evaluation of population state variables, such as abundance, and population-level process, such as survival, when assessing anthropogenic impacts on forest biodiversity. PMID:24718498

  17. Population Structure and Evolution after Speciation of the Hokkaido Salamander (Hynobius retardatus)

    PubMed Central

    Matsunami, Masatoshi; Igawa, Takeshi; Michimae, Hirofumi; Miura, Toru; Nishimura, Kinya

    2016-01-01

    The Hokkaido salamander (Hynobius retardatus) is endemic to Hokkaido Island, Japan, and shows intriguing flexible phenotypic plasticity and regional morphological diversity. However, to date, allozymes and partial mitochondria DNA sequences have provided only an outline of its demographic histories and the pattern of its genetic diversification. To understand the finer details of the population structure of this species and its evolution since speciation, we genotyped five regional populations by using 12 recently developed microsatellite polymorphic markers. We found a clear population structure with low gene flow among the five populations, but a close genetic relationship between the Teshio and Kitami populations. Our demographic analysis suggested that Teshio and Erimo had the largest effective population sizes among the five populations. These findings regarding the population structure and demography of H. retardatus improve our understanding of the faunal phylogeography on Hokkaido Island and also provide fundamental genetic information that will be useful for future studies. PMID:27257807

  18. Population Structure and Evolution after Speciation of the Hokkaido Salamander (Hynobius retardatus).

    PubMed

    Matsunami, Masatoshi; Igawa, Takeshi; Michimae, Hirofumi; Miura, Toru; Nishimura, Kinya

    2016-01-01

    The Hokkaido salamander (Hynobius retardatus) is endemic to Hokkaido Island, Japan, and shows intriguing flexible phenotypic plasticity and regional morphological diversity. However, to date, allozymes and partial mitochondria DNA sequences have provided only an outline of its demographic histories and the pattern of its genetic diversification. To understand the finer details of the population structure of this species and its evolution since speciation, we genotyped five regional populations by using 12 recently developed microsatellite polymorphic markers. We found a clear population structure with low gene flow among the five populations, but a close genetic relationship between the Teshio and Kitami populations. Our demographic analysis suggested that Teshio and Erimo had the largest effective population sizes among the five populations. These findings regarding the population structure and demography of H. retardatus improve our understanding of the faunal phylogeography on Hokkaido Island and also provide fundamental genetic information that will be useful for future studies. PMID:27257807

  19. Elevational differences in trait response to UV-B radiation by long-toed salamander populations.

    PubMed

    Thurman, Lindsey L; Garcia, Tiffany S; Hoffman, Peter D

    2014-07-01

    Amphibian species capable of optimizing trait response to environmental stressors may develop complex strategies for defending against rapid environmental change. Trait responses may differ between populations, particularly if stressor strength varies across spatial or temporal gradients. Ultraviolet-B (UV-B) radiation is one such stressor that poses a significant threat to amphibian species. We examined the ability of long-toed salamanders (Ambystoma macrodactylum) at high- and low-elevation breeding sites to cooperatively employ behavioral and physiological trait responses to mediate UV-B damage. We performed a microhabitat survey to examine differences in oviposition behavior and UV-B conditions among breeding populations at high- (n = 3; >1,500 m) and low-elevation (n = 3; <100 m) sites. We found significant differences in oviposition behavior across populations, with females at high-elevation sites selecting oviposition substrates in UV-B protected microhabitats. We also collected eggs (n = 633) from each of the breeding sites for analysis of photolyase activity, a photoreactivating enzyme that repairs UV-B damage to the DNA, using a photoproduct immunoassay. Our results revealed no significant differences in photolyase activity between long-toed salamander populations at high and low elevations. For high-elevation salamander populations, relatively low physiological repair capabilities in embryos appear to be buffered by extensive behavioral modifications to reduce UV-B exposure and standardize developmental temperatures. This study provides valuable insight into environmental stress responses via the assessment of multiple traits in allowing sensitive species to persist in rapidly changing landscapes.

  20. Elevational differences in trait response to UV-B radiation by long-toed salamander populations.

    PubMed

    Thurman, Lindsey L; Garcia, Tiffany S; Hoffman, Peter D

    2014-07-01

    Amphibian species capable of optimizing trait response to environmental stressors may develop complex strategies for defending against rapid environmental change. Trait responses may differ between populations, particularly if stressor strength varies across spatial or temporal gradients. Ultraviolet-B (UV-B) radiation is one such stressor that poses a significant threat to amphibian species. We examined the ability of long-toed salamanders (Ambystoma macrodactylum) at high- and low-elevation breeding sites to cooperatively employ behavioral and physiological trait responses to mediate UV-B damage. We performed a microhabitat survey to examine differences in oviposition behavior and UV-B conditions among breeding populations at high- (n = 3; >1,500 m) and low-elevation (n = 3; <100 m) sites. We found significant differences in oviposition behavior across populations, with females at high-elevation sites selecting oviposition substrates in UV-B protected microhabitats. We also collected eggs (n = 633) from each of the breeding sites for analysis of photolyase activity, a photoreactivating enzyme that repairs UV-B damage to the DNA, using a photoproduct immunoassay. Our results revealed no significant differences in photolyase activity between long-toed salamander populations at high and low elevations. For high-elevation salamander populations, relatively low physiological repair capabilities in embryos appear to be buffered by extensive behavioral modifications to reduce UV-B exposure and standardize developmental temperatures. This study provides valuable insight into environmental stress responses via the assessment of multiple traits in allowing sensitive species to persist in rapidly changing landscapes. PMID:24833287

  1. DEMOGRAPHY AND SPATIAL POPULATION STRUCTURE IN CALIFORNIA TIGER SALAMANDER

    EPA Science Inventory

    Although the causes of many amphibian declines remain mysterious, there is general agreement that human habitat alteration represents the greatest threat to amphibian populations. In January 2000 the US Fish and Wildlife Service proposed listing Santa Barbara County California Ti...

  2. Conservation genetics of extremely isolated urban populations of the northern dusky salamander (Desmognathus fuscus) in New York City

    PubMed Central

    Zak, Yana; Pehek, Ellen

    2013-01-01

    Urbanization is a major cause of amphibian decline. Stream-dwelling plethodontid salamanders are particularly susceptible to urbanization due to declining water quality and hydrological changes, but few studies have examined these taxa in cities. The northern dusky salamander (Desmognathus fuscus) was once common in the New York City metropolitan area, but has substantially declined throughout the region in recent decades. We used five tetranucleotide microsatellite loci to examine population differentiation, genetic variation, and bottlenecks among five remnant urban populations of dusky salamanders in NYC. These genetic measures provide information on isolation, prevalence of inbreeding, long-term prospects for population persistence, and potential for evolutionary responses to future environmental change. All populations were genetically differentiated from each other, and the most isolated populations in Manhattan have maintained very little genetic variation (i.e. <20% heterozygosity). A majority of the populations also exhibited evidence of genetic bottlenecks. These findings contrast with published estimates of high genetic variation within and lack of structure between populations of other desmognathine salamanders sampled over similar or larger spatial scales. Declines in genetic variation likely resulted from population extirpations and the degradation of stream and terrestrial paths for dispersal in NYC. Loss of genetic variability in populations isolated by human development may be an underappreciated cause and/or consequence of the decline of this species in urbanized areas of the northeast USA. PMID:23646283

  3. Conservation genetics of extremely isolated urban populations of the northern dusky salamander (Desmognathus fuscus) in New York City.

    PubMed

    Munshi-South, Jason; Zak, Yana; Pehek, Ellen

    2013-01-01

    Urbanization is a major cause of amphibian decline. Stream-dwelling plethodontid salamanders are particularly susceptible to urbanization due to declining water quality and hydrological changes, but few studies have examined these taxa in cities. The northern dusky salamander (Desmognathus fuscus) was once common in the New York City metropolitan area, but has substantially declined throughout the region in recent decades. We used five tetranucleotide microsatellite loci to examine population differentiation, genetic variation, and bottlenecks among five remnant urban populations of dusky salamanders in NYC. These genetic measures provide information on isolation, prevalence of inbreeding, long-term prospects for population persistence, and potential for evolutionary responses to future environmental change. All populations were genetically differentiated from each other, and the most isolated populations in Manhattan have maintained very little genetic variation (i.e. <20% heterozygosity). A majority of the populations also exhibited evidence of genetic bottlenecks. These findings contrast with published estimates of high genetic variation within and lack of structure between populations of other desmognathine salamanders sampled over similar or larger spatial scales. Declines in genetic variation likely resulted from population extirpations and the degradation of stream and terrestrial paths for dispersal in NYC. Loss of genetic variability in populations isolated by human development may be an underappreciated cause and/or consequence of the decline of this species in urbanized areas of the northeast USA.

  4. Population genetic structure of critically endangered salamander (Hynobius amjiensis) in China: recommendations for conservation.

    PubMed

    Yang, J; Chen, C S; Chen, S H; Ding, P; Fan, Z Y; Lu, Y W; Yu, L P; Lin, H D

    2016-01-01

    Amji's salamander (Hynobius amjiensis) is a critically endangered species (IUCN Red List), which is endemic to mainland China. In the present study, five haplotypes were genotyped for the mtDNA cyt b gene in 45 specimens from three populations. Relatively low levels of haplotype diversity (h = 0.524) and nucleotide diversity (π = 0.00532) were detected. Analyses of the phylogenic structure of H. amjiensis showed no evidence of major geographic partitions or substantial barriers to historical gene flow throughout the species' range. Two major phylogenetic haplotype groups were revealed, and were estimated to have diverged about 1.262 million years ago. Mismatch distribution analysis, neutrality tests, and Bayesian skyline plots revealed no evidence of dramatic changes in the effective population size. According to the SAMOVA and STRUCTURE analyses, H. amjiensis should be regarded as two different management units. PMID:27323156

  5. Ecological connectivity assessment in a strongly structured fire salamander (Salamandra salamandra) population

    PubMed Central

    Bani, Luciano; Pisa, Giulia; Luppi, Massimiliano; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Orioli, Valerio

    2015-01-01

    Small populations are more prone to extinction if the dispersal among them is not adequately maintained by ecological connections. The degree of isolation between populations could be evaluated measuring their genetic distance, which depends on the respective geographic (isolation by distance, IBD) and/or ecological (isolation by resistance, IBR) distances. The aim of this study was to assess the ecological connectivity of fire salamander Salamandra salamandra populations by means of a landscape genetic approach. The species lives in broad-leaved forest ecosystems and is particularly affected by fragmentation due to its habitat selectivity and low dispersal capability. We analyzed 477 biological samples collected in 47 sampling locations (SLs) in the mainly continuous populations of the Prealpine and Eastern foothill lowland (PEF) and 10 SLs in the fragmented populations of the Western foothill (WF) lowland of Lombardy (northern Italy). Pairwise genetic distances (Chord distance, DC) were estimated from allele frequencies of 16 microsatellites loci. Ecological distances were calculated using one of the most promising methodology in landscape genetics studies, the circuit theory, applied to habitat suitability maps. We realized two habitat suitability models: one without barriers (EcoD) and a second one accounting for the possible barrier effect of main roads (EcoDb). Mantel tests between distance matrices highlighted how the Log-DC in PEF populations was related to log-transformed geographic distance (confirming a prevalence of IBD), while it was explained by the Log-EcoD, and particularly by the Log-EcoDb, in WF populations, even when accounting for the confounding effect of geographic distance (highlighting a prevalence of IBR). Moreover, we also demonstrated how considering the overall population, the effect of Euclidean or ecological distances on genetic distances acting at the level of a single group (PEF or WF populations) could not be detected, when

  6. Ecological connectivity assessment in a strongly structured fire salamander (Salamandra salamandra) population.

    PubMed

    Bani, Luciano; Pisa, Giulia; Luppi, Massimiliano; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Orioli, Valerio

    2015-08-01

    Small populations are more prone to extinction if the dispersal among them is not adequately maintained by ecological connections. The degree of isolation between populations could be evaluated measuring their genetic distance, which depends on the respective geographic (isolation by distance, IBD) and/or ecological (isolation by resistance, IBR) distances. The aim of this study was to assess the ecological connectivity of fire salamander Salamandra salamandra populations by means of a landscape genetic approach. The species lives in broad-leaved forest ecosystems and is particularly affected by fragmentation due to its habitat selectivity and low dispersal capability. We analyzed 477 biological samples collected in 47 sampling locations (SLs) in the mainly continuous populations of the Prealpine and Eastern foothill lowland (PEF) and 10 SLs in the fragmented populations of the Western foothill (WF) lowland of Lombardy (northern Italy). Pairwise genetic distances (Chord distance, DC) were estimated from allele frequencies of 16 microsatellites loci. Ecological distances were calculated using one of the most promising methodology in landscape genetics studies, the circuit theory, applied to habitat suitability maps. We realized two habitat suitability models: one without barriers (EcoD) and a second one accounting for the possible barrier effect of main roads (EcoDb). Mantel tests between distance matrices highlighted how the Log-DC in PEF populations was related to log-transformed geographic distance (confirming a prevalence of IBD), while it was explained by the Log-EcoD, and particularly by the Log-EcoDb, in WF populations, even when accounting for the confounding effect of geographic distance (highlighting a prevalence of IBR). Moreover, we also demonstrated how considering the overall population, the effect of Euclidean or ecological distances on genetic distances acting at the level of a single group (PEF or WF populations) could not be detected, when

  7. Effects of structural complexity enhancement on eastern red-backed salamander (Plethodon cinereus) populations in northern hardwood forests

    USGS Publications Warehouse

    McKenny, H.C.; Keeton, W.S.; Donovan, T.M.

    2006-01-01

    Managing for stand structural complexity in northern hardwood forests has been proposed as a method for promoting microhabitat characteristics important to eastern red-backed salamanders (Plethodon cinereus). We evaluated the effects of alternate, structure-based silvicultural systems on red-backed salamander populations at two research sites in northwestern Vermont. Treatments included two uneven-aged approaches (single-tree selection and group-selection) and one unconventional approach, termed "structural complexity enhancement" (SCE), that promotes development of late-successional structure, including elevated levels of coarse woody debris (CWD). Treatments were applied to 2 ha units and were replicated two to four times depending on treatment. We surveyed red-backed salamanders with a natural cover search method of transects nested within vegetation plots 1 year after logging. Abundance estimates corrected for detection probability were calculated from survey data with a binomial mixture model. Abundance estimates differed between study areas and were influenced by forest structural characteristics. Model selection was conducted using Akaike Information Criteria, corrected for over-dispersed data and small sample size (QAICc). We found no difference in abundance as a response to treatment as a whole, suggesting that all of the uneven-aged silvicultural systems evaluated can maintain salamander populations after harvest. However, abundance was tied to specific structural habitat attributes associated with study plots within treatments. The most parsimonious model of habitat covariates included site, relative density of overstory trees, and density of more-decayed and less-decayed downed CWD. Abundance responded positively to the density of downed, well-decayed CWD and negatively to the density of poorly decayed CWD and to overstory relative density. CWD volume was not a strong predictor of salamander abundance. We conclude that structural complexity enhancement

  8. Mechanisms of population differentiation in marbled murrelets: historical versus contemporary processes

    USGS Publications Warehouse

    Congdon, B.C.; Piatt, J.F.; Martin, K.; Friesen, V.L.

    2000-01-01

    Mechanisms of population differentiation in highly vagile species such as seabirds are poorly understood. Previous studies of marbled murrelets (Brachyramphus marmoratus; Charadriiformes: Alcidae) found significant population genetic structure, but could not determine whether this structure is due to historical vicariance (e.g., due to Pleistocene glaciers), isolation by distance, drift or selection in peripheral populations, or nesting habitat selection. To discriminate among these possibilities, we analyzed sequence variation in nine nuclear introns from 120 marbled murrelets sampled from British Columbia to the western Aleutian Islands. Mismatch distributions indicated that murrelets underwent at least one population expansion during the Pleistocene and probably are not in genetic equilibrium. Maximum-likelihood analysis of allele frequencies suggested that murrelets from 'mainland' sites (from the Alaskan Peninsula east) are genetically different from those in the Aleutians and that these two lineages diverged prior to the last glaciation. Analyses of molecular variance, as well as estimates of gene flow derived using coalescent theory, indicate that population genetic structure is best explained by peripheral isolation of murrelets in the Aleutian Islands, rather than by selection associated with different nesting habitats. No isolation-by-distance effects could be detected. Our results are consistent with a rapid expansion of murrelets from a single refugium during the early-mid Pleistocene, subsequent isolation and divergence in two or more refugia during the final Pleistocene glacial advance, and secondary contact following retreat of the ice sheets. Population genetic structure now appears to be maintained by distance effects combined with small populations and a highly fragmented habitat in the Aleutian Islands.

  9. Ancient DNA assessment of tiger salamander population in Yellowstone National Park.

    PubMed

    McMenamin, Sarah K; Hadly, Elizabeth A

    2012-01-01

    Recent data indicates that blotched tiger salamanders (Ambystoma tigrinum melanostictum) in northern regions of Yellowstone National Park are declining due to climate-related habitat changes. In this study, we used ancient and modern mitochondrial haplotype diversity to model the effective size of this amphibian population through recent geological time and to assess past responses to climatic changes in the region. Using subfossils collected from a cave in northern Yellowstone, we analyzed >700 base pairs of mitochondrial sequence from 16 samples ranging in age from 100 to 3300 years old and found that all shared an identical haplotype. Although mitochondrial diversity was extremely low within the living population, we still were able to detect geographic subdivision within the local area. Using serial coalescent modelling with Bayesian priors from both modern and ancient genetic data we simulated a range of probable population sizes and mutation rates through time. Our simulations suggest that regional mitochondrial diversity has remained relatively constant even through climatic fluctuations of recent millennia.

  10. Dramatic declines in neotropical salamander populations are an important part of the global amphibian crisis

    PubMed Central

    Rovito, Sean M.; Parra-Olea, Gabriela; Vásquez-Almazán, Carlos R.; Papenfuss, Theodore J.; Wake, David B.

    2009-01-01

    We document major declines of many species of salamanders at several sites in Central America and Mexico, with emphasis on the San Marcos region of Guatemala, one of the best studied and most diverse salamander communities in the Neotropics. Profound declines of several formerly abundant species, including 2 apparent extinctions, are revealed. Terrestrial microhabitat specialists at mid- to high elevations have declined more than microhabitat generalists. These terrestrial microhabitat specialists have largely disappeared from multiple sites in western Guatemala, including in well-protected areas, suggesting that the phenomenon cannot be explained solely by localized habitat destruction. Major declines in southern Mexican plethodontid salamanders occurred in the late 1970s to early 1980s, concurrent with or preceding many reported frog declines. The species in decline comprise several major evolutionary lineages of tropical salamanders, underscoring that significant portions of the phylogenetic diversity of Neotropical salamanders are at risk. Our results highlight the urgent need to document and understand Neotropical salamander declines as part of the larger effort to conserve global amphibian diversity. PMID:19204286

  11. Abundance and phenology patterns of two pond-breeding salamanders determine species interactions in natural populations.

    PubMed

    Anderson, Thomas L; Hocking, Daniel J; Conner, Christopher A; Earl, Julia E; Harper, Elizabeth B; Osbourn, Michael S; Peterman, William E; Rittenhouse, Tracy A G; Semlitsch, Raymond D

    2015-03-01

    Phenology often determines the outcome of interspecific interactions, where early-arriving species often dominate interactions over those arriving later. The effects of phenology on species interactions are especially pronounced in aquatic systems, but the evidence is largely derived from experimental studies. We examined whether differences in breeding phenology between two pond-breeding salamanders (Ambystoma annulatum and A. maculatum) affected metamorph recruitment and demographic traits within natural populations, with the expectation that the fall-breeding A. annulatum would negatively affect the spring-breeding A. maculatum. We monitored populations of each species at five ponds over 4 years using drift fences. Metamorph abundance and survival of A. annulatum were affected by intra- and interspecific processes, whereas metamorph size and date of emigration were primarily influenced by intraspecific effects. Metamorph abundance, snout-vent length, date of emigration and survival for A. maculatum were all predicted by combinations of intra- and interspecific effects, but often showed negative relationships with A. annulatum metamorph traits and abundance. Size and date of metamorphosis were strongly correlated within each species, but in opposite patterns (negative for A. annulatum and positive for A. maculatum), suggesting that the two species use alternative strategies to enhance terrestrial survival and that these factors may influence their interactions. Our results match predictions from experimental studies that suggest recruitment is influenced by intra- and interspecific processes which are determined by phenological differences between species. Incorporating spatiotemporal variability when modeling population dynamics is necessary to understand the importance of phenology in species interactions, especially as shifts in phenology occur under climate change.

  12. Abundance and phenology patterns of two pond-breeding salamanders determine species interactions in natural populations.

    PubMed

    Anderson, Thomas L; Hocking, Daniel J; Conner, Christopher A; Earl, Julia E; Harper, Elizabeth B; Osbourn, Michael S; Peterman, William E; Rittenhouse, Tracy A G; Semlitsch, Raymond D

    2015-03-01

    Phenology often determines the outcome of interspecific interactions, where early-arriving species often dominate interactions over those arriving later. The effects of phenology on species interactions are especially pronounced in aquatic systems, but the evidence is largely derived from experimental studies. We examined whether differences in breeding phenology between two pond-breeding salamanders (Ambystoma annulatum and A. maculatum) affected metamorph recruitment and demographic traits within natural populations, with the expectation that the fall-breeding A. annulatum would negatively affect the spring-breeding A. maculatum. We monitored populations of each species at five ponds over 4 years using drift fences. Metamorph abundance and survival of A. annulatum were affected by intra- and interspecific processes, whereas metamorph size and date of emigration were primarily influenced by intraspecific effects. Metamorph abundance, snout-vent length, date of emigration and survival for A. maculatum were all predicted by combinations of intra- and interspecific effects, but often showed negative relationships with A. annulatum metamorph traits and abundance. Size and date of metamorphosis were strongly correlated within each species, but in opposite patterns (negative for A. annulatum and positive for A. maculatum), suggesting that the two species use alternative strategies to enhance terrestrial survival and that these factors may influence their interactions. Our results match predictions from experimental studies that suggest recruitment is influenced by intra- and interspecific processes which are determined by phenological differences between species. Incorporating spatiotemporal variability when modeling population dynamics is necessary to understand the importance of phenology in species interactions, especially as shifts in phenology occur under climate change. PMID:25413866

  13. Detecting a hierarchical genetic population structure: the case study of the Fire Salamander (Salamandra salamandra) in Northern Italy.

    PubMed

    Pisa, Giulia; Orioli, Valerio; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Bani, Luciano

    2015-02-01

    The multistep method here applied in studying the genetic structure of a low dispersal and philopatric species, such as the Fire Salamander Salamandra salamandra, was proved to be effective in identifying the hierarchical structure of populations living in broad-leaved forest ecosystems in Northern Italy. In this study, 477 salamander larvae, collected in 28 sampling populations (SPs) in the Prealpine and in the foothill areas of Northern Italy, were genotyped at 16 specie-specific microsatellites. SPs showed a significant overall genetic variation (Global F ST = 0.032, P < 0.001). The genetic population structure was assessed by using STRUCTURE 2.3.4. We found two main genetic groups, one represented by SPs inhabiting the Prealpine belt, which maintain connections with those of the Eastern foothill lowland (PEF), and a second group with the SPs of the Western foothill lowland (WF). The two groups were significantly distinct with a Global F ST of 0.010 (P < 0.001). While the first group showed a moderate structure, with only one divergent SP (Global F ST = 0.006, P < 0.001), the second group proved more structured being divided in four clusters (Global F ST = 0.017, P = 0.058). This genetic population structure should be due to the large conurbations and main roads that separate the WF group from the Prealpine belt and the Eastern foothill lowland. The adopted methods allowed the analysis of the genetic population structure of Fire Salamander from wide to local scale, identifying different degrees of genetic divergence of their populations derived from forest fragmentation induced by urban and infrastructure sprawl. PMID:25691995

  14. The First Estimates of Marbled Cat Pardofelis marmorata Population Density from Bornean Primary and Selectively Logged Forest

    PubMed Central

    Hearn, Andrew J.; Ross, Joanna; Bernard, Henry; Bakar, Soffian Abu; Hunter, Luke T. B.; Macdonald, David W.

    2016-01-01

    The marbled cat Pardofelis marmorata is a poorly known wild cat that has a broad distribution across much of the Indomalayan ecorealm. This felid is thought to exist at low population densities throughout its range, yet no estimates of its abundance exist, hampering assessment of its conservation status. To investigate the distribution and abundance of marbled cats we conducted intensive, felid-focused camera trap surveys of eight forest areas and two oil palm plantations in Sabah, Malaysian Borneo. Study sites were broadly representative of the range of habitat types and the gradient of anthropogenic disturbance and fragmentation present in contemporary Sabah. We recorded marbled cats from all forest study areas apart from a small, relatively isolated forest patch, although photographic detection frequency varied greatly between areas. No marbled cats were recorded within the plantations, but a single individual was recorded walking along the forest/plantation boundary. We collected sufficient numbers of marbled cat photographic captures at three study areas to permit density estimation based on spatially explicit capture-recapture analyses. Estimates of population density from the primary, lowland Danum Valley Conservation Area and primary upland, Tawau Hills Park, were 19.57 (SD: 8.36) and 7.10 (SD: 1.90) individuals per 100 km2, respectively, and the selectively logged, lowland Tabin Wildlife Reserve yielded an estimated density of 10.45 (SD: 3.38) individuals per 100 km2. The low detection frequencies recorded in our other survey sites and from published studies elsewhere in its range, and the absence of previous density estimates for this felid suggest that our density estimates may be from the higher end of their abundance spectrum. We provide recommendations for future marbled cat survey approaches. PMID:27007219

  15. The First Estimates of Marbled Cat Pardofelis marmorata Population Density from Bornean Primary and Selectively Logged Forest.

    PubMed

    Hearn, Andrew J; Ross, Joanna; Bernard, Henry; Bakar, Soffian Abu; Hunter, Luke T B; Macdonald, David W

    2016-01-01

    The marbled cat Pardofelis marmorata is a poorly known wild cat that has a broad distribution across much of the Indomalayan ecorealm. This felid is thought to exist at low population densities throughout its range, yet no estimates of its abundance exist, hampering assessment of its conservation status. To investigate the distribution and abundance of marbled cats we conducted intensive, felid-focused camera trap surveys of eight forest areas and two oil palm plantations in Sabah, Malaysian Borneo. Study sites were broadly representative of the range of habitat types and the gradient of anthropogenic disturbance and fragmentation present in contemporary Sabah. We recorded marbled cats from all forest study areas apart from a small, relatively isolated forest patch, although photographic detection frequency varied greatly between areas. No marbled cats were recorded within the plantations, but a single individual was recorded walking along the forest/plantation boundary. We collected sufficient numbers of marbled cat photographic captures at three study areas to permit density estimation based on spatially explicit capture-recapture analyses. Estimates of population density from the primary, lowland Danum Valley Conservation Area and primary upland, Tawau Hills Park, were 19.57 (SD: 8.36) and 7.10 (SD: 1.90) individuals per 100 km2, respectively, and the selectively logged, lowland Tabin Wildlife Reserve yielded an estimated density of 10.45 (SD: 3.38) individuals per 100 km2. The low detection frequencies recorded in our other survey sites and from published studies elsewhere in its range, and the absence of previous density estimates for this felid suggest that our density estimates may be from the higher end of their abundance spectrum. We provide recommendations for future marbled cat survey approaches.

  16. The First Estimates of Marbled Cat Pardofelis marmorata Population Density from Bornean Primary and Selectively Logged Forest.

    PubMed

    Hearn, Andrew J; Ross, Joanna; Bernard, Henry; Bakar, Soffian Abu; Hunter, Luke T B; Macdonald, David W

    2016-01-01

    The marbled cat Pardofelis marmorata is a poorly known wild cat that has a broad distribution across much of the Indomalayan ecorealm. This felid is thought to exist at low population densities throughout its range, yet no estimates of its abundance exist, hampering assessment of its conservation status. To investigate the distribution and abundance of marbled cats we conducted intensive, felid-focused camera trap surveys of eight forest areas and two oil palm plantations in Sabah, Malaysian Borneo. Study sites were broadly representative of the range of habitat types and the gradient of anthropogenic disturbance and fragmentation present in contemporary Sabah. We recorded marbled cats from all forest study areas apart from a small, relatively isolated forest patch, although photographic detection frequency varied greatly between areas. No marbled cats were recorded within the plantations, but a single individual was recorded walking along the forest/plantation boundary. We collected sufficient numbers of marbled cat photographic captures at three study areas to permit density estimation based on spatially explicit capture-recapture analyses. Estimates of population density from the primary, lowland Danum Valley Conservation Area and primary upland, Tawau Hills Park, were 19.57 (SD: 8.36) and 7.10 (SD: 1.90) individuals per 100 km2, respectively, and the selectively logged, lowland Tabin Wildlife Reserve yielded an estimated density of 10.45 (SD: 3.38) individuals per 100 km2. The low detection frequencies recorded in our other survey sites and from published studies elsewhere in its range, and the absence of previous density estimates for this felid suggest that our density estimates may be from the higher end of their abundance spectrum. We provide recommendations for future marbled cat survey approaches. PMID:27007219

  17. The Effect of Recurrent Floods on Genetic Composition of Marble Trout Populations

    PubMed Central

    Pujolar, José Martin; Vincenzi, Simone; Zane, Lorenzo; Jesensek, Dusan; De Leo, Giulio A.; Crivelli, Alain J.

    2011-01-01

    A changing global climate can threaten the diversity of species and ecosystems. We explore the consequences of catastrophic disturbances in determining the evolutionary and demographic histories of secluded marble trout populations in Slovenian streams subjected to weather extremes, in particular recurrent flash floods and debris flows causing massive mortalities. Using microsatellite data, a pattern of extreme genetic differentiation was found among populations (global FST of 0.716), which exceeds the highest values reported in freshwater fish. All locations showed low levels of genetic diversity as evidenced by low heterozygosities and a mean of only 2 alleles per locus, with few or no rare alleles. Many loci showed a discontinuous allele distribution, with missing alleles across the allele size range, suggestive of a population contraction. Accordingly, bottleneck episodes were inferred for all samples with a reduction in population size of 3–4 orders of magnitude. The reduced level of genetic diversity observed in all populations implies a strong impact of genetic drift, and suggests that along with limited gene flow, genetic differentiation might have been exacerbated by recurrent mortalities likely caused by flash flood and debris flows. Due to its low evolutionary potential the species might fail to cope with an intensification and altered frequency of flash flood events predicted to occur with climate change. PMID:21931617

  18. Calibrating abundance indices with population size estimators of red back salamanders (Plethodon cinereus) in a New England forest

    PubMed Central

    Ellison, Aaron M.; Jackson, Scott

    2015-01-01

    Herpetologists and conservation biologists frequently use convenient and cost-effective, but less accurate, abundance indices (e.g., number of individuals collected under artificial cover boards or during natural objects surveys) in lieu of more accurate, but costly and destructive, population size estimators to detect and monitor size, state, and trends of amphibian populations. Although there are advantages and disadvantages to each approach, reliable use of abundance indices requires that they be calibrated with accurate population estimators. Such calibrations, however, are rare. The red back salamander, Plethodon cinereus, is an ecologically useful indicator species of forest dynamics, and accurate calibration of indices of salamander abundance could increase the reliability of abundance indices used in monitoring programs. We calibrated abundance indices derived from surveys of P. cinereus under artificial cover boards or natural objects with a more accurate estimator of their population size in a New England forest. Average densities/m2 and capture probabilities of P. cinereus under natural objects or cover boards in independent, replicate sites at the Harvard Forest (Petersham, Massachusetts, USA) were similar in stands dominated by Tsuga canadensis (eastern hemlock) and deciduous hardwood species (predominantly Quercus rubra [red oak] and Acer rubrum [red maple]). The abundance index based on salamanders surveyed under natural objects was significantly associated with density estimates of P. cinereus derived from depletion (removal) surveys, but underestimated true density by 50%. In contrast, the abundance index based on cover-board surveys overestimated true density by a factor of 8 and the association between the cover-board index and the density estimates was not statistically significant. We conclude that when calibrated and used appropriately, some abundance indices may provide cost-effective and reliable measures of P. cinereus abundance that could

  19. Fine-scale population differentiation and gene flow in a terrestrial salamander (Plethodon cinereus) living in continuous habitat.

    PubMed

    Cabe, P R; Page, R B; Hanlon, T J; Aldrich, M E; Connors, L; Marsh, D M

    2007-01-01

    Several recent studies have shown that amphibian populations may exhibit high genetic subdivision in areas with recent fragmentation and urban development. Less is known about the potential for genetic differentiation in continuous habitats. We studied genetic differentiation of red-backed salamanders (Plethodon cinereus) across a 2-km transect through continuous forest in Virginia, USA. Mark-recapture studies suggest very little dispersal for this species, whereas homing experiments and post-Pleistocene range expansion both suggest greater dispersal abilities. We used six microsatellite loci to examine genetic population structure and differentiation between eight subpopulations of red-backed salamanders at distances from 200 m to 2 km. We also used several methods to extrapolate dispersal frequencies and test for sex-biased dispersal. We found small, but detectable differentiation among populations, even at distances as small as 200 m. Differentiation was closely correlated with distance and both Mantel tests and assignment tests were consistent with an isolation-by-distance model for the population. Extrapolations of intergenerational variance in spatial position (sigma(2)<15 m(2)) and pair-wise dispersal frequencies (4 Nm < 25 for plots separated by 300 m) both suggest limited gene flow. Additionally, tests for sex-biased dispersal imply that dispersal frequency is similarly low for both sexes. We suggest that these low levels of gene flow and the infrequent dispersal observed in mark-recapture studies may be reconciled with homing ability and range expansion if dispersing animals rarely succeed in breeding in saturated habitats, if dispersal is flexible depending on the availability of habitat, or if dispersal frequency varies across the geographic range of red-backed salamanders.

  20. Calibrating abundance indices with population size estimators of red back salamanders (Plethodon cinereus) in a New England forest.

    PubMed

    Siddig, Ahmed A; Ellison, Aaron M; Jackson, Scott

    2015-01-01

    Herpetologists and conservation biologists frequently use convenient and cost-effective, but less accurate, abundance indices (e.g., number of individuals collected under artificial cover boards or during natural objects surveys) in lieu of more accurate, but costly and destructive, population size estimators to detect and monitor size, state, and trends of amphibian populations. Although there are advantages and disadvantages to each approach, reliable use of abundance indices requires that they be calibrated with accurate population estimators. Such calibrations, however, are rare. The red back salamander, Plethodon cinereus, is an ecologically useful indicator species of forest dynamics, and accurate calibration of indices of salamander abundance could increase the reliability of abundance indices used in monitoring programs. We calibrated abundance indices derived from surveys of P. cinereus under artificial cover boards or natural objects with a more accurate estimator of their population size in a New England forest. Average densities/m(2) and capture probabilities of P. cinereus under natural objects or cover boards in independent, replicate sites at the Harvard Forest (Petersham, Massachusetts, USA) were similar in stands dominated by Tsuga canadensis (eastern hemlock) and deciduous hardwood species (predominantly Quercus rubra [red oak] and Acer rubrum [red maple]). The abundance index based on salamanders surveyed under natural objects was significantly associated with density estimates of P. cinereus derived from depletion (removal) surveys, but underestimated true density by 50%. In contrast, the abundance index based on cover-board surveys overestimated true density by a factor of 8 and the association between the cover-board index and the density estimates was not statistically significant. We conclude that when calibrated and used appropriately, some abundance indices may provide cost-effective and reliable measures of P. cinereus abundance that

  1. Fine-Scale Habitat Associations of a Terrestrial Salamander: The Role of Environmental Gradients and Implications for Population Dynamics

    PubMed Central

    Peterman, William E.; Semlitsch, Raymond D.

    2013-01-01

    Environmental gradients are instrumental in shaping the distribution and local abundance of species because at the most fundamental level, an organism’s performance is constrained by the environment it inhabits. In topographically complex landscapes, slope, aspect, and vegetative cover interact to affect solar exposure, creating temperature-moisture gradients and unique microclimates. The significance of the interaction of abiotic gradients and biotic factors such as competition, movement, or physiology has long been recognized, but the scale at which these factors vary on the landscape has generally precluded their inclusion in spatial abundance models. We used fine-scale spatial data relating to surface-soil moisture, temperature, and canopy cover to describe the spatial distribution of abundance of a terrestrial salamander, Plethodon albagula, across the landscape. Abundance was greatest in dense-canopy ravine habitats with high moisture and low solar exposure, resulting in a patchy distribution of abundance. We hypothesize that these patterns reflect the physiological constraints of Plethodontid salamanders. Furthermore, demographic cohorts were not uniformly distributed among occupied plots on the landscape. The probability of gravid female occurrence was nearly uniform among occupied plots, but juveniles were much more likely to occur on plots with lower surface temperatures. The disconnect between reproductive effort and recruitment suggests that survival differs across the landscape and that local population dynamics vary spatially. Our study demonstrates a connection between abundance, fine-scale environmental gradients, and population dynamics, providing a foundation for future research concerning movement, population connectivity, and physiology. PMID:23671586

  2. Effects of hatching time for larval ambystomatid salamanders

    USGS Publications Warehouse

    Boone, M.D.; Scott, D.E.; Niewiarowski, P.H.

    2002-01-01

    In aquatic communities, the phenology of breeding may influence species interactions. In the early-breeding marbled salamander, Ambystoma opacum, timing of pond filling may determine whether interactions among larvae are competitive or predatory. The objectives of our studies were to determine how time of egg hatching affected size, larval period, and survival to metamorphosis in A. opacum, and if early-hatching in A. opacum influenced the competitive and predator-prey relationships with smaller larvae of the mole salamander, Ambystoma talpoideum. Salamander larvae were reared from hatching through metamorphosis in large, outdoor enclosures located in a natural temporary pond in Aiken County, South Carolina, in two experiments. In study 1, we reared early- and late-hatching A. opacum larvae separately from hatching through metamorphosis. In study 2, we examined how early- versus late-hatching A. opacum affected a syntopic species, A. talpoideum. In general, early-hatching A. opacum were larger and older at metamorphosis, had greater survival, and left the pond earlier than late-hatching larvae. Ambystoma talpoideum reared in the presence of early-hatching A. opacum had lower survival than in controls, suggesting that A. opacum may predate upon A. talpoideum when they gain a growth advantage over later-hatching larvae. Our studies demonstrate that time of pond filling and phenology of breeding may influence population dynamics and alter the nature of relationships that develop among species.

  3. Phylogeography of the Alpine salamander, Salamandra atra (Salamandridae) and the influence of the Pleistocene climatic oscillations on population divergence.

    PubMed

    Riberon, A; Miaud, C; Grossenbacher, K; Taberlet, P

    2001-10-01

    Fifty individuals of the endemic Alpine salamander, Salamandra atra, representing 13 populations throughout the range of the two currently recognized subspecies, atra and aurorae, were examined for sequence variation in a large portion (1050 bp) of the mitochondrial cytochrome b gene. We revealed a large number of mitochondrial DNA (mtDNA) haplotypes (10). Interpopulation sequence divergence was very low, ranging from 0 to 3.1%. The relationships among haplotypes were poorly resolved. The divergence time estimate between several mtDNA haplotypes suggested a pre-Pleistocene differentiation approximately 3 million years ago. Moreover, the impact of the Pleistocene glaciations on the phylogeographical patterns appears to have been secondary, although a somewhat reduced genetic variability was found in populations living in areas that were directly affected by the glaciation.

  4. Growth, survival, longevity, and population size of the Big Mouth Cave salamander (Gyrinophilus palleucus necturoides) from the type locality in Grundy County, Tennessee, USA

    USGS Publications Warehouse

    Niemiller, Matthew L.; Glorioso, Brad M.; Fenolio, Dante B.; Reynolds, R. Graham; Taylor, Steven J.; Miller, Brian T.

    2016-01-01

    Salamander species that live entirely in subterranean habitats have evolved adaptations that allow them to cope with perpetual darkness and limited energy resources. We conducted a 26-month mark–recapture study to better understand the individual growth and demography of a population of the Big Mouth Cave Salamander (Gyrinophilus palleucus necturoides). We employed a growth model to estimate growth rates, age at sexual maturity, and longevity, and an open population model to estimate population size, density, detectability, and survival rates. Furthermore, we examined cover use and evidence of potential predation. Individuals probably reach sexual maturity in 3–5 years and live at least nine years. Survival rates were generally high (>75%) but declined during the study. More than 30% of captured salamanders had regenerating tails or tail damage, which presumably represent predation attempts by conspecifics or crayfishes. Most salamanders (>90%) were found under cover (e.g., rocks, trash, decaying plant material). Based on 11 surveys during the study, population size estimates ranged from 21 to 104 individuals in the ca. 710 m2 study area. Previous surveys indicated that this population experienced a significant decline from the early 1970s through the 1990s, perhaps related to silvicultural and agricultural practices. However, our data suggest that this population has either recovered or stabilized during the past 20 years. Differences in relative abundance between early surveys and our survey could be associated with differences in survey methods or sampling conditions rather than an increase in population size. Regardless, our study demonstrates that this population is larger than previously thought and is in no immediate risk of extirpation, though it does appear to exhibit higher rates of predation than expected for a species believed to be an apex predator of subterranean food webs.

  5. Reproductive biology of Ambystoma salamanders in the southeastern United States

    USGS Publications Warehouse

    Glorioso, Brad M.; Waddle, J. Hardin; Hefner, Jeromi M.

    2015-01-01

    Reproductive aspects of Ambystoma salamanders were investigated at sites in Louisiana (2010–12) and Mississippi (2013). Three species occurred at the Louisiana site, Spotted Salamander (A. maculatum), Marbled Salamander (A. opacum), and Mole Salamander (A. talpoideum), whereas only Spotted Salamanders were studied at the Mississippi site. A total of 162 and 71 egg masses of Spotted Salamanders were examined at the Louisiana and Mississippi sites, respectively. Significantly more Spotted Salamander eggs per egg mass were observed at the Mississippi site (x̄ = 78.2) than the Louisiana site (x̄ = 53.8; P < 0.001). The mean snout–vent length of female Spotted Salamanders at the Mississippi site (82.9 mm) was significantly larger than the Louisiana site (76.1 mm; P < 0.001). Opaque Spotted Salamander egg masses were not found at the Mississippi site, but accounted for 11% of examined egg masses at the Louisiana site. The mean number of eggs per egg mass at the Louisiana site did not differ between opaque (47.3) and clear (54.6) egg masses (P = 0.21). A total of 47 egg masses of the Mole Salamander were examined, with a mean number of 6.7 embryos per mass. Twenty-three individual nests of the Marbled Salamander were found either under or in decaying logs in the dry pond basins. There was no difference between the mean numbers of eggs per mass of attended nests (93.0) versus those that were discovered unattended (86.6; P = 0.67). Females tended to place their nests at intermediate heights within the pond basin.

  6. Estimation of Coast-Wide Population Trends of Marbled Murrelets in Canada Using a Bayesian Hierarchical Model.

    PubMed

    Bertram, Douglas F; Drever, Mark C; McAllister, Murdoch K; Schroeder, Bernard K; Lindsay, David J; Faust, Deborah A

    2015-01-01

    Species at risk with secretive breeding behaviours, low densities, and wide geographic range pose a significant challenge to conservation actions because population trends are difficult to detect. Such is the case with the Marbled Murrelet (Brachyramphus marmoratus), a seabird listed as 'Threatened' by the Species at Risk Act in Canada largely due to the loss of its old growth forest nesting habitat. We report the first estimates of population trend of Marbled Murrelets in Canada derived from a monitoring program that uses marine radar to detect birds as they enter forest watersheds during 923 dawn surveys at 58 radar monitoring stations within the six Marbled Murrelet Conservation Regions on coastal British Columbia, Canada, 1996-2013. Temporal trends in radar counts were analyzed with a hierarchical Bayesian multivariate modeling approach that controlled for variation in tilt of the radar unit and day of year, included year-specific deviations from the overall trend ('year effects'), and allowed for trends to be estimated at three spatial scales. A negative overall trend of -1.6%/yr (95% credibility interval: -3.2%, 0.01%) indicated moderate evidence for a coast-wide decline, although trends varied strongly among the six conservation regions. Negative annual trends were detected in East Vancouver Island (-9%/yr) and South Mainland Coast (-3%/yr) Conservation Regions. Over a quarter of the year effects were significantly different from zero, and the estimated standard deviation in common-shared year effects between sites within each region was about 50% per year. This large common-shared interannual variation in counts may have been caused by regional movements of birds related to changes in marine conditions that affect the availability of prey.

  7. Estimation of Coast-Wide Population Trends of Marbled Murrelets in Canada Using a Bayesian Hierarchical Model

    PubMed Central

    Schroeder, Bernard K.; Lindsay, David J.; Faust, Deborah A.

    2015-01-01

    Species at risk with secretive breeding behaviours, low densities, and wide geographic range pose a significant challenge to conservation actions because population trends are difficult to detect. Such is the case with the Marbled Murrelet (Brachyramphus marmoratus), a seabird listed as ‘Threatened’ by the Species at Risk Act in Canada largely due to the loss of its old growth forest nesting habitat. We report the first estimates of population trend of Marbled Murrelets in Canada derived from a monitoring program that uses marine radar to detect birds as they enter forest watersheds during 923 dawn surveys at 58 radar monitoring stations within the six Marbled Murrelet Conservation Regions on coastal British Columbia, Canada, 1996–2013. Temporal trends in radar counts were analyzed with a hierarchical Bayesian multivariate modeling approach that controlled for variation in tilt of the radar unit and day of year, included year-specific deviations from the overall trend (‘year effects’), and allowed for trends to be estimated at three spatial scales. A negative overall trend of -1.6%/yr (95% credibility interval: -3.2%, 0.01%) indicated moderate evidence for a coast-wide decline, although trends varied strongly among the six conservation regions. Negative annual trends were detected in East Vancouver Island (-9%/yr) and South Mainland Coast (-3%/yr) Conservation Regions. Over a quarter of the year effects were significantly different from zero, and the estimated standard deviation in common-shared year effects between sites within each region was about 50% per year. This large common-shared interannual variation in counts may have been caused by regional movements of birds related to changes in marine conditions that affect the availability of prey. PMID:26258803

  8. Temporal changes in allele frequencies in a small marble trout Salmo marmoratus population threatened by extreme flood events.

    PubMed

    Pujolar, J M; Vincenzi, S; Zane, L; Crivelli, A J

    2016-03-01

    The effect of extreme floods on the genetic composition of marble trout Salmo marmoratus living in Lipovscek, a tributary of the Soca River in Slovenia, which has been affected by multiple destructive flood events for centuries was investigated. By monitoring genetic variability during the period 2004-2011, apparent signatures of genetic erosion including a decline in observed and expected heterozygosities and allelic richness were observed. Contemporary effective population size was estimated between 11 and 55 individuals, which is congruent with census data. The data suggest asymmetric gene flow between the two sections of the river. The existence of substantial downstream migration (15-19%) was confirmed by paternity analysis. A small (1-3%) upstream migration was also suggested, which was confirmed by tagging data. Overall, low genetic diversity has not prevented the survival of the Lipovscek population, which might be a common feature of salmonid freshwater populations. PMID:26832308

  9. Patch occupancy, number of individuals and population density of the Marbled White in a changing agricultural landscape

    NASA Astrophysics Data System (ADS)

    Lenda, Magdalena; Skórka, Piotr

    2010-09-01

    Metapopulation theory predicts the occurrence of animals in habitat patches. In this paper, we tested predictions based on this theory, including effects of spatial autocorrelation, to describe factors affecting the presence, local number of individuals and density of the Marbled White butterfly Melanargia galathea in habitat patches spread across the agricultural landscape of southern Poland. This agricultural landscape has undergone significant changes in recent decades due to the country's political transformation and is currently characterized by a large proportion of fallow (abandoned) land. We compared 48 occupied habitat patches with 60 unoccupied ones. Positive spatial autocorrelation was found in the number and density of individuals in habitat patches. The probability of patch occupancy was higher for patches that were larger, had a higher proportion of edges, were located closer to the nearest neighbouring local population and to the nearest piece of fallow, contained a smaller area of cut grass, and also had more nectar resources. The number of Marbled Whites in habitat patches was positively related to the patch area, the distance to the nearest fallow and the abundance of nectar resources, but was negatively related to the density of shrubs. The density of individuals was positively related to abundance of flowers, proportion of edge in a patch and distance to the nearest fallow, but it was negatively related to patch area, vegetation height and grass cover. These results indicate that recent land-use changes in agricultural landscapes have had both positive and negative effects on the presence and local number of individuals and density of the Marbled White. These changes affect the metapopulation of the species through changes in habitat quality and landscape connectivity in the area surrounding habitat patches.

  10. Metals, Parasites, and Environmental Conditions Affecting Breeding Populations of Spotted Salamanders (Ambystoma maculatum) in Northern Arkansas, USA.

    PubMed

    DeMali, Heather M; Trauth, Stanley E; Bouldin, Jennifer L

    2016-06-01

    The spotted salamander (Ambystoma maculatum) is indigenous to northern Arkansas, and several breeding sites are known to exist in the region. Spotted salamanders (n = 17) were collected and examined for parasites and only three females harbored nematodes (Physaloptera spp.). Chronic aquatic bioassays were conducted using water collected from eight breeding ponds during different hydroperiod events. No lethal or sublethal effects were measured in Ceriodaphnia dubia; however, decreased growth and survival were seen in Pimephales promelas. Aqueous, sediment, and salamander hepatic samples were analyzed for As, Cd, Cu, Pb, and Ni. Metal analysis revealed possible increased metal exposure following precipitation, with greatest metal concentrations measured in sediment samples. Hepatic metal concentrations were similar in parasitized and non-parasitized individuals, and greatest Pb concentrations were measured following normal precipitation events. Determining environmental stressors of amphibians, especially during their breeding and subsequent larval life stage, is imperative to improve species conservation. PMID:26886425

  11. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders

    PubMed Central

    Ziemba, Julie L.

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from “non-invaded” and “pheretimoid invaded” sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance

  12. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders.

    PubMed

    Ziemba, Julie L; Hickerson, Cari-Ann M; Anthony, Carl D

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from "non-invaded" and "pheretimoid invaded" sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance following Asian

  13. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders.

    PubMed

    Ziemba, Julie L; Hickerson, Cari-Ann M; Anthony, Carl D

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from "non-invaded" and "pheretimoid invaded" sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance following Asian

  14. Marbles in Motion.

    ERIC Educational Resources Information Center

    Brown, Helen; Meyers, Bernice; Schmidt, William

    1999-01-01

    Marbles were successfully used to help primary students develop concepts of motion. Marble-unit activities began with shaking and rattling inference bags and predicting by listening just how many marbles were in each bag. Students made qualitative and quantitative observations of the marbles, manipulated marbles with a partner, and observed…

  15. [Effect of population density on enzymatic activity of antioxidative and phenol oxidase systems of imagoes and nymphs of the marble cockroach Nauphoeta cinerea].

    PubMed

    Murzagulov, G S; Saltykova, E S; Gaĭfullina, L R; Nikolenko, A G

    2013-01-01

    The work deals with effect of density of population on functional activity of components pf protective system of adult individuals and nymphs of the marble cockroach. The resistance of individuals has been noted to decrease both at individual maintenance and under conditions of overpopulation. Changes in activities of enzymes of antioxidative and phenoloxidase systems are studied ion the insect hemolymph and intestine. Possible consequences of isolation and overpopulation are discussed both for stability and for individual development.

  16. Effects of timber harvests and silvicultural edges on terrestrial salamanders.

    PubMed

    MacNeil, Jami E; Williams, Rod N

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m). Small harvests (<4 ha) and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years

  17. Effects of Timber Harvests and Silvicultural Edges on Terrestrial Salamanders

    PubMed Central

    MacNeil, Jami E.; Williams, Rod N.

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m). Small harvests (<4 ha) and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years

  18. Effects of timber harvests and silvicultural edges on terrestrial salamanders.

    PubMed

    MacNeil, Jami E; Williams, Rod N

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m). Small harvests (<4 ha) and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years

  19. Separating Population Structure from Population History: A Cladistic Analysis of the Geographical Distribution of Mitochondrial DNA Haplotypes in the Tiger Salamander, Ambystoma Tigrinum

    PubMed Central

    Templeton, A. R.; Routman, E.; Phillips, C. A.

    1995-01-01

    Nonrandom associations of alleles or haplotypes with geographical location can arise from restricted gene flow, historical events (fragmentation, range expansion, colonization), or any mixture of these factors. In this paper, we show how a nested cladistic analysis of geographical distances can be used to test the null hypothesis of no geographical association of haplotypes, test the hypothesis that significant associations are due to restricted gene flow, and identify patterns of significant association that are due to historical events. In this last case, criteria are given to discriminate among contiguous range expansion, long-distance colonization, and population fragmentation. The ability to make these discriminations depends critically upon an adequate geographical sampling design. These points are illustrated with a worked example: mitochondrial DNA haplotypes in the salamander Ambystoma tigrinum. For this example, prior information exists about restricted gene flow and likely historical events, and the nested cladistic analyses were completely concordant with this prior information. This concordance establishes the plausibility of this nested cladistic approach, but much future work will be necessary to demonstrate robustness and to explore the power and accuracy of this procedure. PMID:7498753

  20. A population analysis of two species of streamside salamanders, genus Desmognathus

    USGS Publications Warehouse

    Hall, R.J.

    1977-01-01

    Desmognathus fuscus and Desmognathus ochrophaeus mere studied over a 6-wk period by mark-recapture and removal methods. Density is ~. 0.8/m2 in D. fuscus and 0.6 - l.l/m2 in D. ochrophaeus; respective biomass densities are 1.5 and 1.0 g/m2. Adjusted estimates indicate a greater proportion of adults in D. ochrophaeus. The observed sex ratio is unbalanced in favor of males but may be close to 1:1 in each species. Adult male age structures based on testis lobes indicate greater adult survivorship in D. ochrophaeus than D. fuscus. Local populations of D. ochrophaeus may differ from others studied in having a shortened larval period. Indirect evidence may indicate greater predation on D. fuscus than on D. ochrophaeus. Fecundity is positively correlated with the size of females in both species and the slopes of the regression lines are similar. Mean egg complements are 21.2 for D. fuscus and 15.6 for D. ochrophaeus. Most observations support the hypothesis that demographic differences are related to differences in degree of terrestrialism between the two species.

  1. Liquid marbles.

    PubMed

    Aussillous, P; Quéré, D

    2001-06-21

    The transport of a small amount of liquid on a solid is not a simple process, owing to the nature of the contact between the two phases. Setting a liquid droplet in motion requires non-negligible forces (because the contact-angle hysteresis generates a force opposing the motion), and often results in the deposition of liquid behind the drop. Different methods of levitation-electrostatic, electromagnetic, acoustic, or even simpler aerodynamic techniques-have been proposed to avoid this wetting problem, but all have proved to be rather cumbersome. Here we propose a simple alternative, which consists of encapsulating an aqueous liquid droplet with a hydrophobic powder. The resulting 'liquid marbles' are found to behave like a soft solid, and show dramatically reduced adhesion to a solid surface. As a result, motion can be generated using gravitational, electrical and magnetic fields. Moreover, because the viscous friction associated with motion is very small, we can achieve quick displacements of the droplets without any leaks. All of these features are of potential benefit in microfluidic applications, and also permit the study of a drop in a non-wetting situation-an issue of renewed interest following the recent achievement of super-hydrophobic substrates. PMID:11418851

  2. Liquid marbles.

    PubMed

    Aussillous, P; Quéré, D

    2001-06-21

    The transport of a small amount of liquid on a solid is not a simple process, owing to the nature of the contact between the two phases. Setting a liquid droplet in motion requires non-negligible forces (because the contact-angle hysteresis generates a force opposing the motion), and often results in the deposition of liquid behind the drop. Different methods of levitation-electrostatic, electromagnetic, acoustic, or even simpler aerodynamic techniques-have been proposed to avoid this wetting problem, but all have proved to be rather cumbersome. Here we propose a simple alternative, which consists of encapsulating an aqueous liquid droplet with a hydrophobic powder. The resulting 'liquid marbles' are found to behave like a soft solid, and show dramatically reduced adhesion to a solid surface. As a result, motion can be generated using gravitational, electrical and magnetic fields. Moreover, because the viscous friction associated with motion is very small, we can achieve quick displacements of the droplets without any leaks. All of these features are of potential benefit in microfluidic applications, and also permit the study of a drop in a non-wetting situation-an issue of renewed interest following the recent achievement of super-hydrophobic substrates.

  3. Northwestern salamanders Ambystoma gracile in mountain lakes: record oviposition depths among salamanders

    USGS Publications Warehouse

    Hoffman, R.; Pearl, C.A.; Larson, G.L.; Samora, B.

    2012-01-01

    Oviposition timing, behaviors, and microhabitats of ambystomatid salamanders vary considerably (Egan and Paton 2004; Figiel and Semlitsch 1995; Howard and Wallace 1985; Mac-Cracken 2007). Regardless of species, however, females typically oviposit using sites conducive to embryo development and survival. For example, the results of an experiment by Figiel and Semlitsch (1995) on Ambystoma opacum (Marbled Salamander) oviposition indicated that females actively selected sites that were under grass clumps in wet versus dry treatments, and surmised that environmental conditions such as humidity, moisture, and temperature contributed to their results. Other factors associated with ambystomatid oviposition and embryo survival include water temperature (Anderson 1972; Brown 1976), dissolved oxygen concentration (Petranka et al. 1982; Sacerdote and King 2009), oviposition depth (Dougherty et al. 2005; Egan and Paton 2004), and oviposition attachment structures such as woody vegetation (McCracken 2007; Nussbaum et al. 1983). Resetarits (1996), in creating a model of oviposition site selection for anuran amphibians, hypothesized that oviparous organisms were also capable of modifying oviposition behavior and site selection to accommodate varying habitat conditions and to minimize potential negative effects of environmental stressors. Kats and Sih (1992), investigating the oviposition of Ambystoma barbouri (Streamside Salamander) in pools of a Kentucky stream, found that females preferred pools without predatory Lepomis cyanellus (Green Sunfish), and that the number of egg masses present in a pool historically containing fish increased significantly the year after fish had been extirpated from the pool. Palen et al. (2005) determined that Ambystoma gracile (Northwestern Salamander) and Ambystoma macrodactylum (Longtoed Salamander) eggs were deposited either at increased depth or in full shaded habitats, respectively, as water transperancy to UV-B radiation increased.

  4. From species divergence to population structure: a multimarker approach on the most basal lineage of Salamandridae, the spectacled salamanders (genus Salamandrina) from Italy.

    PubMed

    Hauswaldt, J Susanne; Angelini, Claudio; Gehara, Marcelo; Benavides, Edgar; Polok, Andy; Steinfartz, Sebastian

    2014-01-01

    The Apennine Peninsula is one of Europe's main glacial refugial areas and harbors a large number of lineages and species. Here, a pattern of higher genetic diversity in the south compared to that of the north is characteristic of most vertebrates; however, most studies that have produced these results have relied only on inferences based on mitochondrial DNA. The spectacled salamanders (genus Salamandrina) are endemic to the Apennine Peninsula and have diverged into two sibling species: S. terdigitata (in the south) and S. perspicillata (in the north), presumably in the late Miocene or early Pliocene. By sequencing one mitochondrial (cytb) and two nuclear genes (RAG1 and POMC) and genotyping 10 microsatellite loci, we traced the evolution of these sibling species from their divergence to their contemporary population structure at a fine scale. Using a multilocus coalescent-based approach, we estimated the temporal divergence of both species at approximately 2.25 mya (million years ago), which, hence, is much younger than previous estimates. The classical pattern of high genetic diversity in the south and lower diversity in the north was confirmed only for some markers, and the demographic histories of the two species differed substantially. Whereas S. perspicillata (north) expanded from a single major refugium in the center of the Apennine Peninsula, populations of S. terdigitata (south) persisted through cooler periods in multiple refugia. Further, the fine-scale population genetic structure of 16 S. perspicillata populations revealed significant genetic differentiation, even across short geographic distances. The results of our study stress that for a better understanding of phylogeographic patterns and past demographic processes, both mitochondrial and multiple nuclear loci should be analyzed to avoid gene-specific, and possibly biased results.

  5. Molecular Phylogeography and Population Genetic Structure of an Endangered Species Pachyhynobius shangchengensis (hynobiid Salamander) in a Fragmented Habitat of Southeastern China

    PubMed Central

    Zhao, Yanyu; Zhang, Yanhua; Li, Xiaochen

    2013-01-01

    The salamander Pachyhynobius shangchengensis (Hynobiidae) is a vulnerable species restricted to a patchy distribution associated with small mountain streams surrounded by forested slopes in the Mount Dabieshan region in southeastern China. However, molecular phylogeography and population genetic structure of P. shangchengensis remain poorly investigated. In this study, we explored the genetic structure and phylogeography of P. shangchengensis based on partial sequences of the mitochondrial DNA (mtDNA) cytochrome b and cytochrome c oxidase subunit I genes. Fifty-one haplotypes and four clades were found among 93 samples. Phylogenetic analyses revealed four deeply divergent and reciprocally monophyletic mtDNA lineages that approximately correspond to four geographic regions separated by complicated topography and long distances. The distinct geographic distributions of all lineages and the estimated divergence time suggest spatial and temporal separation coinciding with climatic changes during the Pleistocene. Analysis of molecular variance indicated that most of the observed genetic variation occurred among the four groups, implying long-term interruption of gene flow, and the possible separation of P. shangchengensis into four management units for conservation. PMID:24205092

  6. Ambystoma maculatum (spotted salamander). Reproduction

    USGS Publications Warehouse

    Glorioso, Brad M.; Waddle, Hardin; Hefner, Jeromi

    2012-01-01

    The Spotted Salamander is a wide-ranging salamander of the eastern United States that typically breeds in winter or early spring in ephemeral pools in lowland forests. Ambystoma maculatum is known to deposit 2-4 egg masses per year, each containing 1-250 eggs. As part of ongoing research into the ecology and reproductive biology of Spotted Salamanders in the Kisatchie District of Kisatchie National Forest in Natchitoches Parish, Louisiana, USA, we have been counting the number of embryos per egg mass. We captured seven female A. maculatum in a small pool, six of which were still gravid. We took standard measurements, including SVL, and then implanted a Passive Integrated Transponder (PIT tag) into each adult female as was the protocol. About an hour after processing these animals we marked new A. maculatum egg masses found in the same small pool using PVC pin flags pushed carefully through the outer jelly. We did not have enough time to process them that evening, and it was not until a few days later that we photographed those masses. We discovered that one of the masses contained a PIT tag in the outer jelly that corresponded to one of the six gravid females that were marked that same evening. To our knowledge, this is the first report of PIT tags being the means, albeit coincidentally, by which a particular egg mass of Ambystoma maculatum has been assigned to a particular female. For our purposes, losing the PIT tag from the adult female is counter to the goals of our study of this population, and we will no longer be implanting PIT tags into gravid females.

  7. Marvelous Marbled Underwater Scenes

    ERIC Educational Resources Information Center

    Walkup, Nancy

    2005-01-01

    In an effort to intrigue her fifth graders with a novel and spontaneous approach to line and movement, Nancy Walkup introduced paper marbling as a means to create remarkable decorative surface designs. To marble paper, some kind of pigment, usually oil or acrylic paint, is floated upon the surface of a liquid such as water or liquid starch. In the…

  8. Effects of urbanization on occupancy of stream salamanders.

    PubMed

    Price, Steven J; Cecala, Kristen K; Browne, Robert A; Dorcas, Michael E

    2011-06-01

    Urban development is the most common form of land conversion in the United States. Using a before-after control-impact study design, we investigated the effects of urbanization on larval and adult stages of southern two-lined salamanders (Eurycea cirrigera) and northern dusky salamanders (Desmognathus fuscus). Over 5 years, we estimated changes in occupancy and probabilities of colonization and survival in 13 stream catchments after urbanization and in 17 catchments that were not urbanized. We also examined effects of proportion of urbanized area in a catchment and distance of the salamander population to the nearest stream on probabilities of colonization and survival. Before urbanization, adult and larval stages of the two salamander species occupied nearly all surveyed streams, with occupancy estimates ranging from 1.0 to 0.78. Four years after urbanization mean occupancy of larval and adult two-lined salamanders had decreased from 0.87 and 0.78 to 0.57 and 0.39, respectively. Estimates of mean occupancy of larval northern dusky salamanders decreased from 1.0 to 0.57 in urban streams 4 years after urbanization; however, adult northern dusky salamander occupancy remained close to 1.0 in urban streams over 5 years. Occupancy estimates in control streams were similar for each species and stage over 5 years. Urbanization was associated with decreases in survival probabilities of adult and larval two-lined salamanders and decreases in colonization probabilities of larval dusky salamanders. Nevertheless, proportion of impervious surface and distance to nearest stream had little effect on probabilities of survival and colonization. Our results imply that in the evaluation of the effects of urbanization on species, such as amphibians, with complex life cycles, consideration of the effects of urbanization on both adult and larval stages is required.

  9. Elasticity of liquid marbles.

    PubMed

    Asare-Asher, Samuel; Connor, Jason N; Sedev, Rossen

    2015-07-01

    Liquid marbles are liquid droplets covered densely with small particles. They exhibit hydrophobic properties even on hydrophilic surfaces and this behaviour is closely related to the Cassie wetting state and the phenomenon of superhydrophobicity. Typical liquid marbles are of millimetre size but their properties are analogous to smaller capsules and droplets of Pickering emulsions. We study water marbles covered with an uneven multilayer of polyethylene particles. Their elastic properties were assessed under quasi-static conditions. The liquid marbles are highly elastic and can sustain a reversible deformation of up to 30%. The spring constant is of the same order of magnitude as that for bare water droplets. Therefore the elasticity of the liquid marble is provided mainly by the liquid menisci between the particles. Upon further compression, the spring constant increases up to the point of breakage. This increase may be due to capillary attraction acting across the emerging cracks in the particle coating. The stress-strain curve for liquid marbles is similar to that obtained with liquid-filled microcapsules. A mechanical scaling description proposed for capsules is qualitatively applicable for liquid marbles. The exact mechanical role of the multilayer particle network remains elusive.

  10. The influence of ecology and genetics on behavioral variation in salamander populations across the Eastern Continental Divide.

    PubMed

    Rissler, Leslie J; Wilbur, Henry M; Taylor, Douglas R

    2004-08-01

    Understanding the unique contributions of ecology and history to the distribution of species within communities requires an integrative approach. The Eastern Continental Divide in southwestern Virginia separates river drainages that differ in species composition: the more aquatic, predatory Desmognathus quadramaculatus is present only in the New River drainage (which drains to the Gulf of Mexico), while Desmognathus monticola is present in both the New River drainage and the James River drainage (which drains to the Atlantic Ocean). We investigated natural distributions, behavioral variation in experimental mesocosms, population genetic, and phylogenetic implications of community structure. The presence of D. quadramaculatus increased the terrestriality of D. monticola in natural and experimental situations but to different degrees in allopatric and sympatric populations. Our ecological data suggest that the degree of terrestriality in D. monticola is a result of a balance between the optimal aquatic habitat and risks of predation. Our genetic analyses suggest that D. monticola has experienced a recent range expansion and has only a recent history of association with D. quadramaculatus in Virginia. This is surprising given the strong behavioral variation that exists in populations experiencing unique community compositions over a scale of meters. This study demonstrates the need to combine both ecology and genetics toward an understanding of the factors affecting species distributions, behavioral variation between populations, and patterns of genetic variation across a landscape. PMID:15278844

  11. Terrestrial salamander abundance on reclaimed mountaintop removal mines

    USGS Publications Warehouse

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Mountaintop removal mining, a large-scale disturbance affecting vegetation, soil structure, and topography, converts landscapes from mature forests to extensive grassland and shrubland habitats. We sampled salamanders using drift-fence arrays and coverboard transects on and near mountaintop removal mines in southern West Virginia, USA, during 2000–2002. We compared terrestrial salamander relative abundance and species richness of un-mined, intact forest with habitats on reclaimed mountaintop removal mines (reclaimed grassland, reclaimed shrubland, and fragmented forest). Salamanders within forests increased in relative abundance with increasing distance from reclaimed mine edge. Reclaimed grassland and shrubland habitats had lower relative abundance and species richness than forests. Characteristics of reclaimed habitats that likely contributed to lower salamander abundance included poor soils (dry, compacted, little organic matter, high rock content), reduced vertical structure of vegetation and little tree cover, and low litter and woody debris cover. Past research has shown that salamander populations reduced by clearcutting may rebound in 15–24 years. Time since disturbance was 7–28 years in reclaimed habitats on our study areas and salamander populations had not reached levels found in adjacent mature forests.

  12. Terrestrial distribution of pond-breeding salamanders around an isolated wetland.

    PubMed

    Scott, David E; Komoroski, Mark J; Croshaw, Dean A; Dixon, Philip M

    2013-11-01

    Terrestrial habitats surrounding isolated wetlands are a critical resource for many pond-breeding amphibian species, yet few studies have examined the terrestrial distribution of post-metamorphic juveniles and adults. We used an encircling drift fence at a breeding pond in conjunction with partial fences at 90, 172, and 332 m from the wetland to estimate the terrestrial distribution of adult marbled salamanders (Ambystoma opacum; four breeding seasons) and mole salamanders (A. talpoideum; two seasons), as well as the dispersion of newly metamorphosed A. opacum (one summer). For newly metamorphosed A. opacum, 79% emigrated < 90 m from the wetland, and 8% moved beyond 172 m; movement distance was unrelated to body size. Distribution of adult A. opacum varied among years, with an average of 28% (range 23-31%) occurring beyond 172 m in all years. Averaged across two years, 51% of adult A. talpoideum occurred beyond 172 m. Lognormal models provided a good fit to both the juvenile and adult ambystomatid distributions, and parameters differed between age classes, sexes, species, and years within species. For adult A. opacum a buffer radius of 300 m or 340 m, depending on the year, is estimated to include 95% of adults; for A. talpoideum the estimate is 464 m or 501 m. A reanalysis of distribution data for seven ambystomatid species shows that a previous estimate of a 164-m radius to protect 95% of a population underestimates the needed buffer radius by 185 m. Because our study wetland requires a nearly 500 m wide radius to protect 95% of its ambystomatid adults, preservation of similar communities may require much more surrounding terrestrial habitat than previously thought. PMID:24400505

  13. 77 FR 36287 - Proposed Low-Effect Habitat Conservation Plan for the California Tiger Salamander, Calaveras...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-06-18

    ... Fish and Wildlife Service Proposed Low-Effect Habitat Conservation Plan for the California Tiger... listed animal, the threatened Central California Distinct Population Segment of the California tiger salamander (tiger salamander). The applicant would implement a conservation program to minimize and...

  14. Habitat relationships of eastern red-backed salamanders (Plethodon cinereus) in Appalachian grazing systems

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Altered microclimates and vegetation structure after timber harvest can result in longterm population declines of some Appalachian salamanders. If changes in forest structure following harvest alter woodland salamander habitat quality, conversion of forests to pastures or meadows is believed to resu...

  15. Effects of predator chemical cues and behavioral biorhythms on foraging activity of terrestrial salamanders.

    PubMed

    Maerz, J C; Panebianco, N L; Madison, D M

    2001-07-01

    Red-backed salamanders, Plethodon cinereus, show a variety of alarm responses to chemical cues from eastern garter snakes, Thamnophis sirtalis. We measured the foraging activity of red-backed salamanders exposed to water soiled by a garter snake (fed P. cinereus) or to unsoiled water. Salamanders exposed to snake-soiled water showed less foraging activity than salamanders exposed to unsoiled water; therefore, predators could have nonlethal effects on salamander populations. Our results also show additional factors influenced salamander foraging activity. Salamander foraging activity and responsiveness to chemical cues do not appear to have been affected by sex or food deprivation. Salamander foraging activity does appear to have been influenced by activity biorhythms. Foraging activity of animals in both treatments showed a bimodal periodicity that is consistent with natural activity patterns controlled by internal biorhythms. Exposure to snake-soiled water significantly reduced foraging activity during periods of peak foraging activity, but had a subtler effect on foraging activity during natural lulls in activity. We suggest that both activity biorhythms and exposure to chemical cues are important factors affecting salamander foraging behavior.

  16. Impact of valley fills on streamside salamanders in southern West Virginia

    USGS Publications Warehouse

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Valley fills associated with mountaintop-removal mining bury stream headwaters and affect water quality and ecological function of reaches below fills. We quantified relative abundance of streamside salamanders in southern West Virginia during 2002 in three streams below valley fills (VFS) and in three reference streams (RS). We surveyed 36 10- × 2-m stream transects, once in summer and fall, paired by order and structure. Of 2,343 salamanders captured, 66.7% were from RS. Total salamanders (adults plus larvae) were more abundant in RS than VFS for first-order and second-order reaches. Adult salamanders had greater abundance in first-order reaches of RS than VFS. Larval salamanders were more abundant in second-order reaches of RS than VFS. No stream width or mesohabitat variables differed between VFS and RS. Only two cover variables differed. Silt cover, greater in VFS than RS first-order reaches, is a likely contributor to reduced abundance of salamanders in VFS. Second-order RS had more boulder cover than second-order VFS, which may have contributed to the higher total and larval salamander abundance in RS. Water chemistry assessments of our VFS and RS reported elevated levels of metal and ion concentrations in VFS, which can depress macroinvertebrate populations and likely affect salamander abundance. Valley fills appear to have significant negative effects on stream salamander abundance due to alterations in habitat structure, water quality and chemistry, and macroinvertebrate communities in streams below fills.

  17. From lamprey to salamander: an exploratory modeling study on the architecture of the spinal locomotor networks in the salamander.

    PubMed

    Bicanski, Andrej; Ryczko, Dimitri; Cabelguen, Jean-Marie; Ijspeert, Auke Jan

    2013-10-01

    The evolutionary transition from water to land required new locomotor modes and corresponding adjustments of the spinal "central pattern generators" for locomotion. Salamanders resemble the first terrestrial tetrapods and represent a key animal for the study of these changes. Based on recent physiological data from salamanders, and previous work on the swimming, limbless lamprey, we present a model of the basic oscillatory network in the salamander spinal cord, the spinal segment. Model neurons are of the Hodgkin-Huxley type. Spinal hemisegments contain sparsely connected excitatory and inhibitory neuron populations, and are coupled to a contralateral hemisegment. The model yields a large range of experimental findings, especially the NMDA-induced oscillations observed in isolated axial hemisegments and segments of the salamander Pleurodeles waltlii. The model reproduces most of the effects of the blockade of AMPA synapses, glycinergic synapses, calcium-activated potassium current, persistent sodium current, and [Formula: see text]-current. Driving segments with a population of brainstem neurons yields fast oscillations in the in vivo swimming frequency range. A minimal modification to the conductances involved in burst-termination yields the slower stepping frequency range. Slow oscillators can impose their frequency on fast oscillators, as is likely the case during gait transitions from swimming to stepping. Our study shows that a lamprey-like network can potentially serve as a building block of axial and limb oscillators for swimming and stepping in salamanders.

  18. Deterioration of marble structures

    SciTech Connect

    Cheng, R.J.; Hwu, H.R.; Kim, J.T.; Leu, S.M.

    1987-01-15

    The accelerated destruction of marble objects has focused attention on how the damage occurs and on the role of acid rain. Roger Cheng of the State University of New York and colleagues at the Johns Hopkins University describe their efforts to elucidate the process.

  19. Marbling on a Budget.

    ERIC Educational Resources Information Center

    Gruber, Donald

    2001-01-01

    Provides historical information on the art technique called marbling. Includes floating paints on water and transferring the patterns formed in the water to paper. Discusses how teachers can teach this technique with materials that fit their budgets. Describes the process in detail. (CMK)

  20. Plethodon cinereus (Redback Salamander) predation

    USGS Publications Warehouse

    Jung, R.E.; Ward, W.L.; Kings, C.O.; Weir, L.A.

    2000-01-01

    In 1999 at the Patuxent Research Refuge, we observed a large rove beetle (Staphylinus maculosus) consuming an eviscerated redback salamander (Plethodon cinereus) underneath a coverboard. Rove beetles typically eat invertebrates.

  1. Ecological separation in a polymorphic terrestrial salamander.

    PubMed

    Anthony, Carl D; Venesky, Matthew D; Hickerson, Cari-Ann M

    2008-07-01

    1. When studying speciation, researchers commonly examine reproductive isolation in recently diverged populations. Polymorphic species provide an opportunity to examine the role of reproductive isolation in populations that may be in the process of divergence. 2. We examined a polymorphic population of Plethodon cinereus (red-backed salamanders) for evidence of sympatric ecological separation by colour morphology. Recent studies have correlated temperature and climate with colour morphology in this species, but no studies have looked at differences in diet or mate choice between colour morphs. We used artificial cover objects to assess salamander diet, mating preference and surface activity over a 2-year period at a field site in north-eastern Ohio. 3. We detected differences in diet between two colour morphs, striped and unstriped. The diets of striped individuals were significantly more diverse and were made up of more profitable prey than the diets of unstriped salamanders. 4. Opposite sex pairs were made up of individuals of the same colour morph and striped males were found more often with larger females than were unstriped males. 5. We corroborate findings of earlier studies suggesting that the unstriped form is adapted to warmer conditions. Unstriped individuals were the first to withdraw from the forest floor as temperatures fell in the late fall. We found no evidence that the colour morphs responded differently to abiotic factors such as soil moisture and relative humidity, and responses to surface temperatures were also equivocal. 6. We conclude that the two colour morphs exhibit some degree of ecological separation and tend to mate assortatively, but are unlikely to be undergoing divergence given the observed frequency of intermorph pairings.

  2. SPATIALLY AUTOCORRELATED DEMOGRAPHY AND INTERPOND MIGRATION IN THE CALIFORNIA TIGER SALAMANDER (AMBYSTOME CALIFORNIENSE)

    EPA Science Inventory

    We investigated the metapopulation structure of the California tiger salamander (Ambystoma californiense) using a combination of indirect and direct methods to evaluate two key requirements of modern metapopulation models: 1) that patches support somewhat independent populations ...

  3. Landmark learning by juvenile salamanders (Ambystoma maculatum).

    PubMed

    Heuring, Whitney L; Mathis, Alicia

    2014-10-01

    Learning to use a landmark as a beacon to locate resources is one of the simplest forms of spatial learning. We tested whether landmark learning occurs in a semifossorial salamander that migrates annually to breeding ponds as adults. Juvenile spotted salamanders (Ambystoma maculatum) were tested in square containers with a plastic feeding dish in each corner, and a piece of earthworm was placed in one randomly-chosen dish. For landmark-trained salamanders, a rock was placed beside the dish containing the prey. For control salamanders, the rock was placed beside a randomly selected feeding dish. Each salamander was trained once every 2 days for 30 days. Significantly more landmark-trained salamanders than control salamanders entered the landmark area first, and landmark-trained individuals had faster latencies to enter the landmark area and longer stay-times. These results suggest that spotted salamanders are able to locate resources by associating their positions with landmarks.

  4. Landmark learning by juvenile salamanders (Ambystoma maculatum).

    PubMed

    Heuring, Whitney L; Mathis, Alicia

    2014-10-01

    Learning to use a landmark as a beacon to locate resources is one of the simplest forms of spatial learning. We tested whether landmark learning occurs in a semifossorial salamander that migrates annually to breeding ponds as adults. Juvenile spotted salamanders (Ambystoma maculatum) were tested in square containers with a plastic feeding dish in each corner, and a piece of earthworm was placed in one randomly-chosen dish. For landmark-trained salamanders, a rock was placed beside the dish containing the prey. For control salamanders, the rock was placed beside a randomly selected feeding dish. Each salamander was trained once every 2 days for 30 days. Significantly more landmark-trained salamanders than control salamanders entered the landmark area first, and landmark-trained individuals had faster latencies to enter the landmark area and longer stay-times. These results suggest that spotted salamanders are able to locate resources by associating their positions with landmarks. PMID:25444775

  5. Evaluation of terrestrial and streamside salamander monitoring techniques at Shenandoah National Park

    USGS Publications Warehouse

    Jung, R.E.; Droege, S.; Sauer, J.R.; Landy, R.B.

    2000-01-01

    In response to concerns about amphibian declines, a study evaluating and validating amphibian monitoring techniques was initiated in Shenandoah and Big Bend National Parks in the spring of 1998. We evaluate precision, bias, and efficiency of several sampling methods for terrestrial and streamside salamanders in Shenandoah National Park and assess salamander abundance in relation to environmental variables, notably soil and water pH. Terrestrial salamanders, primarily redback salamanders (Plethodon cinereus), were sampled by searching under cover objects during the day in square plots (10 to 35 m2). We compared population indices (mean daily and total counts) with adjusted population estimates from capture-recapture. Analyses suggested that the proportion of salamanders detected (p) during sampling varied among plots, necessitating the use of adjusted population estimates. However, adjusted population estimates were less precise than population indices, and may not be efficient in relating salamander populations to environmental variables. In future sampling, strategic use of capture-recapture to verify consistency of p's among sites may be a reasonable compromise between the possibility of bias in estimation of population size and deficiencies due to inefficiency associated with the estimation of p. The streamside two-lined salamander (Eurycea bislineata) was surveyed using four methods: leaf litter refugia bags, 1 m2 quadrats, 50 x 1 m visual encounter transects, and electric shocking. Comparison of survey methods at nine streams revealed congruent patterns of abundance among sites, suggesting that relative bias among the methods is similar, and that choice of survey method should be based on precision and logistical efficiency. Redback and two-lined salamander abundance were not significantly related to soil or water pH, respectively.

  6. Interpretation of elasticity of liquid marbles.

    PubMed

    Whyman, Gene; Bormashenko, Edward

    2015-11-01

    Liquid marbles are non-stick droplets covered with micro-scaled particles. Liquid marbles demonstrate quasi-elastic properties when pressed. The interpretation of the phenomenon of elasticity of liquid marbles is proposed. The model considering the growth in the marble surface in the course of deformation under the conservation of marble's volume explains semi-quantitatively the elastic properties of marbles in satisfactory agreement with the reported experimental data. The estimation of the effective Young modulus of marbles and its dependence on the marble volume are reported.

  7. The Blue Marble

    NASA Technical Reports Server (NTRS)

    2002-01-01

    This spectacular Moderate Resolution Imaging Spectroradiometer (MODIS) 'blue marble' image is based on the most detailed collection of true-color imagery of the entire Earth to date. Using a collection of satellite-based observations, scientists and visualizers stitched together months of observations of the land surface, oceans, sea ice, and clouds into a seamless, true-color mosaic of every square kilometer (.386 square mile) of our planet. Most of the information contained in this image came from MODIS, illustrating MODIS' outstanding capacity to act as an integrated tool for observing a variety of terrestrial, oceanic, and atmospheric features of the Earth. The land and coastal ocean portions of this image is based on surface observations collected from June through September 2001 and combined, or composited, every eight days to compensate for clouds that might block the satellite's view on any single day. Global ocean color (or chlorophyll) data was used to simulate the ocean surface. MODIS doesn't measure 3-D features of the Earth, so the surface observations were draped over topographic data provided by the U.S. Geological Survey EROS Data Center. MODIS observations of polar sea ice were combined with observations of Antarctica made by the National Oceanic and Atmospheric Administration's AVHRR sensor-the Advanced Very High Resolution Radiometer. The cloud image is a composite of two days of MODIS imagery collected in visible light wavelengths and a third day of thermal infra-red imagery over the poles. A large collection of imagery based on the blue marble in a variety of sizes and formats, including animations and the full (1 km) resolution imagery, is available at the Blue Marble page. Image by Reto Stockli, Render by Robert Simmon. Based on data from the MODIS Science Team

  8. Apparent survival of the salamander Salamandra salamandra is low because of high migratory activity

    PubMed Central

    Schmidt, Benedikt R; Schaub, Michael; Steinfartz, Sebastian

    2007-01-01

    Background Understanding the demographic processes underlying population dynamics is a central theme in ecology. Populations decline if losses from the population (i.e., mortality and emigration) exceed gains (i.e., recruitment and immigration). Amphibians are thought to exhibit little movement even though local populations often fluctuate dramatically and are likely to go exinct if there is no rescue effect through immigration from nearby populations. Terrestrial salamanders are generally portrayed as amphibians with low migratory activity. Our study uses demographic analysis as a key to unravel whether emigration or mortality is the main cause of "losses" from the population. In particular, we use the analysis to challenge the common belief that terrestrial salamanders show low migratory activity. Results The mark-recapture analysis of adult salamanders showed that monthly survival was high (> 90%) without a seasonal pattern. These estimates, however, translate into rather low rates of local annual survival of only ~40% and suggest that emigration was important. The estimated probability of emigration was 49%. Conclusion Our analysis shows that terrestrial salamanders exhibit more migratory activity than commonly thought. This may be due either because the spatial extent of salamander populations is underestimated or because there is a substantial exchange of individuals between populations. Our current results are in line with several other studies that suggest high migratory activity in amphibians. In particular, many amphibian populations may be characterized by high proportions of transients and/or floaters. PMID:17803829

  9. Intracellular invasion of green algae in a salamander host

    PubMed Central

    Kerney, Ryan; Kim, Eunsoo; Hangarter, Roger P.; Heiss, Aaron A.; Bishop, Cory D.; Hall, Brian K.

    2011-01-01

    The association between embryos of the spotted salamander (Ambystoma maculatum) and green algae (“Oophila amblystomatis” Lamber ex Printz) has been considered an ectosymbiotic mutualism. We show here, however, that this symbiosis is more intimate than previously reported. A combination of imaging and algal 18S rDNA amplification reveals algal invasion of embryonic salamander tissues and cells during development. Algal cells are detectable from embryonic and larval Stages 26–44 through chlorophyll autofluorescence and algal 18S rDNA amplification. Algal cell ultrastructure indicates both degradation and putative encystment during the process of tissue and cellular invasion. Fewer algal cells were detected in later-stage larvae through FISH, suggesting that the decline in autofluorescent cells is primarily due to algal cell death within the host. However, early embryonic egg capsules also contained encysted algal cells on the inner capsule wall, and algal 18S rDNA was amplified from adult reproductive tracts, consistent with oviductal transmission of algae from one salamander generation to the next. The invasion of algae into salamander host tissues and cells represents a unique association between a vertebrate and a eukaryotic alga, with implications for research into cell–cell recognition, possible exchange of metabolites or DNA, and potential congruence between host and symbiont population structures. PMID:21464324

  10. Cannibalistic-morph Tiger Salamanders in unexpected ecological contexts

    USGS Publications Warehouse

    McLean, Kyle I.; Stockwell, Craig A.; Mushet, David M.

    2016-01-01

    Barred tiger salamanders [Ambystoma mavortium (Baird, 1850)] exhibit two trophic morphologies; a typical and a cannibalistic morph. Cannibalistic morphs, distinguished by enlarged vomerine teeth, wide heads, slender bodies, and cannibalistic tendencies, are often found where conspecifics occur at high density. During 2012 and 2013, 162 North Dakota wetlands and lakes were sampled for salamanders. Fifty-one contained A. mavortium populations; four of these contained cannibalistic morph individuals. Two populations with cannibalistic morphs occurred at sites with high abundances of conspecifics. However, the other two populations occurred at sites with unexpectedly low conspecific but high fathead minnow [Pimephales promelas (Rafinesque, 1820)] abundances. Further, no typical morphs were observed in either of these later two populations, contrasting with earlier research suggesting cannibalistic morphs only occur at low frequencies in salamander populations. Another anomaly of all four populations was the occurrence of cannibalistic morphs in permanent water sites, suggesting their presence was due to factors other than faster growth allowing them to occupy ephemeral habitats. Therefore, our findings suggest environmental factors inducing the cannibalistic morphism may be more complex than previously thought.

  11. 'Salamander plague' on Britain's doorstep.

    PubMed

    Mills, Georgina

    2015-01-24

    Chytridiomycosis can cause mass declines in amphibians, and the chytrid fungus Batrachochytrium dendrobatidis is the classic cause of this disease. However, recently, a second strain of chytrid fungus has emerged in Europe, resulting in major declines in fire salamanders. The Zoological Society of London (ZSL) discussed this, and the implications for the UK, at a meeting in December in London. Georgina Mills reports.

  12. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander

    PubMed Central

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M.; Willard, Scott T.; Kouba, Andrew J.

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration. PMID:27258650

  13. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander.

    PubMed

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M; Willard, Scott T; Kouba, Andrew J

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration. PMID:27258650

  14. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander.

    PubMed

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M; Willard, Scott T; Kouba, Andrew J

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration.

  15. Portugues Marbles as Stone Heritage

    NASA Astrophysics Data System (ADS)

    Lopes, Luis; Martins, Ruben

    2013-04-01

    The main objective of this paper is to present and justify the reasons for the worldwide recognition of Portuguese Marbles as Stone Heritage. These marbles are also known as "Estremoz Marble" since was the first county were exploited. In the Estremoz Anticline marbles occupy an intermediate stratigraphic position being part of a volcano-sedimentary sequence of Cambrian age. The anticlinal structure has a Precambrian core and the younger rocks aged Devonian Period. This sequence has deformed by the Variscan Orogeny, which performed twice with different intensities both in ductile and brittle tension fields. The early Alpine Cycle also acts in the region and cause more fracturing of the marble. Practically in all the quarries is possible to perceive the spatial-temporal continuity of the deformation where one can describe a complete Wilson Cycle. Together all these geological features imprint the marbles beautiful aesthetic patterns that can be highlighted when used as dimension stone. Nowadays most of the quarries are placed in the counties of Borba and mainly in Vila Viçosa. This last city claims for itself the "Capital of the Marble" title and named the marble as "White Gold". In fact, according to the historical record, the marbles were quarried in Portuguese Alentejo's Province since the fourth century BC. Locally these geological materials are available easily accessible. Exhibit physical properties that allow the fabrication of structural and decorative elements and so were used since humans settled in the region and developed a structured Society. In the Roman period, the pieces of art made with Estremoz Marbles were exported abroad and today are represented in Museums and Archaeological Sites throughout Europe and North Africa countries. The Portuguese Marbles and Limestones, transformed into altars, stairways, columns, statues and pieces of wall cladding, were carried as ballast in the holds of ships. At the destination the Portuguese People had built

  16. Climate change and shrinking salamanders: alternative mechanisms for changes in plethodontid salamander body size.

    PubMed

    Connette, Grant M; Crawford, John A; Peterman, William E

    2015-08-01

    An increasing number of studies have demonstrated relationships between climate trends and body size change of organisms. In many cases, climate might be expected to influence body size by altering thermoregulation, energetics or food availability. However, observed body size change can result from a variety of ecological processes (e.g. growth, selection, population dynamics) or imperfect observation of biological systems. We used two extensive datasets to evaluate alternative mechanisms for recently reported changes in the observed body size of plethodontid salamanders. We found that mean adult body size of salamanders can be highly sensitive to survey conditions, particularly rainfall. This systematic bias in the detection of larger or smaller individuals could result in a signature of body size change in relation to reported climate trends when it is simply observation error. We also identify considerable variability in body size distributions among years and find that individual growth rates can be strongly influenced by weather. Finally, our study demonstrates that measures of mean adult body size can be highly variable among surveys and that large sample sizes may be required to make reliable inferences. Identifying the effects of climate change is a critical area of research in ecology and conservation. Researchers should be aware that observed changes in certain organisms can result from multiple ecological processes or systematic bias due to nonrandom sampling of populations.

  17. Climate change and shrinking salamanders: alternative mechanisms for changes in plethodontid salamander body size.

    PubMed

    Connette, Grant M; Crawford, John A; Peterman, William E

    2015-08-01

    An increasing number of studies have demonstrated relationships between climate trends and body size change of organisms. In many cases, climate might be expected to influence body size by altering thermoregulation, energetics or food availability. However, observed body size change can result from a variety of ecological processes (e.g. growth, selection, population dynamics) or imperfect observation of biological systems. We used two extensive datasets to evaluate alternative mechanisms for recently reported changes in the observed body size of plethodontid salamanders. We found that mean adult body size of salamanders can be highly sensitive to survey conditions, particularly rainfall. This systematic bias in the detection of larger or smaller individuals could result in a signature of body size change in relation to reported climate trends when it is simply observation error. We also identify considerable variability in body size distributions among years and find that individual growth rates can be strongly influenced by weather. Finally, our study demonstrates that measures of mean adult body size can be highly variable among surveys and that large sample sizes may be required to make reliable inferences. Identifying the effects of climate change is a critical area of research in ecology and conservation. Researchers should be aware that observed changes in certain organisms can result from multiple ecological processes or systematic bias due to nonrandom sampling of populations. PMID:25641384

  18. 'Salamander plague' on Britain's doorstep.

    PubMed

    Mills, Georgina

    2015-01-24

    Chytridiomycosis can cause mass declines in amphibians, and the chytrid fungus Batrachochytrium dendrobatidis is the classic cause of this disease. However, recently, a second strain of chytrid fungus has emerged in Europe, resulting in major declines in fire salamanders. The Zoological Society of London (ZSL) discussed this, and the implications for the UK, at a meeting in December in London. Georgina Mills reports. PMID:25614547

  19. Subcritical crack growth in marble

    NASA Astrophysics Data System (ADS)

    Nara, Yoshitaka; Nishida, Yuki; Toshinori, Ii; Harui, Tomoki; Tanaka, Mayu; Kashiwaya, Koki

    2016-04-01

    It is essential to study time-dependent deformation and fracturing in various rock materials to prevent natural hazards related to the failure of a rock mass. In addition, information of time-dependent fracturing is essential to ensure the long-term stability of a rock mass surrounding various structures. Subcritical crack growth is one of the main causes of time-dependent fracturing in rock. It is known that subcritical crack growth is influenced by not only stress but also surrounding environment. Studies of subcritical crack growth have been widely conducted for silicate rocks such as igneous rocks and sandstones. By contrast, information of subcritical crack growth in carbonate rocks is not enough. Specifically, influence of surrounding environment on subcritical crack growth in carbonate rock should be clarified to ensure the long-term stability of a rock mass. In this study, subcritical crack growth in marble was investigated. Especially, the influence of the temperature, relative humidity and water on subcritical crack growth in marble is investigated. As rock samples, marbles obtained in Skopje-City in Macedonia and Carrara-City in Italy were used. To measure subcritical crack growth, we used the load relaxation method of the double-torsion (DT) test. All measurements by DT test were conducted under controlled temperature and relative humidity. For both marbles, it was shown that the crack velocity in marble in air increased with increasing relative humidity at a constant temperature. Additionally, the crack velocity in water was much higher than that in air. It was also found that the crack velocity increased with increasing temperature. It is considered that temperature and water have significant influences on subcritical crack growth in marble. For Carrara marble in air, it was recognized that the value of subcritical crack growth index became low when the crack velocity was higher than 10-4 m/s. This is similar to Region II of subcritical crack growth

  20. Marble Cake Perspectives

    NASA Astrophysics Data System (ADS)

    Langmuir, C. H.

    2007-12-01

    Since the original suggestions by Hanson (Geol. Soc. London, 1977) and Allegre and Turcotte (Nature, 1986), the concept of a "veined" or "marble cake" mantle has gained wide acceptance as a paradigm for mantle composition and components. The "veined mantle" was conceived thinking of the mantle as an ultramafic migmatite with many types of veins, but emphasized metasomatic components contained in hydrous phases as an explanation for alkali basalts. The "marble cake" mantle emphasized recycled oceanic lithosphere. Both types of veins are inevitable consequences of mantle convection. Oceanic lithosphere is recycled and stretched; low melting components of the mantle are inevitably melted in ascending mantle flow, even beneath thick lithsosphere. Both vein types have been widely invoked to explain incompatible element enriched basalts from the mantle. Most recently, disequilibrium melting of veined mantle sources by various mechanisms have become a popular suggestion to explain diverse aspects of mantle geochemistry (e.g. Sobolev et al., Nature, 2005; Phipps Morgan et al., EPSL, 1999). The physical mechanisms that would allow disequilibrium melting of fine scale veins, however, remain to be demonstrated. Average upper mantle composition is residual to continents and requires removal of low F melts to generate the depleted MORB source, and enrichment by low F melts to create the enriched source. Such a process is also necessary in the Sobolev et al model for Hawaii, which generates the equivalent of a low F melt by two stages of larger degree melting. Enriched sources are not restricted to ocean islands, and the name "OIB source" is a misnomer. Enriched basalts occur on normal ridges, in back-arc basins, behind subduction zones, in continental rifts and in isolated volcanic cones. Most of these are not mantle plumes. Enriched components have been ascribed to recycled ocean lithosphere, but recycled ocean crust is depleted, not enriched. Therefore the isotopic signature

  1. Earliest known crown-group salamanders.

    PubMed

    Gao, Ke-Qin; Shubin, Neil H

    2003-03-27

    Salamanders are a model system for studying the rates and patterns of the evolution of new anatomical structures. Recent discoveries of abundant Late Jurassic and Early Cretaceous salamanders are helping to address these issues. Here we report the discovery of well-preserved Middle Jurassic salamanders from China, which constitutes the earliest known record of crown-group urodeles (living salamanders and their closest relatives). The new specimens are from the volcanic deposits of the Jiulongshan Formation (Bathonian), Inner Mongolia, China, and represent basal members of the Cryptobranchidae, a family that includes the endangered Asian giant salamander (Andrias) and the North American hellbender (Cryptobranchus). These fossils document a Mesozoic record of the Cryptobranchidae, predating the previous record of the group by some 100 million years. This discovery provides evidence to support the hypothesis that the divergence of the Cryptobranchidae from the Hynobiidae had taken place in Asia before the Middle Jurassic period.

  2. Earliest known crown-group salamanders.

    PubMed

    Gao, Ke-Qin; Shubin, Neil H

    2003-03-27

    Salamanders are a model system for studying the rates and patterns of the evolution of new anatomical structures. Recent discoveries of abundant Late Jurassic and Early Cretaceous salamanders are helping to address these issues. Here we report the discovery of well-preserved Middle Jurassic salamanders from China, which constitutes the earliest known record of crown-group urodeles (living salamanders and their closest relatives). The new specimens are from the volcanic deposits of the Jiulongshan Formation (Bathonian), Inner Mongolia, China, and represent basal members of the Cryptobranchidae, a family that includes the endangered Asian giant salamander (Andrias) and the North American hellbender (Cryptobranchus). These fossils document a Mesozoic record of the Cryptobranchidae, predating the previous record of the group by some 100 million years. This discovery provides evidence to support the hypothesis that the divergence of the Cryptobranchidae from the Hynobiidae had taken place in Asia before the Middle Jurassic period. PMID:12660782

  3. Hybrid vigor between native and introduced salamanders raises new challenges for conservation

    PubMed Central

    Fitzpatrick, Benjamin M.; Shaffer, H. Bradley

    2007-01-01

    Hybridization between differentiated lineages can have many different consequences depending on fitness variation among hybrid offspring. When introduced organisms hybridize with natives, the ensuing evolutionary dynamics may substantially complicate conservation decisions. Understanding the fitness consequences of hybridization is an important first step in predicting its evolutionary outcome and conservation impact. Here, we measured natural selection caused by differential viability of hybrid larvae in wild populations where native California Tiger Salamanders (Ambystoma californiense) and introduced Barred Tiger Salamanders (Ambystoma tigrinum mavortium) have been hybridizing for 50–60 years. We found strong evidence of hybrid vigor; mixed-ancestry genotypes had higher survival rates than genotypes containing mostly native or mostly introduced alleles. Hybrid vigor may be caused by heterozygote advantage (overdominance) or recombinant hybrid vigor (due to epistasis or complementation). These genetic mechanisms are not mutually exclusive, and we find statistical support for both overdominant and recombinant contributions to hybrid vigor in larval tiger salamanders. Because recombinant homozygous genotypes can breed true, a single highly fit genotype with a mosaic of native and introduced alleles may eventually replace the historically pure California Tiger Salamander (listed as Threatened under the U.S. Endangered Species Act). The management implications of this outcome are complex: Genetically pure populations may not persist into the future, but average fitness and population viability of admixed California Tiger Salamanders may be enhanced. The ecological consequences for other native species are unknown. PMID:17884982

  4. The Tower and Glass Marbles Problem

    ERIC Educational Resources Information Center

    Denman, Richard T.; Hailey, David; Rothenberg, Michael

    2010-01-01

    The Catseye Marble company tests the strength of its marbles by dropping them from various levels of their office tower, to find the highest floor from which a marble will not break. We find the smallest number of drops required and from which floor each drop should be made. We also find out how these answers change if a restriction is placed on…

  5. Phylogeography and genetic identification of the newly-discovered populations of torrent salamanders (Rhyacotriton cascade and R. variegatus) in the central Cascades (USA)

    USGS Publications Warehouse

    Wagner, R.S.; Miller, Mark P.; Haig, Susan M.

    2006-01-01

    Newly discovered populations of Rhyacotritonidae were investigated for taxonomic identity, hybridization, and sympatry. Species in the genus Rhyacotriton have been historically difficult to identify using morphological characters. Mitochondrial (mtDNA) 16S ribosomal RNA sequences (491 bp) and allozymes (6 loci) were used to identify the distribution of populations occurring intermediate between the previously described ranges of R. variegatus and R. cascadae in the central Cascade Mountain region of Oregon. Allozyme and mitochondrial sequence data both indicated the presence of two distinct evolutionary lineages, with each lineage corresponding to the allopatric distribution of R. cascadae and R. variegatus. Results suggest the Willamette River acts as a phylogeographic barrier limiting the distribution of both species, although we cannot exclude the possibility that reproductive isolation also exists that reinforces species' distributions. This study extends the previously described geographical ranges of both R. cascadae and R. variegatus and defines an eastern range limit for R. variegatus conservation efforts.

  6. Life history as a predictor of salamander recovery rate from timber harvest in southern appalachian forests, USA.

    PubMed

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Forest management often represents a balance between social, economic, and ecological objectives. In the eastern United States, numerous studies have established that terrestrial salamander populations initially decline in abundance following timber harvest, yet the large-scale and long-term consequences are relatively unknown. We used count data from terrestrial survey points to examine the relation between salamander abundance and historic timber harvest while accounting for imperfect detection of individuals. Overall, stream- and terrestrial-breeding salamanders appeared to differ by magnitude of population decline, rate of population recovery, and extent of recolonization from surrounding forest. Specifically, estimated abundance of both species groups was positively associated with stand age and recovery rates were predicted to increase over time for red-legged salamanders (Plethodon shermani) and decrease in stream-breeding species. Abundance of stream-breeding salamanders was predicted to reach a peak by 100 years after timber harvest, and the population growth rate of red-legged salamanders was predicted to undergo a significant increase 100 years after harvest. Estimated abundance of stream-breeding salamanders in young forest stands was also negatively associated with the distance to adjacent forest, a result that suggests immigration has a role in the recovery of these species. Our results indicate that salamander abundance in young forest stands may be only modestly lower than in more mature forest but that full recovery from timber harvest may take a substantial amount of time and that species life history may affect patterns of recovery. Historia de Vida como un Vaticinador de la Tasa de Recuperación de una Salamandra a la Colecta de Madera en los Bosques del Sur de los Apalaches, E.U.A.

  7. Detection of an enigmatic plethodontid Salamander using Environmental DNA

    USGS Publications Warehouse

    Pierson, Todd W.; Mckee, Anna; Spear, Stephen F.; Maerz, John C.; Camp, Carlos D.; Glenn, Travis C.

    2016-01-01

    The isolation and identification of environmental DNA (eDNA) offers a non-invasive and efficient method for the detection of rare and secretive aquatic wildlife, and it is being widely integrated into inventory and monitoring efforts. The Patch-Nosed Salamander (Urspelerpes brucei) is a tiny, recently discovered species of plethodontid salamander known only from headwater streams in a small region of Georgia and South Carolina. Here, we present results of a quantitative PCR-based eDNA assay capable of detecting Urspelerpes in more than 75% of 33 samples from five confirmed streams. We deployed the method at 31 additional streams and located three previously undocumented populations of Urspelerpes. We compare the results of our eDNA assay with our attempt to use aquatic leaf litterbags for the rapid detection of Urspelerpes and demonstrate the relative efficacy of the eDNA assay. We suggest that eDNA offers great potential for use in detecting other aquatic and semi-aquatic plethodontid salamanders.

  8. Extreme morphological and ecological homoplasy in tropical salamanders

    PubMed Central

    Parra-Olea, Gabriela; Wake, David B.

    2001-01-01

    Fossorial salamanders typically have elongate and attenuated heads and bodies, diminutive limbs, hands and feet, and extremely elongate tails. Batrachoseps from California, Lineatriton from eastern México, and Oedipina from southern México to Ecuador, all members of the family Plethodontidae, tribe Bolitoglossini, resemble one another in external morphology, which has evolved independently. Whereas Oedipina and Batrachoseps are elongate because there are more trunk vertebrae, a widespread homoplasy (parallelism) in salamanders, the genus Lineatriton is unique in having evolved convergently by an alternate “giraffe-neck” developmental program. Lineatriton has the same number of trunk vertebrae as related, nonelongated taxa, but individual trunk vertebrae are elongated. A robust phylogenetic hypothesis, based on sequences of three mtDNA genes, finds Lineatriton to be deeply nested within a clade characterized by generalized ecology and morphology. Lineatriton lineolus, the only currently recognized taxon in the genus, shows unanticipated genetic diversity. Surprisingly, geographically separated populations of L. lineolus are not monophyletic, but are sister taxa of different species of the morphologically generalized genus Pseudoeurycea. Lineatriton, long thought to be a unique monospecific lineage, is polyphyletic. Accordingly, the specialized morphology of Lineatriton displays homoplasy at two hierarchical levels: (i) with respect to other elongate lineages in the family (convergence), and (ii) within what is currently recognized as a single taxon (parallelism). These evolutionary events are of adaptive significance because to invade the lowland tropics salamanders must be either arboreal or fossorial; the repeated evolution of elongation and attenuation has led to multiple lowland invasions. PMID:11427707

  9. Late Jurassic salamanders from northern China.

    PubMed

    Gao, K Q; Shubin, N H

    2001-03-29

    With ten extant families, salamanders (urodeles) are one of the three major groups of modern amphibians (lissamphibians). Extant salamanders are often used as a model system to assess fundamental issues of developmental, morphological and biogeographical evolution. Unfortunately, our understanding of these issues has been hampered by the paucity of fossil evidence available to assess the early history of the group. Here we report the discovery of an extraordinary sample of salamander fossils, some with rare soft-tissue impressions, from the Upper Jurassic of China. With over 500 articulated specimens, this assemblage documents the morphological diversity of early urodeles and includes larvae and adults of both neotenic and metamorphosed taxa. Phylogenetic analysis confirms that these salamanders are primitive, and reveals that all basal salamander clades have Asian distributions. This is compelling evidence for an Asian origin of Recent salamanders, as well as for an extensive and early radiation of several major lineages. These discoveries show that the evolution of salamanders has involved phylogenetic and ecological diversification around a body plan that has remained fundamentally stable for over 150 million years. PMID:11279493

  10. Late Jurassic salamanders from northern China.

    PubMed

    Gao, K Q; Shubin, N H

    2001-03-29

    With ten extant families, salamanders (urodeles) are one of the three major groups of modern amphibians (lissamphibians). Extant salamanders are often used as a model system to assess fundamental issues of developmental, morphological and biogeographical evolution. Unfortunately, our understanding of these issues has been hampered by the paucity of fossil evidence available to assess the early history of the group. Here we report the discovery of an extraordinary sample of salamander fossils, some with rare soft-tissue impressions, from the Upper Jurassic of China. With over 500 articulated specimens, this assemblage documents the morphological diversity of early urodeles and includes larvae and adults of both neotenic and metamorphosed taxa. Phylogenetic analysis confirms that these salamanders are primitive, and reveals that all basal salamander clades have Asian distributions. This is compelling evidence for an Asian origin of Recent salamanders, as well as for an extensive and early radiation of several major lineages. These discoveries show that the evolution of salamanders has involved phylogenetic and ecological diversification around a body plan that has remained fundamentally stable for over 150 million years.

  11. Stream water temperature limits occupancy of salamanders in mid-Atlantic protected areas

    USGS Publications Warehouse

    Grant, Evan H. Campbell; Wiewel, Amber N. M.; Rice, Karen C.

    2014-01-01

    Stream ecosystems are particularly sensitive to urbanization, and tolerance of water-quality parameters is likely important to population persistence of stream salamanders. Forecasted climate and landscape changes may lead to significant changes in stream flow, chemical composition, and temperatures in coming decades. Protected areas where landscape alterations are minimized will therefore become increasingly important for salamander populations. We surveyed 29 streams at three national parks in the highly urbanized greater metropolitan area of Washington, DC. We investigated relationships among water-quality variables and occupancy of three species of stream salamanders (Desmognathus fuscus, Eurycea bislineata, and Pseudotriton ruber). With the use of a set of site-occupancy models, and accounting for imperfect detection, we found that stream-water temperature limits salamander occupancy. There was substantial uncertainty about the effects of the other water-quality variables, although both specific conductance (SC) and pH were included in competitive models. Our estimates of occupancy suggest that temperature, SC, and pH have some importance in structuring stream salamander distribution.

  12. Wildlife disease. Recent introduction of a chytrid fungus endangers Western Palearctic salamanders.

    PubMed

    Martel, A; Blooi, M; Adriaensen, C; Van Rooij, P; Beukema, W; Fisher, M C; Farrer, R A; Schmidt, B R; Tobler, U; Goka, K; Lips, K R; Muletz, C; Zamudio, K R; Bosch, J; Lötters, S; Wombwell, E; Garner, T W J; Cunningham, A A; Spitzen-van der Sluijs, A; Salvidio, S; Ducatelle, R; Nishikawa, K; Nguyen, T T; Kolby, J E; Van Bocxlaer, I; Bossuyt, F; Pasmans, F

    2014-10-31

    Emerging infectious diseases are reducing biodiversity on a global scale. Recently, the emergence of the chytrid fungus Batrachochytrium salamandrivorans resulted in rapid declines in populations of European fire salamanders. Here, we screened more than 5000 amphibians from across four continents and combined experimental assessment of pathogenicity with phylogenetic methods to estimate the threat that this infection poses to amphibian diversity. Results show that B. salamandrivorans is restricted to, but highly pathogenic for, salamanders and newts (Urodela). The pathogen likely originated and remained in coexistence with a clade of salamander hosts for millions of years in Asia. As a result of globalization and lack of biosecurity, it has recently been introduced into naïve European amphibian populations, where it is currently causing biodiversity loss.

  13. Wildlife disease. Recent introduction of a chytrid fungus endangers Western Palearctic salamanders.

    PubMed

    Martel, A; Blooi, M; Adriaensen, C; Van Rooij, P; Beukema, W; Fisher, M C; Farrer, R A; Schmidt, B R; Tobler, U; Goka, K; Lips, K R; Muletz, C; Zamudio, K R; Bosch, J; Lötters, S; Wombwell, E; Garner, T W J; Cunningham, A A; Spitzen-van der Sluijs, A; Salvidio, S; Ducatelle, R; Nishikawa, K; Nguyen, T T; Kolby, J E; Van Bocxlaer, I; Bossuyt, F; Pasmans, F

    2014-10-31

    Emerging infectious diseases are reducing biodiversity on a global scale. Recently, the emergence of the chytrid fungus Batrachochytrium salamandrivorans resulted in rapid declines in populations of European fire salamanders. Here, we screened more than 5000 amphibians from across four continents and combined experimental assessment of pathogenicity with phylogenetic methods to estimate the threat that this infection poses to amphibian diversity. Results show that B. salamandrivorans is restricted to, but highly pathogenic for, salamanders and newts (Urodela). The pathogen likely originated and remained in coexistence with a clade of salamander hosts for millions of years in Asia. As a result of globalization and lack of biosecurity, it has recently been introduced into naïve European amphibian populations, where it is currently causing biodiversity loss. PMID:25359973

  14. The marbled crayfish as a paradigm for saltational speciation by autopolyploidy and parthenogenesis in animals

    PubMed Central

    Vogt, Günter; Falckenhayn, Cassandra; Schrimpf, Anne; Schmid, Katharina; Hanna, Katharina; Panteleit, Jörn; Helm, Mark; Schulz, Ralf; Lyko, Frank

    2015-01-01

    ABSTRACT The parthenogenetic all-female marbled crayfish is a novel research model and potent invader of freshwater ecosystems. It is a triploid descendant of the sexually reproducing slough crayfish, Procambarus fallax, but its taxonomic status has remained unsettled. By cross-breeding experiments and parentage analysis we show here that marbled crayfish and P. fallax are reproductively separated. Both crayfish copulate readily, suggesting that the reproductive barrier is set at the cytogenetic rather than the behavioural level. Analysis of complete mitochondrial genomes of marbled crayfish from laboratory lineages and wild populations demonstrates genetic identity and indicates a single origin. Flow cytometric comparison of DNA contents of haemocytes and analysis of nuclear microsatellite loci confirm triploidy and suggest autopolyploidisation as its cause. Global DNA methylation is significantly reduced in marbled crayfish implying the involvement of molecular epigenetic mechanisms in its origination. Morphologically, both crayfish are very similar but growth and fecundity are considerably larger in marbled crayfish, making it a different animal with superior fitness. These data and the high probability of a divergent future evolution of the marbled crayfish and P. fallax clusters suggest that marbled crayfish should be considered as an independent asexual species. Our findings also establish the P. fallax–marbled crayfish pair as a novel paradigm for rare chromosomal speciation by autopolyploidy and parthenogenesis in animals and for saltational evolution in general. PMID:26519519

  15. The marbled crayfish as a paradigm for saltational speciation by autopolyploidy and parthenogenesis in animals.

    PubMed

    Vogt, Günter; Falckenhayn, Cassandra; Schrimpf, Anne; Schmid, Katharina; Hanna, Katharina; Panteleit, Jörn; Helm, Mark; Schulz, Ralf; Lyko, Frank

    2015-01-01

    The parthenogenetic all-female marbled crayfish is a novel research model and potent invader of freshwater ecosystems. It is a triploid descendant of the sexually reproducing slough crayfish, Procambarus fallax, but its taxonomic status has remained unsettled. By cross-breeding experiments and parentage analysis we show here that marbled crayfish and P. fallax are reproductively separated. Both crayfish copulate readily, suggesting that the reproductive barrier is set at the cytogenetic rather than the behavioural level. Analysis of complete mitochondrial genomes of marbled crayfish from laboratory lineages and wild populations demonstrates genetic identity and indicates a single origin. Flow cytometric comparison of DNA contents of haemocytes and analysis of nuclear microsatellite loci confirm triploidy and suggest autopolyploidisation as its cause. Global DNA methylation is significantly reduced in marbled crayfish implying the involvement of molecular epigenetic mechanisms in its origination. Morphologically, both crayfish are very similar but growth and fecundity are considerably larger in marbled crayfish, making it a different animal with superior fitness. These data and the high probability of a divergent future evolution of the marbled crayfish and P. fallax clusters suggest that marbled crayfish should be considered as an independent asexual species. Our findings also establish the P. fallax-marbled crayfish pair as a novel paradigm for rare chromosomal speciation by autopolyploidy and parthenogenesis in animals and for saltational evolution in general.

  16. Iteroparity in the variable environment of the salamander Ambystoma tigrinum

    USGS Publications Warehouse

    Church, D.R.; Bailey, L.L.; Wilbur, H.M.; Kendall, W.L.; Hines, J.E.

    2007-01-01

    Simultaneous estimation of survival, reproduction, and movement is essential to understanding how species maximize lifetime reproduction in environments that vary across space and time. We conducted a four-year, capture–recapture study of three populations of eastern tiger salamanders (Ambystoma tigrinum tigrinum) and used multistate mark–recapture statistical methods to estimate the manner in which movement, survival, and breeding probabilities vary under different environmental conditions across years and among populations and habitats. We inferred how individuals may mitigate risks of mortality and reproductive failure by deferring breeding or by moving among populations. Movement probabilities among populations were extremely low despite high spatiotemporal variation in reproductive success and survival, suggesting possible costs to movements among breeding ponds. Breeding probabilities varied between wet and dry years and according to whether or not breeding was attempted in the previous year. Estimates of survival in the nonbreeding, forest habitat varied among populations but were consistent across time. Survival in breeding ponds was generally high in years with average or high precipitation, except for males in an especially ephemeral pond. A drought year incurred severe survival costs in all ponds to animals that attempted breeding. Female salamanders appear to defer these episodic survival costs of breeding by choosing not to breed in years when the risk of adult mortality is high. Using stochastic simulations of survival and breeding under historical climate conditions, we found that an interaction between breeding probabilities and mortality limits the probability of multiple breeding attempts differently between the sexes and among populations.

  17. Iteroparity in the variable environment of the salamander Ambystoma tigrinum.

    PubMed

    Church, Don R; Bailey, Larissa L; Wilbur, Henry M; Kendall, William L; Hines, James E

    2007-04-01

    Simultaneous estimation of survival, reproduction, and movement is essential to understanding how species maximize lifetime reproduction in environments that vary across space and time. We conducted a four-year, capture-recapture study of three populations of eastern tiger salamanders (Ambystoma tigrinum tigrinum) and used multistate mark-recapture statistical methods to estimate the manner in which movement, survival, and breeding probabilities vary under different environmental conditions across years and among populations and habitats. We inferred how individuals may mitigate risks of mortality and reproductive failure by deferring breeding or by moving among populations. Movement probabilities among populations were extremely low despite high spatiotemporal variation in reproductive success and survival, suggesting possible costs to movements among breeding ponds. Breeding probabilities varied between wet and dry years and according to whether or not breeding was attempted in the previous year. Estimates of survival in the nonbreeding, forest habitat varied among populations but were consistent across time. Survival in breeding ponds was generally high in years with average or high precipitation, except for males in an especially ephemeral pond. A drought year incurred severe survival costs in all ponds to animals that attempted breeding. Female salamanders appear to defer these episodic survival costs of breeding by choosing not to breed in years when the risk of adult mortality is high. Using stochastic simulations of survival and breeding under historical climate conditions, we found that an interaction between breeding probabilities and mortality limits the probability of multiple breeding attempts differently between the sexes and among populations. PMID:17536706

  18. Impacts of a gape limited Brook Trout, Salvelinus fontinalis, on larval Northwestern salamander, Ambystoma gracile, growth: A field enclosure experiment

    USGS Publications Warehouse

    Currens, C.R.; Liss, W.J.; Hoffman, R.L.

    2007-01-01

    The formation of amphibian population structure is directly affected by predation. Although aquatic predators have been shown to have direct negative effects on larval salamanders in laboratory and field experiments, the potential impacts of gape-limited fish on larval salamander growth has been largely underexplored. We designed an enclosure experiment conducted in situ to quantify the effects of gape-limited Brook Trout (Salvelinus fontinalis) on larval Northwestern Salamander (Ambystoma gracile) growth. We specifically tested whether the presence of fish too small to consume larvae had a negative effect on larval growth. The results of this study indicate that the presence of a gape-limited S. fontinalis can have a negative effect on growth of larval A. gracile salamanders. Copyright 2007 Society for the Study of Amphibians and Reptiles.

  19. At random meetings to the creation of new species of Salamander

    NASA Astrophysics Data System (ADS)

    Brillant, Marie-Pierre

    2013-04-01

    The pupils in final year of high school (15-18 years old) study the notion "species" and the creation of new species in various ways. Having studied genetic admixtures, this activity allows the pupils to build a scenario explaining the creation of a new species of Salamander in southern California from an ancestral population existing in northern Oregon. They can observe, on Google Earth, various populations of Salamander of the genus Ensatina. Salamanders of the genus Ensatina live in California around the Joaquin and Sacramento dry valleys. In this software, the pupils get information about the salamanders' environment and photographs of individuals and environments. During a migratory movement toward new territories to be colonized, these salamanders meet an inhospitable environment that they can not occupy. This population then splits up into two migratory branches, east and west, each overcoming the obstacles in different ways. The two groups gradually colonized southern territories but they avoided the too dry and hot San Joaquin plains. The two main branches of the original population gradually move away from each other, and genetic exchanges between them decrease over time. Eventually, we can find various populations of Salamander on both sides of the valleys, since the salamanders occupied new territories and diversified along the way. Among mutations that randomly occur, only those mutations that are best adapted in the origin were conserved in the genetic heritage of every population. When the individuals stemming from different western populations met, they were interfertile and give fertile hybrids, which was verified in the laboratory. Likewise, when individuals of the different eastern subspecies met accidentally, fertile hybrids also could arise from these crossings. The pupils can observe what happens in the overlap of various populations : interfertility or not. They also have geological, geographical and climatic information about the San Joaquin

  20. Endoparasites of plethodontid salamanders from Paradise Brook, New Hampshire.

    PubMed

    Muzzall, P M; Peebles, C R; Burton, T M

    1997-12-01

    Totals of 52 dusky salamanders Desmognathus fuscus, 51 two-lined salamanders Eurycea bislineata, 54 red-backed salamanders Plethodon cinereus, and 3 spring salamanders Gyrinophilus porphyriticus (Plethodontidae) collected in June and August 1995 from Paradise Brook, a tributary to Hubbard Brook, New Hampshire, were examined for parasites. Parasites found were Brachycoelium storeriae, Brachycoelium sp., Bothriocephalus rarus, Falcaustra sp., Omeia sp., Batracholandros magnavulvaris, and Cepedietta michiganensis. Eighty-six percent of the red-backed salamanders, a terrestrial species, harbored 1 or more parasites. Among the aquatic and semiaquatic species, 27% of the dusky and 45% of the two-lined salamanders were infected with 1 or more parasites.

  1. A case for using Plethodontid salamanders for monitoring biodiversity and ecosystem integrity of North American forests

    USGS Publications Warehouse

    Welsh, H.H.; Droege, S.

    2001-01-01

    Terrestrial salamanders of the family P!ethodontidae have unique attributes that make them excellent indicators of biodiversity and ecosystem integrity in forested habitats. Their longevity, small territory size, site fidelity, sensitivity to natural and anthropogenic perturbations, tendency to occur in high densities, and low sampling costs mean that counts of plethodontid salamanders provide numerous advantages over counts of other North American forest organisms for indicating environmental change. Furthermore, they are tightly linked physiologically to microclimatic and successional processes that influence the distribution and abundance of numerous other hydrophilic but difficult-to-study forest-dwelling plants and animals. Ecosystem processes such as moisture cycling, food-web dynamics, and succession, with their related structural and microclimatic variability, all affect forest biodiversity and have been shown to affect salamander populations as well. We determined the variability associated with sampling for plethodontid salamanders by estimating the coefficient of variation (CV) from available time-series data. The median coefficient of variation indicated that variation in counts of individuals among studies was much lower in plethodonticis (27%) than in lepidoptera (93%), passerine birds (57%), small mammals (69%), or other amphibians (37-46%), which means plethodontid salamanders provide an important statistical advantage over other species for monitoring long-term forest health.

  2. Larval long-toed salamanders incur nonconsumptive effects in the presence of nonnative trout

    USGS Publications Warehouse

    Kenison, Erin K.; Litt, Andrea R.; Pilliod, David; McMahon, Thomas E.

    2016-01-01

    Predators can influence prey directly through consumption or indirectly through nonconsumptive effects (NCEs) by altering prey behavior, morphology, and life history. We investigated whether predator-avoidance behaviors by larval long-toed salamanders (Ambystoma macrodactylum) in lakes with nonnative trout result in NCEs on morphology and development. Field studies in lakes with and without trout were corroborated by experimental enclosures, where prey were exposed only to visual and chemical cues of predators. We found that salamanders in lakes with trout were consistently smaller than in lakes without trout: 38% lower weight, 24% shorter body length, and 29% shorter tail length. Similarly, salamanders in protective enclosures grew 2.9 times slower when exposed to visual and olfactory trout cues than when no trout cues were present. Salamanders in trout-free lakes and enclosures were 22.7 times and 1.48 times, respectively, more likely to metamorphose during the summer season than those exposed to trout in lakes and/or their cues. Observed changes in larval growth rate and development likely resulted from a facultative response to predator-avoidance behavior and demonstrate NCEs occurred even when predation risk was only perceived. Reduced body size and growth, as well as delayed metamorphosis, could have ecological consequences for salamander populations existing with fish if those effects carry-over into lower recruitment, survival, and fecundity.

  3. Estimating superpopulation size and annual probability of breeding for pond-breeding salamanders

    USGS Publications Warehouse

    Kinkead, K.E.; Otis, D.L.

    2007-01-01

    It has long been accepted that amphibians can skip breeding in any given year, and environmental conditions act as a cue for breeding. In this paper, we quantify temporary emigration or nonbreeding probability for mole and spotted salamanders (Ambystoma talpoideum and A. maculatum). We estimated that 70% of mole salamanders may skip breeding during an average rainfall year and 90% may skip during a drought year. Spotted salamanders may be more likely to breed, with only 17% avoiding the breeding pond during an average rainfall year. We illustrate how superpopulations can be estimated using temporary emigration probability estimates. The superpopulation is the total number of salamanders associated with a given breeding pond. Although most salamanders stay within a certain distance of a breeding pond for the majority of their life spans, it is difficult to determine true overall population sizes for a given site if animals are only captured during a brief time frame each year with some animals unavailable for capture at any time during a given year. ?? 2007 by The Herpetologists' League, Inc.

  4. Conservation assessment for the Siskiyou Mountains salamander and Scott Bar salamander in northern California.

    SciTech Connect

    Vinikour, W. S.; LaGory, K. E.; Adduci, J. J.; Environmental Science Division

    2006-10-20

    The purpose of this conservation assessment is to summarize existing knowledge regarding the biology and ecology of the Siskiyou Mountains salamander and Scott Bar salamander, identify threats to the two species, and identify conservation considerations to aid federal management for persistence of the species. The conservation assessment will serve as the basis for a conservation strategy for the species.

  5. Acute toxicity of acidity in larvae and adults of four stream salamander species (Plethodontidae).

    PubMed

    Green, Linda E; Peloquin, Jennifer E

    2008-11-01

    High levels of acid deposition have severely affected streamwater chemistry in the southern Appalachians. Plethodontid stream salamanders living in and around headwater streams rely on cutaneous respiration and are highly susceptible to changes in water quality. We examined the sensitivity to low pH conditions in four stream salamanders by monitoring the response to six pH treatments ranging from pH 2.75 to 6.5. To quantify acid tolerance, we determined median lethal concentrations (LC50) in 96-h laboratory bioassays. This is the first study to quantify the level of sensitivity of stream salamanders to acidic conditions, indicating that stream salamanders are acid tolerant compared with many other lotic organisms. We found that acid tolerance is a species-specific trait with intraspecific variation shaped by life stage and body size. Mortality occurred at pH levels less than 4.2. The acid sensitivity of Desmognathus quadramaculatus larvae (LC50 = pH 3.95) was highest compared to sensitivity of Eurycea cirrigera larvae (LC50 = 3.6), Gyrinophilus porphyriticus larvae (LC50 = 3.5), and Pseudotriton ruber larvae (LC50 = 3.5). Larval survival was lower than adult survival in low pH treatments for E. cirrigera (adult LC50 = 3.1) and D. quadramaculatus (adult LC50 = 3.5). Salamanders responded to sublethal exposure to acidity with lethargic movements and decreased swimming speed. These results suggest that episodic acid events that cause streamwater pH to drop near 4.2 may cause mortality or induce sublethal effects, such as slower swimming speed. Because salamander larvae are more sensitive to acidic conditions than adults, we recommend that population monitoring programs extend methodology to include reliable estimates of larval population sizes.

  6. ARE SALAMANDERS USEFUL INDICATORS OF HYDROLOGIC PERMANENCE IN HEADWATER STREAMS?

    EPA Science Inventory

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collect...

  7. Floating mechanism of a small liquid marble

    PubMed Central

    Ooi, Chin Hong; Plackowski, Chris; Nguyen, Anh V.; Vadivelu, Raja K.; John, James A. St.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-01-01

    Flotation of small solid objects and liquid droplets on water is critical to natural and industrial activities. This paper reports the floating mechanism of liquid marbles, or liquid droplets coated with hydrophobic microparticles. We used X-ray computed tomography (XCT) to acquire cross-sectional images of the floating liquid marble and interface between the different phases. We then analysed the shape of the liquid marble and the angles at the three-phase contact line (TPCL). We found that the small floating liquid marbles follow the mechanism governing the flotation of solid objects in terms of surface tension forces. However, the contact angles formed and deformation of the liquid marble resemble that of a sessile liquid droplet on a thin, elastic solid. For small liquid marbles, the contact angle varies with volume due to the deformability of the interface. PMID:26902930

  8. Floating mechanism of a small liquid marble

    NASA Astrophysics Data System (ADS)

    Ooi, Chin Hong; Plackowski, Chris; Nguyen, Anh V.; Vadivelu, Raja K.; John, James A. St.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-02-01

    Flotation of small solid objects and liquid droplets on water is critical to natural and industrial activities. This paper reports the floating mechanism of liquid marbles, or liquid droplets coated with hydrophobic microparticles. We used X-ray computed tomography (XCT) to acquire cross-sectional images of the floating liquid marble and interface between the different phases. We then analysed the shape of the liquid marble and the angles at the three-phase contact line (TPCL). We found that the small floating liquid marbles follow the mechanism governing the flotation of solid objects in terms of surface tension forces. However, the contact angles formed and deformation of the liquid marble resemble that of a sessile liquid droplet on a thin, elastic solid. For small liquid marbles, the contact angle varies with volume due to the deformability of the interface.

  9. Floating mechanism of a small liquid marble.

    PubMed

    Ooi, Chin Hong; Plackowski, Chris; Nguyen, Anh V; Vadivelu, Raja K; St John, James A; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-02-23

    Flotation of small solid objects and liquid droplets on water is critical to natural and industrial activities. This paper reports the floating mechanism of liquid marbles, or liquid droplets coated with hydrophobic microparticles. We used X-ray computed tomography (XCT) to acquire cross-sectional images of the floating liquid marble and interface between the different phases. We then analysed the shape of the liquid marble and the angles at the three-phase contact line (TPCL). We found that the small floating liquid marbles follow the mechanism governing the flotation of solid objects in terms of surface tension forces. However, the contact angles formed and deformation of the liquid marble resemble that of a sessile liquid droplet on a thin, elastic solid. For small liquid marbles, the contact angle varies with volume due to the deformability of the interface.

  10. Biofouling of marbles by oxygenic photosynthetic microorganisms.

    PubMed

    Karaca, Zeki; Öztürk, Ayten; Çolak, Emel

    2015-08-01

    Phototrophic microorganisms disfigure the surfaces of different types of stone. Stone structure is damaged by the activity of photoautotrophic and other microorganisms. However, to date few, investigations have been undertaken into the relationship between microorganisms and the properties of different types of marble. In this study, biological activity of photoautotrophic microorganisms on three types of marble (Yatagan White, Giallo Anticato and Afyon White) was investigated under laboratory conditions over a short period of time. The three types of marble supported the growth of phototrophic microbial communities on their outer and inner layers, turning their original colour from white to a yellowish green colour. The porosity of the marble types facilitated filamentous microbial growth in the presence of water. Scanning electron microscope analysis revealed the accumulation of aggregates such as small spherical, fibrillar, calcified globular bodies on the inner surfaces of the marbles. This suggests that the microscopic characteristics of particular marble types may stimulate the growth of certain types of microorganisms.

  11. Environmental acidification is not associated with altered plasma corticosterone levels in the stream-side salamander, Desmognathus ochrophaeus.

    PubMed

    Woodley, Sarah K; Freeman, Peter; Ricciardella, Lauren F

    2014-05-15

    As environments become increasingly altered due to anthropogenic factors, interest is growing in how endocrine systems respond to pollution and environmental degradation. Glucocorticoid hormones (GCs) are a type of stress hormones that are released upon activation of the hypothalamic-pituitary-adrenal axis and have widespread effects throughout the body. We tested the hypothesis that exposure to environmental acidification is associated with altered levels of plasma GCs in adult, stream-side Allegheny Mountain dusky salamanders (Desmognathus ochrophaeus). We compared plasma corticosterone (CORT) in salamanders living in 9 streams that differed in pH. Although capture and handling induced a robust increase in plasma CORT in all populations of salamanders, we discerned no significant effect of environmental pH on baseline CORT or handling-induced CORT levels. In a laboratory study, low pH decreased salamander locomotory activity compared to acid-neutral controls, but there was no effect of pH on plasma CORT. Decreased locomotory activity is a common amphibian response to stress, indicating that low pH has adverse effects on Allegheny Mountain dusky salamanders. Overall, we conclude that the effects of environmental pH on salamander behavior and other potential responses are not mediated by changes in plasma CORT levels. We discuss alternative explanations for our results and describe difficulties involved in searching for relationships between plasma GCs and environmental degradation.

  12. Persistence and extirpation in invaded landscapes: patch characteristics and connectivity determine effects of non-native predatory fish on native salamanders

    USGS Publications Warehouse

    Pilliod, David S.; Arkle, Robert S.; Maxell, Bryce A.

    2012-01-01

    Studies have demonstrated negative effects of non-native, predatory fishes on native amphibians, yet it is still unclear why some amphibian populations persist, while others are extirpated, following fish invasion. We examined this question by developing habitat-based occupancy models for the long-toed salamander (Ambystoma macrodactylum) and nonnative fish using survey data from 1,749 water bodies across 470 catchments in the Northern Rocky Mountains, USA. We first modeled the habitat associations of salamanders at 468 fishless water bodies in 154 catchments where non-native fish were historically, and are currently, absent from the entire catchment. Wethen applied this habitat model to the complete data set to predict the probability of salamander occupancy in each water body, removing any effect of fish presence. Finally, we compared field-observed occurrences of salamanders and fish to modeled probability of salamander occupancy. Suitability models indicated that fish and salamanders had similar habitat preferences, possibly resulting in extirpations of salamander populations from entire catchments where suitable habitats were limiting. Salamanders coexisted with non-native fish in some catchments by using marginal quality, isolated (no inlet or outlet) habitats that remained fishless. They rarely coexisted with fish within individual water bodies and only where habitat quality was highest. Connectivity of water bodies via streams resulted in increased probability of fish invasion and consequently reduced probability of salamander occupancy.These results could be used to identify and prioritize catchments and water bodies where control measures would be most effective at restoring amphibian populations. Our approach could be useful as a framework for improved investigations into questions of persistence and extirpation of native species when non-native species have already become established.

  13. Coexistence in streams: Do source-sink dynamics allow salamanders to persist with fish predators?

    USGS Publications Warehouse

    Sepulveda, A.J.; Lowe, W.H.

    2011-01-01

    Theory suggests that source-sink dynamics can allow coexistence of intraguild predators and prey, but empirical evidence for this coexistence mechanism is limited. We used capture-mark-recapture, genetic methods, and stable isotopes to test whether source-sink dynamics promote coexistence between stream fishes, the intraguild predator, and stream salamanders (Dicamptodon aterrimus), the intraguild prey. Salamander populations from upstream reaches without fish were predicted to maintain or supplement sink populations in downstream reaches with fish. We found instead that downstream reaches with fish were not sinks even though fish consumed salamander larvae-apparent survival, recruitment, and population growth rate did not differ between upstream and downstream reaches. There was also no difference between upstream and downstream reaches in net emigration. We did find that D. aterrimus moved frequently along streams, but believe that this is a response to seasonal habitat changes rather than intraguild predation. Our study provides empirical evidence that local-scale mechanisms are more important than dispersal dynamics to coexistence of streams salamanders and fish. More broadly, it shows the value of empirical data on dispersal and gene flow for distinguishing between local and spatial mechanisms of coexistence. ?? 2011 Springer-Verlag.

  14. Salamander occupancy in headwater stream networks

    USGS Publications Warehouse

    Grant, E.H.C.; Green, L.E.; Lowe, W.H.

    2009-01-01

    1. Stream ecosystems exhibit a highly consistent dendritic geometry in which linear habitat units intersect to create a hierarchical network of connected branches. 2. Ecological and life history traits of species living in streams, such as the potential for overland movement, may interact with this architecture to shape patterns of occupancy and response to disturbance. Specifically, large-scale habitat alteration that fragments stream networks and reduces connectivity may reduce the probability a stream is occupied by sensitive species, such as stream salamanders. 3. We collected habitat occupancy data on four species of stream salamanders in first-order (i.e. headwater) streams in undeveloped and urbanised regions of the eastern U.S.A. We then used an information-theoretic approach to test alternative models of salamander occupancy based on a priori predictions of the effects of network configuration, region and salamander life history. 4. Across all four species, we found that streams connected to other first-order streams had higher occupancy than those flowing directly into larger streams and rivers. For three of the four species, occupancy was lower in the urbanised region than in the undeveloped region. 5. These results demonstrate that the spatial configuration of stream networks within protected areas affects the occurrences of stream salamander species. We strongly encourage preservation of network connections between first-order streams in conservation planning and management decisions that may affect stream species.

  15. Data congruence, paedomorphosis and salamanders

    PubMed Central

    Struck, Torsten H

    2007-01-01

    Background The retention of ancestral juvenile characters by adult stages of descendants is called paedomorphosis. However, this process can mislead phylogenetic analyses based on morphological data, even in combination with molecular data, because the assessment if a character is primary absent or secondary lost is difficult. Thus, the detection of incongruence between morphological and molecular data is necessary to investigate the reliability of simultaneous analyses. Different methods have been proposed to detect data congruence or incongruence. Five of them (PABA, PBS, NDI, LILD, DRI) are used herein to assess incongruence between morphological and molecular data in a case study addressing salamander phylogeny, which comprises several supposedly paedomorphic taxa. Therefore, previously published data sets were compiled herein. Furthermore, two strategies ameliorating effects of paedomorphosis on phylogenetic studies were tested herein using a statistical rigor. Additionally, efficiency of the different methods to assess incongruence was analyzed using this empirical data set. Finally, a test statistic is presented for all these methods except DRI. Results The addition of morphological data to molecular data results in both different positions of three of the four paedomorphic taxa and strong incongruence, but treating the morphological data using different strategies ameliorating the negative impact of paedomorphosis revokes these changes and minimizes the conflict. Of these strategies the strategy to just exclude paedomorphic character traits seem to be most beneficial. Of the three molecular partitions analyzed herein the RAG1 partition seems to be the most suitable to resolve deep salamander phylogeny. The rRNA and mtDNA partition are either too conserved or too variable, respectively. Of the different methods to detect incongruence, the NDI and PABA approaches are more conservative in the indication of incongruence than LILD and PBS. Conclusion

  16. Phylogeny and genetic history of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870) inferred from complete mitochondrial genomes.

    PubMed

    Malyarchuk, Boris; Derenko, Miroslava; Denisova, Galina

    2013-05-01

    We assessed phylogeny of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870), the most northern ectothermic, terrestrial vertebrate in Eurasia, by sequence analysis of complete mitochondrial genomes in 26 specimens from different localities (China, Khabarovsk region, Sakhalin, Yakutia, Magadan region, Chukotka, Kamchatka, Ural, European part of Russia). In addition, a complete mitochondrial genome of the Schrenck salamander, Salamandrella schrenckii, was determined for the first time. Bayesian phylogenetic analysis of the entire mtDNA genomes of S. keyserlingii demonstrates that two haplotype clades, AB and C, radiated about 1.4 million years ago (Mya). Bayesian skyline plots of population size change through time show an expansion around 250 thousand years ago (kya) and then a decline around the Last Glacial Maximum (25 kya) with subsequent restoration of population size. Climatic changes during the Quaternary period have dramatically affected the population genetic structure of the Siberian salamanders. In addition, complete mtDNA sequence analysis allowed us to recognize that the vast area of Northern Eurasia was colonized only by the Siberian salamander clade C1b during the last 150 kya. Meanwhile, we were unable to find evidence of molecular adaptation in this clade by analyzing the whole mitochondrial genomes of the Siberian salamanders.

  17. Phylogeny and genetic history of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870) inferred from complete mitochondrial genomes.

    PubMed

    Malyarchuk, Boris; Derenko, Miroslava; Denisova, Galina

    2013-05-01

    We assessed phylogeny of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870), the most northern ectothermic, terrestrial vertebrate in Eurasia, by sequence analysis of complete mitochondrial genomes in 26 specimens from different localities (China, Khabarovsk region, Sakhalin, Yakutia, Magadan region, Chukotka, Kamchatka, Ural, European part of Russia). In addition, a complete mitochondrial genome of the Schrenck salamander, Salamandrella schrenckii, was determined for the first time. Bayesian phylogenetic analysis of the entire mtDNA genomes of S. keyserlingii demonstrates that two haplotype clades, AB and C, radiated about 1.4 million years ago (Mya). Bayesian skyline plots of population size change through time show an expansion around 250 thousand years ago (kya) and then a decline around the Last Glacial Maximum (25 kya) with subsequent restoration of population size. Climatic changes during the Quaternary period have dramatically affected the population genetic structure of the Siberian salamanders. In addition, complete mtDNA sequence analysis allowed us to recognize that the vast area of Northern Eurasia was colonized only by the Siberian salamander clade C1b during the last 150 kya. Meanwhile, we were unable to find evidence of molecular adaptation in this clade by analyzing the whole mitochondrial genomes of the Siberian salamanders. PMID:23415986

  18. Stream salamander species richness and abundance in relation to environmental factors in Shenandoah National Park, Virginia

    USGS Publications Warehouse

    Grant, E.H.C.; Jung, R.E.; Rice, K.C.

    2005-01-01

    Stream salamanders are sensitive to acid mine drainage and may be sensitive to acidification and low acid neutralizing capacity (ANC) of a watershed. Streams in Shenandoah National Park, Virginia, are subject to episodic acidification from precipitation events. We surveyed 25 m by 2 m transects located on the stream bank adjacent to the water channel in Shenandoah National Park for salamanders using a stratified random sampling design based on elevation, aspect and bedrock geology. We investigated the relationships of four species (Eurycea bislineata, Desmognathus fuscus, D. monticola and Gyrinophilus porphyriticus) to habitat and water quality variables. We did not find overwhelming evidence that stream salamanders are affected by the acid-base status of streams in Shenandoah National Park. Desmognathus fuscus and D. monticola abundance was greater both in streams that had a higher potential to neutralize acidification, and in higher elevation (>700 m) streams. Neither abundance of E. bislineata nor species richness were related to any of the habitat variables. Our sampling method preferentially detected the adult age class of the study species and did not allow us to estimate population sizes. We suggest that continued monitoring of stream salamander populations in SNP will determine the effects of stream acidification on these taxa.

  19. The Amphibian Chytrid Fungus, Batrachochytrium dendrobatidis, in Fully Aquatic Salamanders from Southeastern North America

    PubMed Central

    Chatfield, Matthew W. H.; Moler, Paul; Richards-Zawacki, Corinne L.

    2012-01-01

    Little is known about the impact that the pathogenic amphibian chytrid fungus, Batrachochytrium dendrobatidis (Bd), has on fully aquatic salamander species of the eastern United States. As a first step in determining the impacts of Bd on these species, we aimed to determine the prevalence of Bd in wild populations of fully aquatic salamanders in the genera Amphiuma, Necturus, Pseudobranchus, and Siren. We sampled a total of 98 salamanders, representing nine species from sites in Florida, Mississippi, and Louisiana. Overall, infection prevalence was found to be 0.34, with significant differences among genera but no clear geographic pattern. We also found evidence for seasonal variation, but additional sampling throughout the year is needed to clarify this pattern. The high rate of infection discovered in this study is consistent with studies of other amphibians from the southeastern United States. Coupled with previously published data on life histories and population densities, the results presented here suggest that fully aquatic salamanders may be serving as important vectors of Bd and the interaction between these species and Bd warrants additional research. PMID:22984569

  20. Optical Analysis of Some Romanian Marble

    NASA Astrophysics Data System (ADS)

    Pavelescu, G.; Ricman, C. T.; Ciuciu, J.; Savastru, D.; Nicolae, N.; Talianu, C.

    2007-04-01

    Characterization of some Romanian marble was done by fluorescence spectroscopy. Synchronous fluorescence spectroscopy (SFS) method was applied to obtain preliminary information on their fluorescence fingerprint. The characteristics of the fluorescence spectra (intensity, shape, bands, decay) for some sort of Romanian marble were analyzed in order to identify their nature and to discriminate the materials on clean and dirty states.

  1. Role of habitat complexity in predator-prey dynamics between an introduced fish and larval Long-toed Salamanders (Ambystoma macrodactylum)

    USGS Publications Warehouse

    Kenison, Erin K; Litt, Andrea R.; Pilliod, David; McMahon, Tom E

    2016-01-01

    Predation by nonnative fishes has reduced abundance and increased extinction risk for amphibian populations worldwide. Although rare, fish and palatable amphibians have been observed to coexist where aquatic vegetation and structural complexity provide suitable refugia. We examined whether larval long-toed salamanders (Ambystoma macrodactylum Baird, 1849) increased use of vegetation cover in lakes with trout and whether adding vegetation structure could reduce predation risk and nonconsumptive effects (NCEs), such as reductions in body size and delayed metamorphosis. We compared use of vegetation cover by larval salamanders in lakes with and without trout and conducted a field experiment to investigate the influence of added vegetation structure on salamander body morphology and life history. The probability of catching salamanders in traps in lakes with trout was positively correlated with the proportion of submerged vegetation and surface cover. Growth rates of salamanders in enclosures with trout cues decreased as much as 85% and the probability of metamorphosis decreased by 56%. We did not find evidence that adding vegetation reduced NCEs in experimental enclosures, but salamanders in lakes with trout utilized more highly-vegetated areas which suggests that adding vegetation structure at the scale of the whole lake may facilitate coexistence between salamanders and introduced trout.

  2. Social monogamy in a territorial salamander.

    PubMed

    Gillette; Jaeger; Peterson

    2000-06-01

    Social monogamy, which does not necessarily imply mating or genetic monogamy, is important in the formation of male-female pair associations. We operationally define social monogamy as occurring when two heterosexual adults, exclusive of kin-directed behaviour, direct significantly less aggression and significantly more submission towards each other, and/or spend significantly more time associating with each other relative to other adult heterosexual conspecifics. Long-term pair associations (i.e. those lasting through a lengthy breeding season) that are characteristic of social monogamy are common in some taxa but are virtually unknown in amphibians. Recent studies, however, have suggested that red-backed salamanders, Plethodon cinereus, have complex (for amphibians) social systems. Our laboratory experiments tested the hypothesis that red-backed salamanders found in pairs in the forest display behaviours consistent with social monogamy. During the summer noncourtship season, newly collected male-females pairs showed no preference to associate with their partners more than with a novel conspecific of the opposite sex. However, during the autumn courtship season, paired males and females significantly directed preferential behaviours towards their partners rather than towards a surrogate or a novel paired salamander. Focal animals showed no significant preferences when presented with their partner and a novel single salamander, but they never directed preferential behaviours towards a novel salamander (whether paired or single) or a surrogate. These results are the first to suggest that a salamander species engages in social monogamy. Furthermore, our results suggest that social monogamy may not inhibit paired males and females from displaying alternative strategies: preferring partners when extrapair associations may be disadvantageous (i.e. the extrapair animal is already paired) but not preferring partners when extrapair associations may be advantageous (i

  3. Liquid marble as microbioreactor for bioengineering applications

    NASA Astrophysics Data System (ADS)

    Sarvi, Fatemeh; Jain, Kanika; Alhasan, Layla; Arbatan, Tina; Shen, Wei; Chan, Peggy P. Y.

    2015-12-01

    This paper reports the use of liquid marbles (LMs) as miniature bioreactors to produce three-dimensional (3D) spheroids including tumor-like spheriods from cancer cells and embryoid bodies (EBs) from stem cells. A liquid marble microbioreactor is prepared by placing a drop of cell suspension onto a polytetrafluoroethylene (PTFE) particle bed. Without the addition of growth factors, suspended EBs from liquid marbles exhibit spontaneous contraction. These results indicate that the liquid marble provides a suitable microenvironment to induce EB formation and spontaneous cardiac differentiation. The EBs were further plated onto gelatin-coated tissue culture dishes. Plated EBs express mature cardiomyocyte marker cardiac troponinT (cTnT), indicating that these EBs have differentiated into functional cardiomyocytes. The cardiomyocytes generated using this liquid marble approach could be useful for transplantation.

  4. The Marble-Hand Illusion.

    PubMed

    Senna, Irene; Maravita, Angelo; Bolognini, Nadia; Parise, Cesare V

    2014-01-01

    Our body is made of flesh and bones. We know it, and in our daily lives all the senses constantly provide converging information about this simple, factual truth. But is this always the case? Here we report a surprising bodily illusion demonstrating that humans rapidly update their assumptions about the material qualities of their body, based on their recent multisensory perceptual experience. To induce a misperception of the material properties of the hand, we repeatedly gently hit participants' hand with a small hammer, while progressively replacing the natural sound of the hammer against the skin with the sound of a hammer hitting a piece of marble. After five minutes, the hand started feeling stiffer, heavier, harder, less sensitive, unnatural, and showed enhanced Galvanic skin response (GSR) to threatening stimuli. Notably, such a change in skin conductivity positively correlated with changes in perceived hand stiffness. Conversely, when hammer hits and impact sounds were temporally uncorrelated, participants did not spontaneously report any changes in the perceived properties of the hand, nor did they show any modulation in GSR. In two further experiments, we ruled out that mere audio-tactile synchrony is the causal factor triggering the illusion, further demonstrating the key role of material information conveyed by impact sounds in modulating the perceived material properties of the hand. This novel bodily illusion, the 'Marble-Hand Illusion', demonstrates that the perceived material of our body, surely the most stable attribute of our bodily self, can be quickly updated through multisensory integration.

  5. Phylogenetic relationships of the endangered Shenandoah salamander (Plethodon shenandoah) and other salamanders of the Plethodon cinereus group (Caudata : Plethodontidae)

    USGS Publications Warehouse

    Sites, J.W.; Morando, M.; Highton, R.; Huber, F.; Jung, R.E.

    2004-01-01

    The Shenandoah salamander (Plethodon shenandoah), known from isolated talus slopes on three of the highest mountains in Shenandoah National Park, is listed as state-endangered in Virginia and federally endangered under the U.S. Endangered Species Act. A 1999 paper by G. R. Thurow described P. shenandoah-like salamanders from three localities further south in the Blue Ridge Physiographic Province, which, if confirmed, would represent a range extension for P. shenandoah of approximately 90 km from its nearest known locality. Samples collected from two of these three localities were included in a molecular phylogenetic study of the known populations of P. shenandoah, and all other recognized species in the Plethodon cinereus group, using a 792 bp region of the mitochondrial cytochrome-b gene. Phylogenetic estimates were based on Bayesian, maximum likelihood, and maximum parsimony methods and topologies examined for placement of the new P. shenandoah-like samples relative to all others. All topologies recovered all haplotypes of the P. shenandoah-like animals nested within P. cinereus, and a statistical comparison of the best likelihood tree topology with one with an enforced (Thurow + Shenandoah P. shenandoah) clade revealed that the unconstrained tree had a significantly lower -In L score (P < 0.05, using the Shimodaira-Hasegawa test) than the constraint tree. This result and other anecdotal information give us no solid reason to consider the Thurow report valid. The current recovery program for P. shenandoah should remain focused on populations in Shenandoah National Park.

  6. Association of polymorphisms at DGAT1, leptin, SCD1, CAPN1 and CAST genes with color, marbling and water holding capacity in meat from beef cattle populations in Sweden.

    PubMed

    Li, Xin; Ekerljung, Marie; Lundström, Kerstin; Lundén, Anne

    2013-06-01

    The objective of this study was to investigate the associations of single nucleotide polymorphisms (SNPs) at five candidate genes with meat pH, color, marbling and water holding capacity (WHC) in young bulls from five beef breeds (n=243) in Sweden. The UASMS2 polymorphism at the leptin gene and the SNPs at the Stearoyl-CoA desaturase 1 gene (SCD1.878) and μ-calpain gene (CAPN1:c.947) were associated with variation in meat color traits after 6days of exposure to air. The K232A polymorphism at the diacylglycerol O-acyltransferase 1 (DGAT1) gene and the CAPN1:c.947 SNP were associated with level of beef marbling. There was no association between the SNP at the calpastatin gene (CAST:c.155) and meat quality traits, nor was there any association of the tested SNPs with WHC traits and pH value.

  7. Linking the evolution of habitat choice to ecosystem functioning: direct and indirect effects of pond-reproducing fire salamanders on aquatic-terrestrial subsidies.

    PubMed

    Reinhardt, Timm; Steinfartz, Sebastian; Paetzold, Achim; Weitere, Markus

    2013-09-01

    Shifts in life history traits and in the behaviour of species can potentially alter ecosystem functioning. The reproduction of the central European fire salamander (Salamandra salamandra), which usually deposits its larvae in first-order streams, in small pool and pond-like habitats, is an example of a recent local adaptation in this species. Here we aimed to quantify the direct and indirect effects of the predatory larvae on the aquatic food webs in the ponds and on the flux of matter between the ponds and adjacent terrestrial habitats. Our estimates are based on biomass data of the present pond fauna as well as on the analysis of stomach content data, growth rates and population dynamics of the salamander larvae in pond habitats. By their deposition of larvae in early spring, female fire salamanders import between 0.07 and 2.86 g dry mass m(-2) larval biomass into the ponds. Due to high mortality rates in the larval phase and the relatively small size at metamorphosis of the pond-adapted salamanders compared to stream-adapted ones, the biomass export of the metamorphosed salamanders clearly falls below the initial biomass import. Catastrophic events such as high water temperatures and low oxygen levels may even occasionally result in mass mortalities of salamander larvae and thus in a net 100 % import of the salamander biomass into the pond food webs. Indirect effects further accelerate this net import of matter into the aquatic habitat, e.g. the feeding of salamanders on aquatic insect larvae with the emergence of terrestrial adults-thus preventing export-and on terrestrial organisms that fall on the water surface (supporting import). This study demonstrates that the adaptation of salamanders to pond reproduction can alter food web linkages across ecosystem boundaries by enhancing the flux of materials and energy from terrestrial (i.e. forest) to the aquatic (i.e. pond) habitat.

  8. Cutaneous Bacteria of the Redback Salamander Prevent Morbidity Associated with a Lethal Disease

    PubMed Central

    Becker, Matthew H.; Harris, Reid N.

    2010-01-01

    Chytridiomycosis, caused by the fungal pathogen Batrachochytrium dendrobatidis (Bd), is an infectious disease that causes population declines of many amphibians. Cutaneous bacteria isolated from redback salamanders, Plethodon cinereus, and mountain yellow-legged frogs, Rana muscosa, inhibit the growth of Bd in vitro. In this study, the bacterial community present on the skin of P. cinereus individuals was investigated to determine if it provides protection to salamanders from the lethal and sub-lethal effects of chytridiomycosis. When the cutaneous bacterial community was reduced prior to Bd exposure, salamanders experienced a significantly greater decrease in body mass, which is a symptom of the disease, when compared to infected individuals with a normal bacterial community. In addition, a greater proportion of infected individuals with a reduced bacterial community experienced limb-lifting, a behavior seen only in infected individuals. Overall, these results demonstrate that the cutaneous bacterial community of P. cinereus provides protection to the salamander from Bd and that alteration of this community can change disease resistance. Therefore, symbiotic microbes associated with this species appear to be an important component of its innate skin defenses. PMID:20532032

  9. Context-dependent movement behavior of woodland salamanders (Plethodon) in two habitat types.

    PubMed

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Animal movement is critical to the maintenance of functional connectivity at the landscape scale and can play a key role in population persistence and metapopulation dynamics. The permeability of habitat to animal movement may vary as a result of either differential mortality, physical resistance, or simply the behavioral responses of organisms to perceived habitat quality. Understanding how and when animal movement behavior varies among habitat types is critical for identifying barriers to dispersal and predicting species distributions in relation to landscape features. We conducted an experimental translocation study and compared the movement success and behavioral strategies of plethodontid salamanders in both forest and open-canopy habitat. We found that individuals in closed-canopy forest oriented more strongly towards their home ranges and moved significantly farther on their release night. In spite of the clear differences in movement paths, the ultimate movement success of homing salamanders did not appear to vary with habitat type. Our study contributes to a growing body of literature suggesting the importance of recognizing the context dependence of animal movement behavior. Because the movement rates of displaced salamanders were significantly reduced in open-canopy, dispersal rates of plethodontid salamanders in open-canopy habitat are likely lower than in control forest. Further mechanistic studies focusing on habitat-specific movement behavior and survival costs will be valuable for effectively identifying and mitigating barriers to animal movement.

  10. Cutaneous bacteria of the redback salamander prevent morbidity associated with a lethal disease.

    PubMed

    Becker, Matthew H; Harris, Reid N

    2010-06-04

    Chytridiomycosis, caused by the fungal pathogen Batrachochytrium dendrobatidis (Bd), is an infectious disease that causes population declines of many amphibians. Cutaneous bacteria isolated from redback salamanders, Plethodon cinereus, and mountain yellow-legged frogs, Rana muscosa, inhibit the growth of Bd in vitro. In this study, the bacterial community present on the skin of P. cinereus individuals was investigated to determine if it provides protection to salamanders from the lethal and sub-lethal effects of chytridiomycosis. When the cutaneous bacterial community was reduced prior to Bd exposure, salamanders experienced a significantly greater decrease in body mass, which is a symptom of the disease, when compared to infected individuals with a normal bacterial community. In addition, a greater proportion of infected individuals with a reduced bacterial community experienced limb-lifting, a behavior seen only in infected individuals. Overall, these results demonstrate that the cutaneous bacterial community of P. cinereus provides protection to the salamander from Bd and that alteration of this community can change disease resistance. Therefore, symbiotic microbes associated with this species appear to be an important component of its innate skin defenses.

  11. Conservation genetics of the endangered Shenandoah salamander (Plethodon shenandoah, Plethodontidae)

    USGS Publications Warehouse

    Carpenter, D.W.; Jung, R.E.; Sites, J.W.

    2001-01-01

    The Shenandoah salamander (Plethodon shenandoah) is restricted to three isolated talus outcrops in Shenandoah National Park, VA, USA and has one of the smallest ranges of any tetrapod vertebrate. This species was listed as endangered under the US Endangered Species Act in 1989 over concern that direct competition with the red-backed salamander (Plethodon cinereus), successional habitat changes, and human impacts may cause its decline and possible extinction. We address two issues herein: (1) whether extensive introgression (through long-term hybridization) is present between the two species and threatens the survival of P. shenandoah, and (2) the level of population structure within P. shenandoah. We provide evidence from mtDNA haplotypes that shows no genetic differentiation among the three isolates of P. shenandoah, suggesting that their fragmentation is a geologically recent event, and/or that the isolates are still connected by occasional gene flow. There is also no evidence for extensive introgression of alleles in either direction between P. cinereus and P. shenandoah, which suggests that P. shenandoah may not be in danger of being genetically swamped out through hybridization with P. cinereus.

  12. Evidence for Sex Chromosome Turnover in Proteid Salamanders.

    PubMed

    Sessions, Stanley K; Bizjak Mali, Lilijana; Green, David M; Trifonov, Vladimir; Ferguson-Smith, Malcolm

    2016-01-01

    A major goal of genomic and reproductive biology is to understand the evolution of sex determination and sex chromosomes. Species of the 2 genera of the Salamander family Proteidae - Necturus of eastern North America, and Proteus of Southern Europe - have similar-looking karyotypes with the same chromosome number (2n = 38), which differentiates them from all other salamanders. However, Necturus possesses strongly heteromorphic X and Y sex chromosomes that Proteus lacks. Since the heteromorphic sex chromosomes of Necturus were detectable only with C-banding, we hypothesized that we could use C-banding to find sex chromosomes in Proteus. We examined mitotic material from colchicine-treated intestinal epithelium, and meiotic material from testes in specimens of Proteus, representing 3 genetically distinct populations in Slovenia. We compared these results with those from Necturus. We performed FISH to visualize telomeric sequences in meiotic bivalents. Our results provide evidence that Proteus represents an example of sex chromosome turnover in which a Necturus-like Y-chromosome has become permanently translocated to another chromosome converting heteromorphic sex chromosomes to homomorphic sex chromosomes. These results may be key to understanding some unusual aspects of demographics and reproductive biology of Proteus, and are discussed in the context of models of the evolution of sex chromosomes in amphibians. PMID:27351721

  13. Tissue lesions of tiger salamanders (Ambystoma tigrinum): relationship to sewage effluents.

    PubMed

    Rose, F L

    1978-09-29

    A population of facultative neotenous tiger salamanders (A. tigrinum) inhabiting a sewage lagoon at Reese AFB, Hurlwood, Texas, was found to have an exceptionally high rate of spontaneous tissue lesions. The population is composed of an estimated 28,000 large, reproductively mature larvae that are restricted to the lagoon. Only about 17% of the population metamorphoses normally. In contrast, tiger salamanders from uncontaminated lagoons in the same general vicinity metamorphose normally; however, no neoplasms were discovered in larvae sampled from the nonsewage lagoosn. N-nitrosamine analyses of water and tissue samples of larvae were negative. Polycyclic aromatic hydrocarbon analyses revealed traces of benzo[a]pyrene in the sludge; however, perylene, a constituent of jet fuel, was found in high concentration (300 ppb). These results indicate tat preylene, which was previously found not be tumorigenic to mice and rats, should be retested as a possible agent for nonmammalian species. PMID:280184

  14. Ambient ultraviolet radiation causes mortality in salamander eggs

    SciTech Connect

    Blaustein, A.R.; Edmond, B.; Kiesecker, J.M.

    1995-08-01

    Previous research has shown that amphibian species have differential sensitivity to ultraviolet-B (UV-B) radiation. In some anuran species, ambient levels of UV-B cause mortality in embryonic stages and hatching success is significantly reduced. Projected increases in UV-B may affect an increasing number of species. The adverse effects of UV-B may eventually be manifested at the population level and may ultimately contribute to population declines. Using field experiments, we investigated the effects of ambient UV-B on salamander (Ambystoma gracile) embryos developing at natural oviposition sites. We show that the hatching success of eggs of A. gracile shielded from UV-B is significantly higher than those not shielded from UV-B. 27 refs., 1 fig.

  15. Evaluating multi-level models to test occupancy state responses of Plethodontid salamanders

    USGS Publications Warehouse

    Kroll, Andrew J.; Garcia, Tiffany S.; Jones, Jay E.; Dugger, Catherine; Murden, Blake; Johnson, Josh; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  16. Thermal behaviour of weathered and consolidated marbles

    NASA Astrophysics Data System (ADS)

    Ruedrich, J.; Weiss, T.; Siegesmund, S.; Tschegg, E. K.

    2003-04-01

    To optimise stone consolidation it is necessary to understand the mechanisms of weathering in marbles, the control by the mineralogical composition and the rock fabric. The knowledge of how the stone consolidants affect the weathering mechanisms and if they are compatible with the stone is also an important consideration. The weathering of marble can begin with thermal stress whereby cracks are generated. To verify whether consolidation influences the thermal behaviour of marbles, we compared the behaviour of weathered and consolidated marbles. For the investigations four marbles were selected with various fabrics (e.g. texture, grain size, grain boundary geometry, etc.) and different weathering conditions. Three consolidation approaches were adopted: a solved polymethyl-methacrylate (PMMA I) dissolved in xylenes, a polysilicic acid ester (PSAE) and a total impregnation with a monomer methyl-methacrylate (PMMA II). Measurements of the porosity and effective pore size distribution evidenced a strong modification of the pore space by consolidation. Both PMMA approaches show a reestablishment of cohesion which can be determined by ultrasonic velocity measurements. The most conspicuous change of thermal dilatation behaviour is a pronounced reduction of expansion for the PMMA II consolidated marbles. By reaching the glass transition temperatures of PMMA I and PMMA II, a pronounced residual strain is observed in thermal dilatation measurements. This does not necessarily coincide with a deterioration, since ultrasonic wave velocities do not show a drastic decrease in thermally treated consolidated marbles. The PSAE consolidated marbles only show minor changes of dilatation, but due to its low bonding effect no significant cohesion between the crystals occurs.

  17. Marble Ageing Characterization by Acoustic Waves

    NASA Astrophysics Data System (ADS)

    Boudani, Mohamed El; Wilkie-Chancellier, Nicolas; Martinez, Loïc; Hébert, Ronan; Rolland, Olivier; Forst, Sébastien; Vergès-Belmin, Véronique; Serfaty, Stéphane

    In cultural heritage, statue marble characterization by acoustic waves is a well-known non-destructive method. Such investigations through the statues by time of flight method (TOF) point out sound speeds decrease with ageing. However for outdoor stored statues as the ones in the gardens of Chateau de Versailles, ageing affects mainly the surface of the Carrara marble. The present paper proposes an experimental study of the marble acoustic properties variations during accelerated laboratory ageing. The surface degradation of the marble is reproduced in laboratory for 29 mm thick marble samples by using heating/cooling thermal cycles on one face of a marble plate. Acoustic waves are generated by 1 MHz central frequency contact transducers excited by a voltage pulse placed on both sides of the plate. During the ageing and by using ad hoc transducers, the marble samples are characterized in transmission, along their volume by shear, compressional TOF measurements and along their surface by Rayleigh waves measurements. For Rayleigh waves, both TOF by transducers and laser vibrometry methods are used to detect the Rayleigh wave. The transmission measurements point out a deep decrease of the waves speeds in conjunction with a dramatic decrease of the maximum frequency transmitted. The marble acts as a low pass filter whose characteristic frequency cut decreases with ageing. This pattern occurs also for the Rayleigh wave surface measurements. The speed change in conjunction with the bandwidth translation is shown to be correlated to the material de-structuration during ageing. With a similar behavior but reversed in time, the same king of phenomena have been observed trough sol-gel materials during their structuration from liquid to solid state (Martinez, L. et all (2004). "Chirp-Z analysis for sol-gel transition monitoring". Ultrasonics, 42(1), 507-510.). A model is proposed to interpret the acoustical measurements

  18. Photoresponsive liquid marbles and dry water.

    PubMed

    Tan, Tristan Tsai Yuan; Ahsan, Aniq; Reithofer, Michael R; Tay, Siok Wei; Tan, Sze Yu; Hor, Tzi Sum Andy; Chin, Jia Min; Chew, Benny Kia Jia; Wang, Xiaobai

    2014-04-01

    Stimuli-responsive liquid marbles for controlled release typically rely on organic moieties that require lengthy syntheses. We report herein a facile, one-step synthesis of hydrophobic and oleophobic TiO2 nanoparticles that display photoresponsive wettability. Water liquid marbles stabilized by these photoresponsive TiO2 particles were found to be stable when shielded from ultraviolet (UV) radiation; however, they quickly collapsed after being irradiated with 302 nm UV light. Oil- and organic-solvent-based liquid marbles could also be fabricated using oleophobic TiO2 nanoparticles and show similar UV-induced collapse. Finally, we demonstrated the formation of the micronized form of water liquid marbles, also known as dry water, by homogenization of the TiO2 nanoparticles with water. The TiO2 dry water displayed a similar photoresponse, whereby the micronized liquid marbles collapsed after irradiation and the dry water turned from a free-flowing powder to a paste. Hence, by exploiting the photoresponsive wettability of TiO2, we fabricated liquid marbles and dry water that display photoresponse and studied the conditions required for their collapse. PMID:24617527

  19. Photoresponsive liquid marbles and dry water.

    PubMed

    Tan, Tristan Tsai Yuan; Ahsan, Aniq; Reithofer, Michael R; Tay, Siok Wei; Tan, Sze Yu; Hor, Tzi Sum Andy; Chin, Jia Min; Chew, Benny Kia Jia; Wang, Xiaobai

    2014-04-01

    Stimuli-responsive liquid marbles for controlled release typically rely on organic moieties that require lengthy syntheses. We report herein a facile, one-step synthesis of hydrophobic and oleophobic TiO2 nanoparticles that display photoresponsive wettability. Water liquid marbles stabilized by these photoresponsive TiO2 particles were found to be stable when shielded from ultraviolet (UV) radiation; however, they quickly collapsed after being irradiated with 302 nm UV light. Oil- and organic-solvent-based liquid marbles could also be fabricated using oleophobic TiO2 nanoparticles and show similar UV-induced collapse. Finally, we demonstrated the formation of the micronized form of water liquid marbles, also known as dry water, by homogenization of the TiO2 nanoparticles with water. The TiO2 dry water displayed a similar photoresponse, whereby the micronized liquid marbles collapsed after irradiation and the dry water turned from a free-flowing powder to a paste. Hence, by exploiting the photoresponsive wettability of TiO2, we fabricated liquid marbles and dry water that display photoresponse and studied the conditions required for their collapse.

  20. Unexpected rarity of the pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957-2011.

    PubMed

    Muletz, Carly; Caruso, Nicholas M; Fleischer, Robert C; McDiarmid, Roy W; Lips, Karen R

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957-987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957-2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1-0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection. PMID:25084159

  1. Unexpected Rarity of the Pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957–2011

    PubMed Central

    Muletz, Carly; Caruso, Nicholas M.; Fleischer, Robert C.; McDiarmid, Roy W.; Lips, Karen R.

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957–987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957–2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1–0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection. PMID:25084159

  2. Unexpected rarity of the pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957-2011.

    PubMed

    Muletz, Carly; Caruso, Nicholas M; Fleischer, Robert C; McDiarmid, Roy W; Lips, Karen R

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957-987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957-2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1-0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection.

  3. Distribution of the Sonora Tiger Salamander (Ambystoma mavortium stebbinsi) in Mexico

    USGS Publications Warehouse

    Hossack, Blake R.; Muths, Erin L.; Rorabaugh, James C.; Lemos Espinal, Julio A.; Sigafus, Brent H.; Chambert, Thierry A; Carreon Arroyo, Gerardo; Hurtado Felix, David; Toyos Martinez, Daniel; Jones, Thomas R

    2016-01-01

    The Sonoran Tiger Salamander (Ambystoma mavortium stebbinsi Lowe, 1954) was listed as federally endangered in the USA in 1997 (USFWS 1997). In the USA, the distribution of A. mavortium stebbinsi is limited to the San Rafael Valley (approximately 567 km2), between the Sierra San Antonio (called the Patagonia Mountains in Arizona) and Huachuca Mountains, and south of the Canelo Hills, Arizona (Fig. 1). The USA listing was triggered by loss of natural wetland habitats, threats from invasive predators, frequent die-offs from disease, introgression with the introduced Barred Tiger Salamander (A. mavortium mavortium), and small range and number of breeding sites that increases susceptibility to stochastic events (USFWS 1997). Small population sizes and limited gene flow have caused inbreeding, which may further reduce population viability and the potential for recovery (Jones et al. 1988; Storfer et al. 2014). 

  4. Homing orientation in salamanders: A mechanism involving chemical cues

    NASA Technical Reports Server (NTRS)

    Madison, D. M.

    1972-01-01

    A detailed description is given of experiments made to determine the senses and chemical cues used by salamanders for homing orientation. Sensory impairment and cue manipulative techniques were used in the investigation. All experiments were carried out at night. Results show that sense impaired animals did not home as readily as those who were blind but retained their sensory mechanism. This fact suggests that the olfactory mechanism is necessary for homing in the salamander. It was determined that after the impaired salamander regenerated its sensory mechanism it too returned home. It was concluded that homing ability in salamanders is direction independent, distant dependent, and vision independent.

  5. Phylogeography of Sardinian Cave Salamanders (Genus Hydromantes) Is Mainly Determined by Geomorphology

    PubMed Central

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M.; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems. PMID:22427830

  6. Phylogeography of Sardinian cave salamanders (genus Hydromantes) is mainly determined by geomorphology.

    PubMed

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems.

  7. Phylogeography of Sardinian cave salamanders (genus Hydromantes) is mainly determined by geomorphology.

    PubMed

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems. PMID:22427830

  8. Stream salamanders as indicators of stream quality in Maryland, USA

    USGS Publications Warehouse

    Southerland, M.T.; Jung, R.E.; Baxter, D.P.; Chellman, I.C.; Mercurio, G.; Volstad, J.H.

    2004-01-01

    Biological indicators are critical to the protection of small, headwater streams and the ecological values they provide. Maryland and other state monitoring programs have determined that fish indicators are ineffective in small streams, where stream salamanders may replace fish as top predators. Because of their life history, physiology, abundance, and ubiquity, stream salamanders are likely representative of biological integrity in these streams. The goal of this study was to determine whether stream salamanders are effective indicators of ecological conditions across biogeographic regions and gradients of human disturbance. During the summers of 2001 and 2002, we intensively surveyed for stream salamanders at 76 stream sites located west of the Maryland Coastal Plain, sites also monitored by the Maryland Biological Stream Survey (MBSS) and City of Gaithersburg. We found 1,584 stream salamanders, including all eight species known in Maryland, using two 15 ? 2 m transects and two 4 m2 quadrats that spanned both stream bank and channel. We performed removal sampling on transects to estimate salamander species detection probabilities, which ranged from 0.67-0.85. Stepwise regressions identified 15 of 52 non-salamander variables, representing water quality, physical habitat, land use, and biological conditions, which best predicted salamander metrics. Indicator development involved (1) identifying reference (non-degraded) and degraded sites (using percent forest, shading, riparian buffer width, aesthetic rating, and benthic macroinvertebrate and fish indices of biotic integrity); (2) testing 12 candidate salamander metrics (representing species richness and composition, abundance, species tolerance, and reproductive function) for their ability to distinguish reference from degraded sites; and (3) combining metrics into an index that effectively discriminated sites according to known stream conditions. Final indices for Highlands, Piedmont, and Non-Coastal Plain

  9. In search of critically endangered species: the current situation of two tiny salamander species in the Neotropical mountains of Mexico.

    PubMed

    Sandoval-Comte, Adriana; Pineda, Eduardo; Aguilar-López, José L

    2012-01-01

    Worldwide, one in every three species of amphibian is endangered, 39 species have gone extinct in the last 500 years and another 130 species are suspected to have gone extinct in recent decades. Of the amphibians, salamanders have the highest portion of their species in one of the risk categories, even higher than the frogs. To date there have been few studies that have used recent field data to examine the status of populations of endangered salamanders. In this study we evaluate the current situation of two tiny salamanders, Parvimolge townsendi and Thorius pennatulus, both of which are distributed at intermediate elevations in the mountains of the northern Neotropics and are considered to be critically endangered; the first has been proposed as possibly extinct. By carrying out exhaustive surveys in both historical and potentially suitable sites for these two species, we evaluated their abundance and the characteristics of their habitats, and we estimated their potential geographic distribution. We visited 22 sites, investing 672 person-hours of sampling effort in the surveys, and found 201 P. townsendi salamanders in 11 sites and only 13 T. pennatulus salamanders in 5 sites. Both species were preferentially found in cloud forest fragments that were well conserved or only moderately transformed, and some of the salamanders were found in shade coffee plantations. The potential distribution area of both species is markedly fragmented and we estimate that it has decreased by more than 48%. The results of this study highlight the importance of carrying out exhaustive, systematic field surveys to obtain accurate information about the current situation of critically endangered species, and help us better understand the crisis that amphibians are facing worldwide.

  10. Bromeliad selection by two salamander species in a harsh environment.

    PubMed

    Ruano-Fajardo, Gustavo; Rovito, Sean M; Ladle, Richard J

    2014-01-01

    Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment.

  11. Bromeliad Selection by Two Salamander Species in a Harsh Environment

    PubMed Central

    Ruano-Fajardo, Gustavo; Rovito, Sean M.; Ladle, Richard J.

    2014-01-01

    Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment. PMID:24892414

  12. Bromeliad selection by two salamander species in a harsh environment.

    PubMed

    Ruano-Fajardo, Gustavo; Rovito, Sean M; Ladle, Richard J

    2014-01-01

    Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment. PMID:24892414

  13. Amphibian chemical defense: antifungal metabolites of the microsymbiont Janthinobacterium lividum on the salamander Plethodon cinereus.

    PubMed

    Brucker, Robert M; Harris, Reid N; Schwantes, Christian R; Gallaher, Thomas N; Flaherty, Devon C; Lam, Brianna A; Minbiole, Kevin P C

    2008-11-01

    Disease has spurred declines in global amphibian populations. In particular, the fungal pathogen Batrachochytrium dendrobatidis has decimated amphibian diversity in some areas unaffected by habitat loss. However, there is little evidence to explain how some amphibian species persist despite infection or even clear the pathogen beyond detection. One hypothesis is that certain bacterial symbionts on the skin of amphibians inhibit the growth of the pathogen. An antifungal strain of Janthinobacterium lividum, isolated from the skin of the red-backed salamander Plethodon cinereus, produces antifungal metabolites at concentrations lethal to B. dendrobatidis. Antifungal metabolites were identified by using reversed phase high performance liquid chromatography, high resolution mass spectrometry, nuclear magnetic resonance, and UV-Vis spectroscopy and tested for efficacy of inhibiting the pathogen. Two metabolites, indole-3-carboxaldehyde and violacein, inhibited the pathogen's growth at relatively low concentrations (68.9 and 1.82 microM, respectively). Analysis of fresh salamander skin confirmed the presence of J. lividum and its metabolites on the skin of host salamanders in concentrations high enough to hinder or kill the pathogen (51 and 207 microM, respectively). These results support the hypothesis that cutaneous, mutualistic bacteria play a role in amphibian resistance to fungal disease. Exploitation of this biological process may provide long-term resistance to B. dendrobatidis for vulnerable amphibians and serve as a model for managing future emerging diseases in wildlife populations. PMID:18949519

  14. Amphibian chemical defense: antifungal metabolites of the microsymbiont Janthinobacterium lividum on the salamander Plethodon cinereus.

    PubMed

    Brucker, Robert M; Harris, Reid N; Schwantes, Christian R; Gallaher, Thomas N; Flaherty, Devon C; Lam, Brianna A; Minbiole, Kevin P C

    2008-11-01

    Disease has spurred declines in global amphibian populations. In particular, the fungal pathogen Batrachochytrium dendrobatidis has decimated amphibian diversity in some areas unaffected by habitat loss. However, there is little evidence to explain how some amphibian species persist despite infection or even clear the pathogen beyond detection. One hypothesis is that certain bacterial symbionts on the skin of amphibians inhibit the growth of the pathogen. An antifungal strain of Janthinobacterium lividum, isolated from the skin of the red-backed salamander Plethodon cinereus, produces antifungal metabolites at concentrations lethal to B. dendrobatidis. Antifungal metabolites were identified by using reversed phase high performance liquid chromatography, high resolution mass spectrometry, nuclear magnetic resonance, and UV-Vis spectroscopy and tested for efficacy of inhibiting the pathogen. Two metabolites, indole-3-carboxaldehyde and violacein, inhibited the pathogen's growth at relatively low concentrations (68.9 and 1.82 microM, respectively). Analysis of fresh salamander skin confirmed the presence of J. lividum and its metabolites on the skin of host salamanders in concentrations high enough to hinder or kill the pathogen (51 and 207 microM, respectively). These results support the hypothesis that cutaneous, mutualistic bacteria play a role in amphibian resistance to fungal disease. Exploitation of this biological process may provide long-term resistance to B. dendrobatidis for vulnerable amphibians and serve as a model for managing future emerging diseases in wildlife populations.

  15. Sex in unisexual salamanders: discovery of a new sperm donor with ancient affinities.

    PubMed

    Bogart, J P; Bartoszek, J; Noble, D W A; Bi, K

    2009-12-01

    Although bisexual reproduction has considerable evolutionary benefits, several all-female vertebrates exist. Unisexual salamanders in the genus Ambystoma are common around the Great Lakes region in eastern North America. They originated from a hybridization event that involved a female that shared a common ancestor with Ambystoma barbouri 2.4 to 3.9 million years ago but, unexpectedly, A. barbouri nuclear genomes were unknown in unisexuals. Unisexual salamanders steal sperm from donors of normally bisexual species, so their reproductive mode is described as kleptogenesis. Most known unisexuals are polyploid and they all possess at least one A. laterale genome. One or more other genomes are taken from sperm donors that may include A. jeffersonianum, A. laterale, A. texanum and A. tigrinum. We examined unisexual adults and larvae in a southern Ohio pond where unisexual individuals coexist with male A. barbouri. This population provided an opportunity to test hypotheses pertaining to the role of A. barbouri in the evolution of the disparate cytoplasmic and nuclear genomes in unisexual salamanders. Microsatellite DNA loci, mitochondrial DNA sequences and genomic in situ hybridization were used to identify the genomic constitution of individuals. A. barbouri was found to be an acceptable sperm donor for unisexuals but only contributed genomes in ploidy-elevated individuals. In the absence of A. jeffersonianum, this Ohio population is likely experiencing a recent switch in sperm donors from A. jeffersonianum to A. barbouri and demonstrates the evolutionary flexibility and dynamics of kleptogenesis. PMID:19639004

  16. Evaporation of Ethanol-Water Binary Mixture Sessile Liquid Marbles.

    PubMed

    Ooi, Chin Hong; Bormashenko, Edward; Nguyen, Anh V; Evans, Geoffrey M; Dao, Dzung V; Nguyen, Nam-Trung

    2016-06-21

    Liquid marble is a liquid droplet coated with particles. Recently, the evaporation process of a sessile liquid marble using geometric measurements has attracted great attention from the research community. However, the lack of gravimetric measurement limits further insights into the physical changes of a liquid marble during the evaporation process. Moreover, the evaporation process of a marble containing a liquid binary mixture has not been reported before. The present paper investigates the effective density and the effective surface tension of an evaporating liquid marble that contains aqueous ethanol at relatively low concentrations. The effective density of an evaporating liquid marble is determined from the concurrent measurement of instantaneous mass and volume. Density measurements combined with surface profile fitting provide the effective surface tension of the marble. We found that the density and surface tension of an evaporating marble are significantly affected by the particle coating. PMID:27230102

  17. Evaporation of Ethanol-Water Binary Mixture Sessile Liquid Marbles.

    PubMed

    Ooi, Chin Hong; Bormashenko, Edward; Nguyen, Anh V; Evans, Geoffrey M; Dao, Dzung V; Nguyen, Nam-Trung

    2016-06-21

    Liquid marble is a liquid droplet coated with particles. Recently, the evaporation process of a sessile liquid marble using geometric measurements has attracted great attention from the research community. However, the lack of gravimetric measurement limits further insights into the physical changes of a liquid marble during the evaporation process. Moreover, the evaporation process of a marble containing a liquid binary mixture has not been reported before. The present paper investigates the effective density and the effective surface tension of an evaporating liquid marble that contains aqueous ethanol at relatively low concentrations. The effective density of an evaporating liquid marble is determined from the concurrent measurement of instantaneous mass and volume. Density measurements combined with surface profile fitting provide the effective surface tension of the marble. We found that the density and surface tension of an evaporating marble are significantly affected by the particle coating.

  18. Mineralogical characterization of the Shelburne marble and the Salem limestone

    SciTech Connect

    McGee, E.S.

    1989-01-01

    Samples of Shelburne marble and Salem limestone were selected to represent marbles and limestones used in buildings and monuments. The Royal variety of Shelburne marble is a white marble predominantly composed of calcite but has heterogeneously distributed gray inclusions. The select buff Salem limestone is a beige, homogeneous, fossiliferous limestone, predominantly composed of fragments of echinoderms and bryozoans. The author reports that both samples are appropriate test stones for the National Acid Precipitation Assessment Program stone exposure studies.

  19. Transcriptome analysis of the endangered Chinese giant salamander (Andrias davidianus): Immune modulation in response to Aeromonas hydrophila infection.

    PubMed

    Qi, Zhitao; Zhang, Qihuan; Wang, Zisheng; Ma, Tianyi; Zhou, Jie; Holland, Jason W; Gao, Qian

    2016-01-01

    The endangered Chinese giant salamander (Andrias davidianus) is the largest extant amphibian species. Disease outbreaks represent one of the major factors threatening A. davidianus populations in the wild and the viability of artificial breeding programmes. Development of future immune therapies to eliminate infectious disease in A. davidianus is dependent on a thorough understanding of the immune mechanisms elicited by pathogen encounters. To this end we have undertaken, for the first time in amphibians, differential transcriptome analysis of the giant salamander response to Aeromonas hydrophila, one of the most devastating pathogens affecting amphibian populations. Out of 87,204 non-redundant consensus unigenes 19,216 were annotated, 6834 of which were upregulated and 906 down-regulated following bacterial infection. 2058 unigenes were involved with immune system processes, including 287 differentially expressed unigenes indicative of the impact of bacterial infection on several innate and adaptive immune pathways in the giant salamander. Other pathways not directly associated with immune-related activity were differentially expressed, including developmental, structural, molecular and growth processes. Overall, this work provides valuable insights into the underlying immune mechanisms elicited during bacterial infection in amphibians that may aid in the future development of disease control measures in protecting the Chinese giant salamander. With the unique position of amphibians in the transition of tetrapods from aquatic to terrestrial habitats, our study will also be invaluable towards the further understanding of the evolution of tetrapod immunity.

  20. Marble Bone Disease: A Rare Bone Disorder

    PubMed Central

    Harinathbabu, Maheswari; Thillaigovindan, Ranjani; Prabhu, Geetha

    2015-01-01

    Osteopetrosis, or marble bone disease, is a rare skeletal disorder due to a defective function of the osteoclasts. This defect renders bones more susceptible to osteomyelitis due to decreased vascularity. This disorder is inherited as autosomal dominant and autosomal recessive. Healthcare professionals should urge these patients to maintain their oral health as well as general health, as this condition makes these patients more susceptible to frequent infections and fractures. This case report emphasizes the signs and symptoms of marble bone disease and presents clinical and radiographic findings.  PMID:26594603

  1. Pulmonary alveolar proteinosis in a marble worker.

    PubMed

    Yildirim, Berna Botan; Akgedik, Recep; Akgedik, Sukran; Nazaroglu, Hasan

    2016-01-01

    Pulmonary alveolar proteinosis (PAP) is a rarely seen disease of the alveoli, characterized by accumulation of proteinous material, which stains positive with periodic acid Schiff, in the alveoli. Secondary PAP may develop as a result of occupational exposure to materials such as silica and indium. In the paper, together with a review of the relevant literature, we present an uncommon case of a 47-year old male, marble worker who was diagnosed with PAP associated with a 12-year history of exposure to marble dust. Int J Occup Med Environ Health 2016;29(5):871-876. PMID:27518894

  2. Colorado Yule Marble; building stone of the Lincoln Memorial

    USGS Publications Warehouse

    McGee, Elaine S.

    1999-01-01

    The Colorado Yule marble, quarried in Marble, Colo., is a very pure white marble, and it has been widely acclaimed for its quality and purity. This marble has been used for many prominent buildings; one of the most notable is the Lincoln Memorial in Washington, D.C., built nearly 80 years ago. Although most of the marble in the memorial appears to be in very good condition, some of the stones have developed pronounced surficial roughness and show a significant loss of carved details and rounded edges compared with adjacent stones. Because adjacent blocks of marble receive nearly identical exposure to weathering agents that cause deterioration of the marble, it seems very likely that this pronounced difference in durability of adjacent stones arises from some inherent characteristic of the marble. The Colorado Yule marble is a nearly pure calcite marble with minor inclusions of mica, quartz, and feldspar. Compositions of the calcite and the inclusion phases in the marble are typical for those phases. The calcite grains that compose the marble are irregularly shaped and range from 100 to 600 micrometers in diameter. The texture of the marble is even, with a slight preferred directional elongation that is visible when the marble is cut in certain directions. Physical tests of the marble show that its strength is comparable to that of other marbles typically used in buildings. Variations in the durability of the marble, like those seen at the Lincoln Memorial, are not related to variations in calcite composition or to the presence of inclusions in the marble. Most likely, the variations arise from differences in the calcite grain boundaries and the degree to which the grains interlock with one another. Weak grain boundaries that permit water or solutions to penetrate into the marble and dissolve the calcite grains at their edges cause the marble to disaggregate or ?sugar.? Subtle differences in texture that occur in the marble from various parts of the quarry probably

  3. Escape to Alcatraz: evolutionary history of slender salamanders (Batrachoseps) on the islands of San Francisco Bay

    PubMed Central

    Martínez-Solano, Iñigo; Lawson, Robin

    2009-01-01

    Background Island populations are excellent model systems for studies of phenotypic, ecological and molecular evolution. In this study, molecular markers of mitochondrial and nuclear derivation were used to investigate the evolution, structure and origin of populations of the California slender salamander (Batrachoseps attenuatus) inhabiting the six major islands of San Francisco Bay, formed following the rising of sea level around 9,000 years ago. Results There was a high degree of congruence in the results of analyses of nucleotide and allozyme data, both of which strongly support the hypothesis that, for the majority of the islands, salamanders are descended from hilltop populations that became isolated with the formation of the Bay ca. 9,000 years ago. There are two exceptions (Alcatraz and Yerba Buena) where the evidence suggests that salamander populations are wholly or in part, the result of anthropogenic introductions. Comparison of the molecular data and the interpretations drawn therefrom with an earlier morphological study of many of the same salamander populations show some of the same evolutionary trends. Conclusion In spite of marked differences between the evolutionary rates of the two kinds of molecular markers, both indicate distinctive and similar patterns of population structure for B. attenuatus in the San Francisco Bay Area and its islands. With the two noted exceptions, it is clear that most island populations were established prior to the 9,000 years since the formation of the Bay. Results of coalescence-based analyses suggest that for most island populations the mtDNA lineages from which they were derived date from the Pleistocene. It can be said that, based on observed values of genetic diversity, the last 9,000 years of evolution on these islands have been characterized by relative stability, with the occasional extinction of some haplotypes or alleles that were formerly shared between island and mainland populations but overall

  4. The effects of atrazine on spotted salamander embryos and their symbiotic alga.

    PubMed

    Olivier, Heather M; Moon, Brad R

    2010-04-01

    Worldwide amphibian declines have been a concern for biologists for the past several decades. The causes of such declines may include habitat loss, invasive species, pathogens, and man-made chemicals. Agricultural herbicides, in particular, are known to interfere with reproduction in amphibians and are likely contributing to population declines. We tested the effects of the herbicide atrazine on developing spotted salamanders (Ambystoma maculatum) and their symbiotic green alga Oophila amblystomatis. We exposed spotted salamander egg masses to atrazine at concentrations of 0 microg/L (control), 50, 100, 200, and 400 microg/L. Algae were eliminated in all atrazine treatments. Hatching success was significantly lower for atrazine-treated egg masses than for the controls, and was inversely related to atrazine concentration. The highest developmental stage reached by the embryos was significantly lower in the atrazine treatments than in the controls, and was inversely related to atrazine concentration. These results indicate that atrazine exposure affected spotted salamanders both directly by causing pathologies and mortality in embryos and indirectly by eliminating their symbiotic alga. PMID:19924530

  5. Effects of red-backed salamanders on ecosystem functions.

    PubMed

    Hocking, Daniel J; Babbitt, Kimberly J

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m(2) plots) and small-scale enclosures (2 m(2)) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m(-2)). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types.

  6. Prey detection by vomeronasal chemoreception in a plethodontid salamander.

    PubMed

    Placyk, John S; Graves, Brent M

    2002-05-01

    While chemoreception is involved in a wide variety of salamander behaviors, the chemosensory system that mediates specific behaviors is rarely known. We investigated the role of the vomeronasal system (VNS) in foraging behavior of the red-backed salamander (Plethodon cinereus) by manipulating salamanders' abilities to detect nonvolatile chemical cues emitted by potential prey. Subjects received one of three treatments: (1) impaired vomeronasal system, (2) sham manipulation, and (3) no manipulation. The role of the VNS in mediating foraging on motile prey (Drosophila melanogaster) was investigated under three light conditions (bright, dim, dark). Salamanders with impaired VNSs foraged less efficiently than either of the other experimental groups by displaying the longest latency to attack and the lowest rate of prey capture, especially in the absence of visual cues. A second experiment utilized freshly killed prey to determine whether the VNS takes on added importance in the absence of visual or tactile cues associated with moving prey. Animals with impaired VNSs showed a decreased foraging efficiency on stationary prey under both dark and light conditions. In addition, a mark-recapture study of VNS-impaired and sham salamanders in the field also indicated that salamanders with impaired VNSs consumed fewer stationary prey compared to shams. The study indicates that the VNS plays a substantial role in the foraging behavior of the plethodontid salamander, P. cinereus.

  7. Effects of Red-Backed Salamanders on Ecosystem Functions

    PubMed Central

    Hocking, Daniel J.; Babbitt, Kimberly J.

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m2 plots) and small-scale enclosures (2 m2) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m−2). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types. PMID:24466269

  8. Effects of red-backed salamanders on ecosystem functions.

    PubMed

    Hocking, Daniel J; Babbitt, Kimberly J

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m(2) plots) and small-scale enclosures (2 m(2)) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m(-2)). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types. PMID:24466269

  9. Marbles, Anyone? Traditional Games in the Classroom.

    ERIC Educational Resources Information Center

    Casbergue, Renee M.; Kieff, Judith

    1998-01-01

    Children now play more solitary games, perhaps missing benefits of traditional games such as jacks, marbles, and dominoes. Such games offer children of all backgrounds the opportunity to consolidate knowledge and skills, develop a more orderly way of thinking, and establish themselves with peers. By making these games available in classrooms,…

  10. Lead poisoning of a marbled godwit

    USGS Publications Warehouse

    Locke, L.N.; Smith, M.R.; Windingstad, R.M.; Martin, S.J.

    1991-01-01

    A thin adult female marbled godwit (Limosa fedoa) found dead at Benton Lake National Wildlife Refuge, Montana, was found to have 17 ingested lead shot in its gizzard. Its liver contained 51.7 ppm lead (wet weight). Based on these necropsy findings a diagnosis of lead poisoning was made.

  11. Data Collection and the Marble Company.

    ERIC Educational Resources Information Center

    Harper, Nancy L.

    A study investigated how managers in various kinds of organizations make decisions and also examined ways that using the Marble Company simulation (developed by L. C. Lederman and L. P. Stewart in 1985) could enhance, clarify, and extend its findings. Managers were asked to write down what they would say to their subordinates in order to elicit…

  12. An Environmental Handbook of the Marble Area.

    ERIC Educational Resources Information Center

    Campbell, Dan

    The Elk Range located in the very center of the Colorado Rocky Mountains is described in this guide to the Maroon Bells-Snowmass Wilderness Area. Near the ghost town of Marble, Colorado, this wilderness area is described as 66,000 acres 150 miles outside Denver encompassing 25% of all established wilderness in Colorado, 130 miles of marked trails,…

  13. Insertion and confinement of air bubbles inside a liquid marble.

    PubMed

    Sun, Guanqing; Sheng, Yifeng; Ngai, To

    2016-01-14

    Nanoparticles at the air/liquid interface can serve as solid separating barriers to form stable foams or liquid marbles depending on the wettability of the nanoparticles. This paper presents an effect that enables the insertion and confinement of air bubbles inside a liquid marble, based on encapsulating an air bubble surrounded by surfactant molecules or hydrophilic particles. We have demonstrated that more than one bubble can be inserted and trapped inside one liquid marble so that liquid marbles can be divided into several separate compartments. The findings presented here may stimulate fundamental studies of this novel bubble-marble phenomenon, as well as developments of various practical applications.

  14. Paedomorphosis and simplification in the nervous system of salamanders.

    PubMed

    Roth, G; Nishikawa, K C; Naujoks-Manteuffel, C; Schmidt, A; Wake, D B

    1993-01-01

    Comparative neuroanatomists since Herrick [1914] have been aware of the paradox that the brain of amphibians, especially salamanders, is less complex than one would expect based on their phylogenetic position among the Tetrapoda. Many features of the brain are less differentiated in salamanders than in tetrapod outgroups, including chondrichthyans and bony fishes, and for some brain characters, the salamander brain is even more simple than that of the agnathans. Here, we perform a cladistic analysis on 23 characters of four sensory systems (visual, auditory, lateral line and olfactory) and the brain. Our taxa include myxinoids, lampreys, chondrichthyans, actinopterygians, Latimeria, Neoceratodus and the lepidosirenid lungfishes, amniotes, frogs, caecilians, salamanders and bolitoglossine salamanders. Of the 23 characters we examined, 19 are most parsimoniously interpreted as secondarily simplified in salamanders from a more complex ancestral state, two characters are equally parsimonious under both hypotheses, one character (well developed ipsilateral retinotectal projections) is more complex in bolitoglossine salamanders than in vertebrates generally, and only one character (migration of neurons in the medial pallium) is most parsimoniously interpreted as retention of the plesiomorphically simple condition. Secondary simplification of the salamander brain appears to result from paedomorphosis, or retention of juvenile or embryonic morphology into adulthood. Paedomorphosis is correlated with an increase in genome size, which in turn is positively correlated with cell size, but negatively correlated with cell proliferation and differentiation rates. Available data suggest that, although increasing genome size and paedomorphosis tend to compromise the function of the salamander brain, compensating mechanisms have evolved that may restore or even enhance brain function. PMID:8364715

  15. Edible liquid marbles and capsules covered with lipid crystals.

    PubMed

    Kawamura, Yuki; Mayama, Hiroyuki; Nonomura, Yoshimune

    2012-01-01

    Liquid marbles are water droplets covered with solid particles. Here we show a method for the preparation of edible liquid marbles and capsules covered with fatty acid crystals and triacylglycerol crystals. We prepared liquid marbles using a simple method; namely, a water droplet was rolled on lipid crystals in petri dishes. The resulting marbles were converted to capsules covered with a lipid shell by heating. These marbles were stable not only on glass surfaces but also on water surfaces because they had rigid hydrophobic exteriors. The lifetime of the liquid marbles on water depended on the alkyl chain length of the lipid molecules and the pH of the water. These findings are useful for applying liquid marbles to food, cosmetic, and medical products. PMID:22975781

  16. Locomotion and visually guided behavior in salamander: a neuromechanical study

    NASA Astrophysics Data System (ADS)

    Ijspeert, Auke J.; Arbib, Michael A.

    2000-10-01

    This article investigates the neural mechanisms underlying locomotion and visually-guided behavior in a lower vertebrate: the salamander. We develop connectionist models of the salamander's locomotor circuitry and visual system, and analyze their functioning by embedding them into a biomechanical simulation of the salamander's body. This work is therefore an experiment in computational neuroethology which aims at investigating how behavior results from the coupling of a central nervous system (CNS) and a body, and from the interactions of the CNS-body pair with the environment. We believe that understanding these mechanisms is not only relevant for neurobiology but also for potential applications in robotics.

  17. Generation of aneurogenic larvae by parabiosis of salamander embryos.

    PubMed

    Kumar, Anoop; Delgado, Jean Paul

    2015-01-01

    Limb regeneration of salamanders is nerve dependent, and the removal of the nerves in early stages of limb regeneration severely curtails the proliferation of the blastemal cells and growth of the regenerate. The removal of the neural tube from a developing salamander embryo results in an aneurogenic larva and the aneurogenic limb (ANL) develops independently without innervation. Paradoxically, the limb in an ANL is capable of regeneration in a nerve-independent manner. Here, we describe a detailed method for the generation of ANL in the spotted salamander, Ambystoma maculatum, for regeneration studies.

  18. Could we also be regenerative superheroes, like salamanders?

    PubMed

    Dall'Agnese, Alessandra; Puri, Pier Lorenzo

    2016-09-01

    Development of methods to reawaken the semi-dormant regenerative potential that lies within adult human tissues would hold promise for the restoration of diseased or damaged organs and tissues. While most of the regeneration potential is suppressed in many vertebrates, including humans, during adult life, urodele amphibians (salamanders) retain their regenerative ability throughout adulthood. Studies in newts and axolotls, two salamander models, have provided significant knowledge about adult limb regeneration. In this review, we present a comparative analysis of salamander and mammalian regeneration and discuss how evolutionarily altered properties of the regenerative environment can be exploited to restore full regenerative potential in the human body. PMID:27338874

  19. Could we also be regenerative superheroes, like salamanders?

    PubMed

    Dall'Agnese, Alessandra; Puri, Pier Lorenzo

    2016-09-01

    Development of methods to reawaken the semi-dormant regenerative potential that lies within adult human tissues would hold promise for the restoration of diseased or damaged organs and tissues. While most of the regeneration potential is suppressed in many vertebrates, including humans, during adult life, urodele amphibians (salamanders) retain their regenerative ability throughout adulthood. Studies in newts and axolotls, two salamander models, have provided significant knowledge about adult limb regeneration. In this review, we present a comparative analysis of salamander and mammalian regeneration and discuss how evolutionarily altered properties of the regenerative environment can be exploited to restore full regenerative potential in the human body.

  20. Innocent until proven guilty? Stable coexistence of alien rainbow trout and native marble trout in a Slovenian stream

    NASA Astrophysics Data System (ADS)

    Vincenzi, Simone; Crivelli, Alain J.; Jesensek, Dusan; Rossi, Gianluigi; de Leo, Giulio A.

    2011-01-01

    To understand the consequences of the invasion of the nonnative rainbow trout Oncorhynchus mykiss on the native marble trout Salmo marmoratus, we compared two distinct headwater sectors where marble trout occur in allopatry (MTa) or sympatry (MTs) with rainbow trout (RTs) in the Idrijca River (Slovenia). Using data from field surveys from 2002 to 2009, with biannual (June and September) sampling and tagging from June 2004 onwards, we analyzed body growth and survival probabilities of marble trout in each stream sector. Density of age-0 in September over the study period was greater for MTs than MTa and very similar between MTs and RTs, while density of trout ≥age-1 was similar for MTa and MTs and greater than density of RTs. Monthly apparent survival probabilities were slightly higher in MTa than in MTs, while RTs showed a lower survival than MTs. Mean weight of marble and rainbow trout aged 0+ in September was negatively related to cohort density for both marble and rainbow trout, but the relationship was not significantly different between MTs and MTa. No clear depression of body growth of sympatric marble trout between sampling intervals was observed. Despite a later emergence, mean weight of RTs cohorts at age 0+ in September was significantly higher than weight of both MTs and MTa. The establishment of a self-sustaining population of rainbow trout does not have a significant impact on body growth and survival probabilities of sympatric marble trout. The numerical dominance of rainbow trout in streams at lower altitudes seem to suggest that while the low summer flow pattern of Slovenian streams is favorable for rainbow trout invasion, the adaptation of marble trout to headwater environments may limit the invasion success of rainbow trout in headwaters.

  1. Salamander chytrid fungus (Batrachochytrium salamandrivorans) in the United States—Developing research, monitoring, and management strategies

    USGS Publications Warehouse

    Grant, Evan H. Campbell; Muths, Erin L.; Katz, Rachel A.; Canessa, Stefano; Adams, Michael J.; Ballard, Jennifer R.; Berger, Lee; Briggs, Cheryl J.; Coleman, Jeremy; Gray, Matthew J.; Harris, M. Camille; Harris, Reid N.; Hossack, Blake R.; Huyvaert, Kathryn P.; Kolby, Jonathan E.; Lips, Karen R.; Lovich, Robert E.; McCallum, Hamish I.; Mendelson, Joseph R.; Nanjappa, Priya; Olson, Deanna H.; Powers, Jenny G.; Richgels, Katherine L.D.; Russell, Robin E.; Schmidt, Benedikt R.; Spitzen-van der Sluijs, Annemarieka; Watry, Mary Kay; Woodhams, Douglas C.; White, C. LeAnn

    2016-01-20

    The recently (2013) identified pathogenic chytrid fungus, Batrachochytrium salamandrivorans (Bsal), poses a severe threat to the distribution and abundance of salamanders within the United States and Europe. Development of a response strategy for the potential, and likely, invasion of Bsal into the United States is crucial to protect global salamander biodiversity. A formal working group, led by Amphibian Research and Monitoring Initiative (ARMI) scientists from the U.S. Geological Survey (USGS) Patuxent Wildlife Research Center, Fort Collins Science Center, and Forest and Rangeland Ecosystem Science Center, was held at the USGS Powell Center for Analysis and Synthesis in Fort Collins, Colorado, United States from June 23 to June 25, 2015, to identify crucial Bsal research and monitoring needs that could inform conservation and management strategies for salamanders in the United States. Key findings of the workshop included the following: (1) the introduction of Bsal into the United States is highly probable, if not inevitable, thus requiring development of immediate short-term and long-term intervention strategies to prevent Bsal establishment and biodiversity decline; (2) management actions targeted towards pathogen containment may be ineffective in reducing the long-term spread of Bsal throughout the United States; and (3) early detection of Bsal through surveillance at key amphibian import locations, among high-risk wild populations, and through analysis of archived samples is necessary for developing management responses. Top research priorities during the preinvasion stage included the following: (1) deployment of qualified diagnostic methods for Bsal and establishment of standardized laboratory practices, (2) assessment of susceptibility for amphibian hosts (including anurans), and (3) development and evaluation of short- and long-term pathogen intervention and management strategies. Several outcomes were achieved during the workshop, including development

  2. Salamander chytrid fungus (Batrachochytrium salamandrivorans) in the United States—Developing research, monitoring, and management strategies

    USGS Publications Warehouse

    Grant, Evan H. Campbell; Muths, Erin L.; Katz, Rachel A.; Canessa, Stefano; Adams, Michael J.; Ballard, Jennifer R.; Berger, Lee; Briggs, Cheryl J.; Coleman, Jeremy; Gray, Matthew J.; Harris, M. Camille; Harris, Reid N.; Hossack, Blake R.; Huyvaert, Kathryn P.; Kolby, Jonathan E.; Lips, Karen R.; Lovich, Robert E.; McCallum, Hamish I.; Mendelson, Joseph R., III; Nanjappa, Priya; Olson, Deanna H.; Powers, Jenny G.; Richgels, Katherine L.D.; Russell, Robin E.; Schmidt, Benedikt R.; Spitzen-van der Sluijs, Annemarieka; Watry, Mary Kay; Woodhams, Douglas C.; White, C. LeAnn

    2016-01-01

    The recently (2013) identified pathogenic chytrid fungus, Batrachochytrium salamandrivorans (Bsal), poses a severe threat to the distribution and abundance of salamanders within the United States and Europe. Development of a response strategy for the potential, and likely, invasion of Bsal into the United States is crucial to protect global salamander biodiversity. A formal working group, led by Amphibian Research and Monitoring Initiative (ARMI) scientists from the U.S. Geological Survey (USGS) Patuxent Wildlife Research Center, Fort Collins Science Center, and Forest and Rangeland Ecosystem Science Center, was held at the USGS Powell Center for Analysis and Synthesis in Fort Collins, Colorado, United States from June 23 to June 25, 2015, to identify crucial Bsal research and monitoring needs that could inform conservation and management strategies for salamanders in the United States. Key findings of the workshop included the following: (1) the introduction of Bsal into the United States is highly probable, if not inevitable, thus requiring development of immediate short-term and long-term intervention strategies to prevent Bsal establishment and biodiversity decline; (2) management actions targeted towards pathogen containment may be ineffective in reducing the long-term spread of Bsal throughout the United States; and (3) early detection of Bsal through surveillance at key amphibian import locations, among high-risk wild populations, and through analysis of archived samples is necessary for developing management responses. Top research priorities during the preinvasion stage included the following: (1) deployment of qualified diagnostic methods for Bsal and establishment of standardized laboratory practices, (2) assessment of susceptibility for amphibian hosts (including anurans), and (3) development and evaluation of short- and long-term pathogen intervention and management strategies. Several outcomes were achieved during the workshop, including development

  3. Acute toxicity of some hydrazine compounds to salamander larvae, Ambystoma spp

    SciTech Connect

    Slonim, A.R.

    1986-11-01

    Although hydrazine compounds have been used extensively by industry for a very long time, they have become important in recent years as propellants for aerospace operations. The study of hydrazine compounds in this laboratory began about two decades ago and developed into a large pharmacological and toxicological research program that included also environmental considerations. Subsequently, acute toxicity studies were conducted on the common guppy (Lebistes reticulatus Peters) using four hydrazine compounds of interest. The toxicity of these propellants were evaluated next on other species of aquatic organisms such as mosquito fish (Gambusia affinis) and amphibians. Two different studies were conducted on amphibians: One utilized amphibian eggs and the other amphibian larvae. The larvae of spotted and marbled salamanders (Ambystoma maculatum and A. opacum, respectively) were used primarily in numerous static bioassays to determine the acute toxicity of hydrazine, UDMH and Aerozine-50 on these organisms. The remaining larvae were used in other tests mainly to corroborate previous experimental results (e.g., to see whether toxicity is affected by organism size, aeration of test solutions, and water hardness). The results on the larvae are presented in this paper.

  4. Salamander-like development in a seymouriamorph revealed by palaeohistology.

    PubMed

    Sanchez, Sophie; Klembara, Jozef; Castanet, Jacques; Steyer, J Sébastien

    2008-08-23

    The amniotes generally lay eggs on land and are thereby differentiated from lissamphibians (salamanders, frogs and caecilians) by their developmental pattern. Although a number of 330-300-Myr old fossils are regarded as early tetrapods placed close to amniotes on the basis of anatomical data, we still do not know whether their developmental pattern was more similar to those of lissamphibians or amniotes. Here we report palaeohistological and skeletochronological evidence supporting a salamander-like development in the seymouriamorph Discosauriscus. Its long-bone growth pattern, slow diaphyseal growth rate and delayed sexual maturity (at more than 10 years old) are more comparable with growth features of extant salamanders rather than extant amniotes, even though they are mostly hypothesized to be phylogenetically closer to living amniotes than salamanders.

  5. Habitat requirements of New Mexico’s endangered salamanders

    USGS Publications Warehouse

    Ramotnik, Cindy A.; Scott, N.J.

    1988-01-01

    We measured habitat components for two state-listed endangered salamanders in New Mexico in 1986 and 1987. Both species are restricted to mesic environments within high-elevation, mixed coniferous forests. Steep slope and high elevation were the most useful variables for predicting the occurrence of Jemez Mountains salamanders and Sacramento Mountain salamanders, respectively. Although the discriminant models show some predictive value in detecting salamanders based on habitat variables, we believe that the best survey technique is ground-truth surveys in wet weather. A better fit of the discriminant models might be obtained by including variables not measured e.g., fire and logging history, and soil characteristics. We offer interim management guidelines as a result of our analysis.

  6. Salamander-like development in a seymouriamorph revealed by palaeohistology.

    PubMed

    Sanchez, Sophie; Klembara, Jozef; Castanet, Jacques; Steyer, J Sébastien

    2008-08-23

    The amniotes generally lay eggs on land and are thereby differentiated from lissamphibians (salamanders, frogs and caecilians) by their developmental pattern. Although a number of 330-300-Myr old fossils are regarded as early tetrapods placed close to amniotes on the basis of anatomical data, we still do not know whether their developmental pattern was more similar to those of lissamphibians or amniotes. Here we report palaeohistological and skeletochronological evidence supporting a salamander-like development in the seymouriamorph Discosauriscus. Its long-bone growth pattern, slow diaphyseal growth rate and delayed sexual maturity (at more than 10 years old) are more comparable with growth features of extant salamanders rather than extant amniotes, even though they are mostly hypothesized to be phylogenetically closer to living amniotes than salamanders. PMID:18460423

  7. Defining evolutionary boundaries across parapatric ecomorphs of Black Salamanders (Aneides flavipunctatus) with conservation implications.

    PubMed

    Reilly, Sean B; Marks, Sharyn B; Jennings, W Bryan

    2012-12-01

    The accurate delimitation of evolutionary population units represents an important component in phylogeographic and conservation genetic studies. Here, we used a combined population assignment and historical demographic approach to study a complex of ecomorphologically distinctive populations of Black Salamanders (Aneides flavipunctatus) that are parapatrically distributed and meet at a three-way contact zone in north-western California. We used mitochondrial tree-based and multilocus clustering methods to evaluate a priori two- (Northern and Southern) and three (Northern, Coast and Inland) population hypotheses derived from previous studies. Mitochondrial results were consistent with the two- and three-population hypotheses, while the nDNA clustering results supported only the two-population hypothesis. Historical demographic analyses and mtDNA gene divergence estimates revealed that the Northern and Southern populations split during the Pliocene (2-5 Ma). Subdivision of the Southern population into Coast and Inland populations was estimated to be late Pleistocene (0.24 Ma), although our mtDNA results suggested a Pliocene divergence. Effective gene flow estimates (2N(e)m) suggest that either the two- or three-population hypotheses remain valid. However, our results unexpectedly revealed that the Northern population might instead represent two parapatric populations that separated nearly 4 Ma. These results are surprising because the Pliocene divergence between these ecomorphologically conservative forms is similar or older than for the ecomorphologically divergent Coast and Inland sister populations. We conclude that Black Salamanders in north-western California belong to at least three or four populations or species, and these all meet criteria for being Evolutionary Significant Units or 'ESUs' and therefore warrant conservation consideration.

  8. Reduced effects of thyroid hormone on gene expression and metamorphosis in a paedomorphic plethodontid salamander.

    PubMed

    Aran, Robert P; Steffen, Michael A; Martin, Samuel D; Lopez, Olivia I; Bonett, Ronald M

    2014-07-01

    It has been over a century since Gudernatsch (1912, Wilhelm Roux Arch Entwickl Mech Org 35:457-483) demonstrated that mammalian thyroid gland extracts can stimulate tadpole metamorphosis. Despite the tremendous developmental diversity of amphibians, mechanisms of metamorphosis have mostly been studied in a few model systems. This limits our understanding of the processes that influence the evolution of developmental aberrations. Here we isolated thyroid hormone receptors alpha (TRα) and beta (TRβ) from Oklahoma salamanders (Eurycea tynerensis), which exhibit permanently aquatic (paedomorphic) or biphasic (metamorphic) developmental modes in different populations. We found that TRα and TRβ were upregulated by thyroid hormone (T3 ) in tail tissues of larvae from metamorphic populations, but basal levels of TR expression and T3 responsiveness were reduced in larvae from paedomorphic populations. Likewise, we found that T3 treatment resulted in complete loss of larval epibranchials in larvae from metamorphic populations, but little to no epibranchial remodeling occurred in larvae from paedomorphic populations over the same duration. This is the first study to directly demonstrate reduced gene expression and metamorphic responses to T3 in a paedomorphic plethodontid compared to metamorphic conspecifics, and the first salamander system to show differential expression of thyroid hormone receptors associated with alternative developmental patterns.

  9. High strain rate damage of Carrara marble

    NASA Astrophysics Data System (ADS)

    Doan, Mai-Linh; Billi, Andrea

    2011-10-01

    Several cases of rock pulverization have been observed along major active faults in granite and other crystalline rocks. They have been interpreted as due to coseismic pervasive microfracturing. In contrast, little is known about pulverization in carbonates. With the aim of understanding carbonate pulverization, we investigate the high strain rate (c. 100 s-1) behavior of unconfined Carrara marble through a set of experiments with a Split Hopkinson Pressure Bar. Three final states were observed: (1) at low strain, the sample is kept intact, without apparent macrofractures; (2) failure is localized along a few fractures once stress is larger than 100 MPa, corresponding to a strain of 0.65%; (3) above 1.3% strain, the sample is pulverized. Contrary to granite, the transition to pulverization is controlled by strain rather than strain rate. Yet, at low strain rate, a sample from the same marble displayed only a few fractures. This suggests that the experiments were done above the strain rate transition to pulverization. Marble seems easier to pulverize than granite. This creates a paradox: finely pulverized rocks should be prevalent along any high strain zone near faults through carbonates, but this is not what is observed. A few alternatives are proposed to solve this paradox.

  10. Using stable isotopes to test for trophic niche partitioning: a case study with stream salamanders and fish

    USGS Publications Warehouse

    Sepulveda, Adam; Lowe, Winsor H.; Marra, Peter P.

    2012-01-01

    5. Although we did not identify mechanisms that facilitate salamander and fish coexistence, our empirical data and use of novel approaches to describe the trophic niche did yield important insights on the role of predator–prey interactions and cannibalism as alternative coexistence mechanisms. In addition, we found that 95% kernel estimators are a simple and robust method to describe population-level measure of trophic structure.

  11. Study of marble deterioration at City Hall, Schenectady, NY

    SciTech Connect

    Cheng, R.J.; Castillo, R.

    1984-01-01

    The effects of air pollution and acid precipitation were investigated as causing the erosion of marble. The research indicated that the marble grains are being structurally weakened by a chemical conversion process of marble to gypsum crystals. The surface zone of chemical activity (2-5 mm) shows the presence of fly ash and iron particles, and points to the possibility of a catalytic mechanism for the conversion of sulfur dioxide to sulfate.

  12. Multiple paternity in a salamander with socially monogamous behaviour.

    PubMed

    Liebgold, Eric B; Cabe, Paul R; Jaeger, Robert G; Leberg, Paul L

    2006-11-01

    In the majority of birds and mammals, social monogamy is not congruent with genetic monogamy. No research to date has compared social and genetic monogamy in amphibians. We analysed paternity in clutches of red-backed salamanders (Plethodon cinereus), a species in which social monogamy has been demonstrated in the laboratory, and 28% of individuals in the forest are found in male-female pairs in the noncourtship season. We collected 16 clutches of eggs of P. cinereus in the southern Appalachian Mountains of Virginia and collected tail clippings from attending mothers. We genotyped embryos and adults at five microsatellite loci in order to analyse paternity of clutches. Most clutches (84.6%) had multiple sires, with two to three sires per clutch. In this study, 25% of clutches had males in addition to females attending eggs. None of the mothers of these clutches were genetically monogamous. All attending males sired some of the offspring in the clutch that they attended (between 9% and 50%) but never sired a majority in that clutch. We conclude that, at least in this population, social monogamy in P. cinereus is not concomitant with genetic monogamy.

  13. Asymmetric Introgression in a Spotted Salamander Hybrid Zone.

    PubMed

    Johnson, Benjamin B; White, Thomas A; Phillips, Christopher A; Zamudio, Kelly R

    2015-01-01

    Before the establishment of reproductive isolation, deeply diverged intraspecific lineages can experience complex genetic and behavioral interactions as they come into secondary contact. Divergent selective and demographic processes mediate gene flow among lineages, resulting in hybrid zones with complex biogeographic structure. Discordance in the biogeographic patterns of autosomal and maternally inherited loci provides a useful window to infer the processes mediating admixture and introgression across hybrid zones. Here, we sampled 489 genotypes across a hybrid zone between 2 phylogeographic lineages of the spotted salamander, Ambystoma maculatum, and characterize discordant patterns of nuclear and mitochondrial introgression across the contact boundary. Our results indicate asymmetric introgression of nuclear DNA beyond the contact boundary from the western to eastern lineage, with introgression of eastern mitochondrial DNA into the western lineage. We discuss alternative mechanisms for this pattern and attribute this result to neutral patterns of population expansion of the western lineage into the east in combination with female mate choice for larger-bodied western males. Our results underscore the complexity of interacting mechanisms that give rise to reproductive asymmetries in the earliest stages of the speciation process. PMID:26136297

  14. Using counts to simultaneously estimate abundance and detection probabilities in a salamander community

    USGS Publications Warehouse

    Dodd, C.K.; Dorazio, R.M.

    2004-01-01

    A critical variable in both ecological and conservation field studies is determining how many individuals of a species are present within a defined sampling area. Labor intensive techniques such as capture-mark-recapture and removal sampling may provide estimates of abundance, but there are many logistical constraints to their widespread application. Many studies on terrestrial and aquatic salamanders use counts as an index of abundance, assuming that detection remains constant while sampling. If this constancy is violated, determination of detection probabilities is critical to the accurate estimation of abundance. Recently, a model was developed that provides a statistical approach that allows abundance and detection to be estimated simultaneously from spatially and temporally replicated counts. We adapted this model to estimate these parameters for salamanders sampled over a six vear period in area-constrained plots in Great Smoky Mountains National Park. Estimates of salamander abundance varied among years, but annual changes in abundance did not vary uniformly among species. Except for one species, abundance estimates were not correlated with site covariates (elevation/soil and water pH, conductivity, air and water temperature). The uncertainty in the estimates was so large as to make correlations ineffectual in predicting which covariates might influence abundance. Detection probabilities also varied among species and sometimes among years for the six species examined. We found such a high degree of variation in our counts and in estimates of detection among species, sites, and years as to cast doubt upon the appropriateness of using count data to monitor population trends using a small number of area-constrained survey plots. Still, the model provided reasonable estimates of abundance that could make it useful in estimating population size from count surveys.

  15. "Big Blue Marble" Fact Sheet and "Big Blue Marble" Program Content (Shows 1 through 78).

    ERIC Educational Resources Information Center

    International Telephone and Telegraph Corp., New York, NY.

    This booklet describes the content of 78 programs presented in the "Big Blue Marble" series, an international series of children's television shows sponsored by the International Telephone and Telegraph Corporation. The major sequence of subjects is given, as well as a description of each program's folktale adaptation (a regular feature) and…

  16. A potential wound-healing-promoting peptide from salamander skin.

    PubMed

    Mu, Lixian; Tang, Jing; Liu, Han; Shen, Chuanbin; Rong, Mingqiang; Zhang, Zhiye; Lai, Ren

    2014-09-01

    Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

  17. Are Salamanders Useful Indicators of Hydrologic Permanence in Headwater Streams?

    NASA Astrophysics Data System (ADS)

    Johnson, B.; Fritz, K.

    2005-05-01

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collected in spring and summer 2003 from 59 sites located longitudinally along 17 forested streams in KY, IN, and OH. Larval Eurycea bislineata/cirrigera dominated all forests, and their abundances were highly correlated with drainage areas and channel dimensions. Appalachian streams were more diverse and had intermittent sites with more Desmognathus and Gyrinophilus spp. Of 22 sites where larvae were collected in spring, 9 sites subsequently dried in summer, suggesting salamanders either emigrated or died. We therefore only used taxa with multi-year larval stages as indicators of perennial water. Salamander larvae >1 yr old were collected from each locality in drainage areas <0.17 km2. However, these older larvae were often found in isolated pools that serve as refugia during dry periods. Findings suggest salamanders with multi-year larval periods can indicate perennial waters and that their use is more effective in Appalachia where abundance and diversity are high. Although this work was reviewed by EPA and approved for publication, it may not necessarily reflect official Agency policy.

  18. Thyroid hormone responsive QTL and the evolution of paedomorphic salamanders

    PubMed Central

    Voss, S R; Kump, D K; Walker, J A; Shaffer, H B; Voss, G J

    2012-01-01

    The transformation of ancestral phenotypes into novel traits is poorly understood for many examples of evolutionary novelty. Ancestrally, salamanders have a biphasic life cycle with an aquatic larval stage, a brief and pronounced metamorphosis, followed by a terrestrial adult stage. Repeatedly during evolution, metamorphic timing has been delayed to exploit growth-permissive environments, resulting in paedomorphic salamanders that retain larval traits as adults. We used thyroid hormone (TH) to rescue metamorphic phenotypes in paedomorphic salamanders and then identified quantitative trait loci (QTL) for life history traits that are associated with amphibian life cycle evolution: metamorphic timing and adult body size. We demonstrate that paedomorphic tiger salamanders (Ambystoma tigrinum complex) carry alleles at three moderate effect QTL (met1–3) that vary in responsiveness to TH and additively affect metamorphic timing. Salamanders that delay metamorphosis attain significantly larger body sizes as adults and met2 explains a significant portion of this variation. Thus, substitution of alleles at TH-responsive loci suggests an adaptive pleiotropic basis for two key life-history traits in amphibians: body size and metamorphic timing. Our study demonstrates a likely pathway for the evolution of novel paedomorphic species from metamorphic ancestors via selection of TH-response alleles that delay metamorphic timing and increase adult body size. PMID:22850698

  19. Coprophagy in a cave-adapted salamander; the importance of bat guano examined through nutritional and stable isotope analyses

    PubMed Central

    Fenolio, Danté B; Graening, G.O; Collier, Bret A; Stout, Jim F

    2005-01-01

    During a two year population ecology study in a cave environment, 15 Eurycea (=Typhlotriton) spelaea were observed ingesting bat guano. Furthermore, E. spelaea capture numbers increased significantly during the time that grey bats (Myotis grisescens) deposited fresh guano. We investigated the hypothesis that this behaviour was not incidental to the capture of invertebrate prey, but a diet switch to an energy-rich detritus in an oligotrophic environment. Stable isotope assays determined that guano may be assimilated into salamander muscle tissue, and nutritional analyses revealed that guano is a comparable food source to potential invertebrate prey items. This is the first report of coprophagy in a salamander and in any amphibian for reasons other than intestinal inoculation. Because many temperate subterranean environments are often energy poor and this limitation is thought to select for increased diet breadth, we predict that coprophagy may be common in subterranean vertebrates where it is not currently recognized. PMID:16615210

  20. Coprophagy in a cave-adapted salamander; the importance of bat guano examined through nutritional and stable isotope analyses.

    PubMed

    Fenolio, Danté B; Graening, G O; Collier, Bret A; Stout, Jim F

    2006-02-22

    During a two year population ecology study in a cave environment, 15 Eurycea (= Typhlotriton) spelaea were observed ingesting bat guano. Furthermore, E. spelaea capture numbers increased significantly during the time that grey bats (Myotis grisescens) deposited fresh guano. We investigated the hypothesis that this behaviour was not incidental to the capture of invertebrate prey, but a diet switch to an energy-rich detritus in an oligotrophic environment. Stable isotope assays determined that guano may be assimilated into salamander muscle tissue, and nutritional analyses revealed that guano is a comparable food source to potential invertebrate prey items. This is the first report of coprophagy in a salamander and in any amphibian for reasons other than intestinal inoculation. Because many temperate subterranean environments are often energy poor and this limitation is thought to select for increased diet breadth, we predict that coprophagy may be common in subterranean vertebrates where it is not currently recognized.

  1. Electrostatic formation of liquid marbles and agglomerates

    NASA Astrophysics Data System (ADS)

    Liyanaarachchi, K. R.; Ireland, P. M.; Webber, G. B.; Galvin, K. P.

    2013-07-01

    We report observations of a sudden, explosive release of electrostatically charged 100 μm glass beads from a particle bed. These cross an air gap of several millimeters, are engulfed by an approaching pendant water drop, and form a metastable spherical agglomerate on the bed surface. The stability transition of the particle bed is explained by promotion of internal friction by in-plane electrostatic stresses. The novel agglomerates formed this way resemble the "liquid marbles" formed by coating a drop with hydrophobic particles. Complex multi-layered agglomerates may also be produced by this method, with potential industrial, pharmaceutical, environmental, and biological applications.

  2. Blue Marble Space Institute essay contest

    NASA Astrophysics Data System (ADS)

    Wendel, JoAnna

    2014-04-01

    The Blue Marble Space Institute of Science, based in Seattle, Wash., is inviting college students to participate in its essay contest. Essays need to address the question, "In the next 100 years, how can human civilization prepare for the long-term changes to the Earth system that will occur over the coming millennium?" According to the institute, the purpose of the contest is "to stimulate creative thinking relating to space exploration and global issues by exploring how changes in the Earth system will affect humanity's future."

  3. Response of the green alga Oophila sp., a salamander endosymbiont, to a PSII-inhibitor under laboratory conditions.

    PubMed

    Baxter, Leilan; Brain, Richard; Rodriguez-Gil, Jose Luis; Hosmer, Alan; Solomon, Keith; Hanson, Mark

    2014-08-01

    In a rare example of autotroph-vertebrate endosymbiosis, eggs of the yellow-spotted salamander (Ambystoma maculatum) are colonized by a green alga (Oophila sp.) that significantly enhances salamander development. Previous studies have demonstrated the potential for impacts to the salamander embryo when growth of the algae is impaired by exposure to herbicides. To further investigate this relationship, the authors characterized the response of the symbiotic algae (Oophila sp.) alone to the photosystem II (PSII) inhibitor atrazine under controlled laboratory conditions. After extraction of the alga from A. maculatum eggs and optimization of culturing conditions, 4 toxicity assays (96 h each) were conducted. Recovery of the algal population was also assessed after a further 96 h in untreated media. Average median effective concentration (EC50) values of 123 µg L(-1) (PSII yield), 169 µg L(-1) (optical density), and 299 µg L(-1) (growth rate) were obtained after the 96-h exposure. Full recovery of exposed algal populations after 96 h in untreated media was observed for all endpoints, except for optical density at the greatest concentration tested (300 µg L(-1) ). Our results show that, under laboratory conditions, Oophila sp. is generally less sensitive to atrazine than standard test species. Although conditions of growth in standard toxicity tests are not identical to those in the natural environment, these results provide an understanding of the tolerance of this alga to PSII inhibitors as compared with other species.

  4. Response of the green alga Oophila sp., a salamander endosymbiont, to a PSII-inhibitor under laboratory conditions.

    PubMed

    Baxter, Leilan; Brain, Richard; Rodriguez-Gil, Jose Luis; Hosmer, Alan; Solomon, Keith; Hanson, Mark

    2014-08-01

    In a rare example of autotroph-vertebrate endosymbiosis, eggs of the yellow-spotted salamander (Ambystoma maculatum) are colonized by a green alga (Oophila sp.) that significantly enhances salamander development. Previous studies have demonstrated the potential for impacts to the salamander embryo when growth of the algae is impaired by exposure to herbicides. To further investigate this relationship, the authors characterized the response of the symbiotic algae (Oophila sp.) alone to the photosystem II (PSII) inhibitor atrazine under controlled laboratory conditions. After extraction of the alga from A. maculatum eggs and optimization of culturing conditions, 4 toxicity assays (96 h each) were conducted. Recovery of the algal population was also assessed after a further 96 h in untreated media. Average median effective concentration (EC50) values of 123 µg L(-1) (PSII yield), 169 µg L(-1) (optical density), and 299 µg L(-1) (growth rate) were obtained after the 96-h exposure. Full recovery of exposed algal populations after 96 h in untreated media was observed for all endpoints, except for optical density at the greatest concentration tested (300 µg L(-1) ). Our results show that, under laboratory conditions, Oophila sp. is generally less sensitive to atrazine than standard test species. Although conditions of growth in standard toxicity tests are not identical to those in the natural environment, these results provide an understanding of the tolerance of this alga to PSII inhibitors as compared with other species. PMID:24782078

  5. Consolidated waste forms: glass marbles and ceramic pellets

    SciTech Connect

    Treat, R.L.; Rusin, J.M.

    1982-05-01

    Glass marbles and ceramic pellets have been developed at Pacific Northwest Laboratory as part of the multibarrier concept for immobilizing high-level radioactive waste. These consolidated waste forms served as substrates for the application of various inert coatings and as ideal-sized particles for encapsulation in protective matrices. Marble and pellet formulations were based on existing defense wastes at Savannah River Plant and proposed commercial wastes. To produce marbles, glass is poured from a melter in a continuous stream into a marble-making device. Marbles were produced at PNL on a vibratory marble machine at rates as high as 60 kg/h. Other marble-making concepts were also investigated. The marble process, including a lead-encapsulation step, was judged as one of the more feasible processes for immobilizing high-level wastes. To produce ceramic pellets, a series of processing steps are required, which include: spray calcining - to dry liquid wastes to a powder; disc pelletizing - to convert waste powders to spherical pellets; sintering - to densify pellets and cause desired crystal formation. These processing steps are quite complex, and thereby render the ceramic pellet process as one of the least feasible processes for immobilizing high-level wastes.

  6. Measurement of the surface tension of liquid marbles.

    PubMed

    Arbatan, Tina; Shen, Wei

    2011-11-01

    The capillary rise and Wilhelmy plate methods have been used to study the "surface tension" of water marbles encapsulated with polytetrafluoroethylene (PTFE) powders of 1-, 35-, and 100-μm particle size. With the capillary rise technique, a glass capillary tube was inserted into a water marble to measure the capillary rise of the water. The Laplace pressure exerted by the water marble was directly measured by comparing the heights of the capillary rise from the marble and from a flat water surface in a beaker. An equation based on Marmur's model was proposed to calculate the water marble surface tension. This method does not require the water contact angle with the supporting solid surface to be considered; it is therefore a simple but efficient method for determining liquid marble surface tension. The Wilhelmy method was used to measure the surface tension of a flat water surface covered by PTFE powder. This method offers a new angle for investigating liquid marble shell properties. A discussion on the nature and the realistic magnitude of liquid marble surface tension is offered. PMID:21910463

  7. Fusulinid marble from Wadi Heimur area, Southeastern Desert, Egypt

    NASA Astrophysics Data System (ADS)

    Ahmed, Abd-Elmohsen A.

    The discovery of Fusulina in the graphitic marble of Wadi Heimur area, located east of Lake Nasser has verified the Carboniferous age previously given by Ahmed and Mahmoud (1984) and Ahmed (1987) for the foraminiferal marble bands of the folded eugeosynclinal sequence outcropping in the Eastern Desert of Egypt.

  8. [Sexual dimorphism of marbled polecat Vormela peregusna (Carnivora: Mustelidae)].

    PubMed

    Rozhnov, V V; Abramov, A V

    2006-01-01

    Analysis of morphometric variation in 26 cranial characters were studied in 85 individuals of marbled polecat Vormela peregusna from Turkmenistan demonstrated a low level of sexual dimorphism in the species. The properties of sexual dimorphism in marbled polecat are discussed in terms of available hypotheses of sexual dimorphism in carnivores.

  9. Landscape influences on dispersal behaviour: a theoretical model and empirical test using the fire salamander, Salamandra infraimmaculata.

    PubMed

    Kershenbaum, Arik; Blank, Lior; Sinai, Iftach; Merilä, Juha; Blaustein, Leon; Templeton, Alan R

    2014-06-01

    When populations reside within a heterogeneous landscape, isolation by distance may not be a good predictor of genetic divergence if dispersal behaviour and therefore gene flow depend on landscape features. Commonly used approaches linking landscape features to gene flow include the least cost path (LCP), random walk (RW), and isolation by resistance (IBR) models. However, none of these models is likely to be the most appropriate for all species and in all environments. We compared the performance of LCP, RW and IBR models of dispersal with the aid of simulations conducted on artificially generated landscapes. We also applied each model to empirical data on the landscape genetics of the endangered fire salamander, Salamandra infraimmaculata, in northern Israel, where conservation planning requires an understanding of the dispersal corridors. Our simulations demonstrate that wide dispersal corridors of the low-cost environment facilitate dispersal in the IBR model, but inhibit dispersal in the RW model. In our empirical study, IBR explained the genetic divergence better than the LCP and RW models (partial Mantel correlation 0.413 for IBR, compared to 0.212 for LCP, and 0.340 for RW). Overall dispersal cost in salamanders was also well predicted by landscape feature slope steepness (76%), and elevation (24%). We conclude that fire salamander dispersal is well characterised by IBR predictions. Together with our simulation findings, these results indicate that wide dispersal corridors facilitate, rather than hinder, salamander dispersal. Comparison of genetic data to dispersal model outputs can be a useful technique in inferring dispersal behaviour from population genetic data.

  10. Transcriptomic Analysis of Endangered Chinese Salamander: Identification of Immune, Sex and Reproduction-Related Genes and Genetic Markers

    PubMed Central

    Che, Rongbo; Sun, Yuena; Wang, Rixin; Xu, Tianjun

    2014-01-01

    Background The Chinese salamander (Hynobius chinensis), an endangered amphibian species of salamander endemic to China, has attracted much attention because of its value of studying paleontology evolutionary history and decreasing population size. Despite increasing interest in the Hynobius chinensis genome, genomic resources for the species are still very limited. A comprehensive transcriptome of Hynobius chinensis, which will provide a resource for genome annotation, candidate genes identification and molecular marker development should be generated to supplement it. Principal Findings We performed a de novo assembly of Hynobius chinensis transcriptome by Illumina sequencing. A total of 148,510 nonredundant unigenes with an average length of approximately 580 bp were obtained. In all, 60,388 (40.66%) unigenes showed homologous matches in at least one database and 33,537 (22.58%) unigenes were annotated by all four databases. In total, 41,553 unigenes were categorized into 62 sub-categories by BLAST2GO search, and 19,468 transcripts were assigned to 140 KEGG pathways. A large number of unigenes involved in immune system, local adaptation, reproduction and sex determination were identified, as well as 31,982 simple sequence repeats (SSRs) and 460,923 putative single nucleotide polymorphisms (SNPs). Conclusion This dataset represents the first transcriptome analysis of the Chinese salamander (Hynobius chinensis), an endangered species, to be also the first time of hynobiidae. The transcriptome will provide valuable resource for further research in discovery of new genes, protection of population, adaptive evolution and survey of various pathways, as well as development of molecule markers in Chinese salamander; and reference information for closely related species. PMID:24498226

  11. Digital microfluidics with a magnetically actuated floating liquid marble.

    PubMed

    Khaw, Mei Kum; Ooi, Chin Hong; Mohd-Yasin, Faisal; Vadivelu, Raja; John, James St; Nguyen, Nam-Trung

    2016-06-21

    Controlled actuation of a floating liquid marble, a liquid droplet coated with hydrophobic particles floating on another liquid surface, is a potential digital microfluidics platform for the transport of aqueous solution with minimal volume loss. This paper reports our recent investigation on the magnetic actuation of floating liquid marbles filled with magnetic particles. The magnetic force and frictional force acting on the floating liquid marble determine the horizontal movement of the marble. We varied the magnetic flux density, flux density gradient, concentration of magnetic particles and speed of the marble to elucidate the relationship between the acting forces. We subsequently determined the suitable operating conditions for the actuation and derived the scaling laws for the actuation parameters. PMID:27191398

  12. Coalescence patterns of endemic Tibetan species of stream salamanders (Hynobiidae: Batrachuperus).

    PubMed

    Lu, Bin; Zheng, Yuchi; Murphy, Robert W; Zeng, Xiaomao

    2012-07-01

    Orogenesis of topographically diverse montane regions often drives complex evolutionary histories of species. The extensive biodiversity of the eastern edge of the Tibetan Plateau, which gradually decreases eastwardly, facilitates a comparison of historical patterns. We use coalescence methods to compare species of stream salamanders (Batrachuperus) that occur at high and low elevations. Coalescent simulations reveal that closely related species are likely to have been influenced by different drivers of diversification. Species living in the western high-elevation region with its northsouth extending mountains appear to have experienced colonization via dispersal followed by isolation and divergence. In contrast, species on the eastern low-elevation region, which has many discontinuous mountain ranges, appear to have experienced fragmentation, sometimes staged, of wide-ranging ancestral populations. The two groups of species appear to have been affected differently by glaciation. High-elevation species, which are more resistant to cooler temperatures, appear to have experienced population declines as recently as the last glaciation (0.016-0.032Ma). In contrast, salamanders dwelling in the warmer and wetter habitats at low-elevation environs appear to have been affected less by the relatively recent, milder glaciation, and more so by harsher, extensive glaciations (0.5-0.175 Ma). Thus, elevation, topography and cold tolerance appear to drive evolutionary patterns of diversification and demography even among closely related taxa. The comparison of multiple species in genealogical analyses can lead to an understanding of the evolutionary drivers. PMID:22571598

  13. Phenotypic variation in metamorphosis and paedomorphosis in the salamander Ambystoma talpoideum

    SciTech Connect

    Semlitsch, R.D.; Gibbons, J.W.

    1985-08-01

    Phenotypic variation in metamorphosis and paedomorphosis in the salamander Ambystoma talpoideum was examined to determine its environmental or genetic basis. Eight artificial ponds were maintained, four at each of two environmental treatments: constant water level, to simulate fish-free permanent breeding ponds, and gradual drying out, to simulate temporary breeding ponds. Two populations of salamanders were used, derived from two breeding ponds having different frequencies of paedomorphosis. The water level in the drying treatment was lowered during the last 10 wk of the experimental period with no apparent differences in water chemistry parameters between treatments and only a slight change in water temperature during the last 2 wk. The effects of water level were potentially confounded by those of water temperature, density of larvae, and amount food. Population differences in the frequency of metamorphosis and paedomorphosis could potentially represent genetic differences resulting from the different selective regimes that individuals encounter in breeding ponds varying in drying frequency. 35 references, 3 figures, 4 tables.

  14. Reduced genetic variation in the Japanese giant salamander, Andrias japonicus (Amphibia: Caudata).

    PubMed

    Matsui, Masafumi; Tominaga, Atsushi; Liu, Wan-zhao; Tanaka-Ueno, Tomoko

    2008-10-01

    The phylogenetic relationships among 46 samples from 27 populations of the Japanese giant salamander, Andriasjaponicus and its congener, A. davidianus from China was investigated, using 3664 bp sequences of the mitochondrial genes NADH1, NADH3, cyt b and CR, partial NADH6 and intervening genes. In phylogenetic trees constructed by MP, ML, and Bayesian methods, the family Cryptobranchidae and the genus Andrias both form monophyletic groups. Japanese A. japonicus and Chinese A. davidianus are sister taxa and can be regarded as separate species despite a small degree of genetic differentiation. Andriasjaponicus is divided into central and western clades, but the phylogenetic relationships within the latter clade are unresolved. As previously reported from allozyme analyses, A. japonicus exhibits little genetic differentiation, in strong contrast to salamanders of the genus Hynobius with which their distributions overlap. This reduced genetic variability in A. japonicus is attributable to a unique mating system of polygyny, delayed sexual maturity, notable longevity, life in a stable aquatic environment, and gigantism, as well as bottleneck effects following habitat fragmentation and extinction of local populations during Quaternary glaciations. The species is thus susceptible to extinction by potential environmental fluctuations, and requires extensive conservation measures. PMID:18723097

  15. Non-additive response of larval ringed salamanders to intraspecific density.

    PubMed

    Ousterhout, Brittany H; Semlitsch, Raymond D

    2016-04-01

    Conditions experienced in early developmental stages can have long-term consequences for individual fitness. High intraspecific density during the natal period can affect juvenile and eventually adult growth rates, metabolism, immune function, survival, and fecundity. Despite the important ecological and evolutionary effects of early developmental density, the form of the relationship between natal density and resulting juvenile phenotype is poorly understood. To test competing hypotheses explaining responses to intraspecific density, we experimentally manipulated the initial larval density of ringed salamanders (Ambystoma annulatum), a pond-breeding amphibian, over 11 densities. We modeled the functional form of the relationship between natal density and juvenile traits, and compared the relative support for the various hypotheses based on their goodness of fit. These functional form models were then used to parameterize a simple simulation model of population growth. Our data support non-additive density dependence and presents an alternate hypothesis to additive density dependence, self-thinning and Allee effects in larval amphibians. We posit that ringed salamander larvae may be under selective pressure for tolerance to high density and increased efficiency in resource utilization. Additionally, we demonstrate that models of population dynamics are sensitive to assumptions of the functional form of density dependence. PMID:26683834

  16. Phylogeography and spatial genetic structure of the Southern torrent salamander: Implications for conservation and management

    USGS Publications Warehouse

    Miller, M.P.; Haig, S.M.; Wagner, R.S.

    2006-01-01

    The Southern torrent salamander (Rhyacotriton variegatus) was recently found not warranted for listing under the US Endangered Species Act due to lack of information regarding population fragmentation and gene flow. Found in small-order streams associated with late-successional coniferous forests of the US Pacific Northwest, threats to their persistence include disturbance related to timber harvest activities. We conducted a study of genetic diversity throughout this species' range to 1) identify major phylogenetic lineages and phylogeographic barriers and 2) elucidate regional patterns of population genetic and spatial phylogeographic structure. Cytochrome b sequence variation was examined for 189 individuals from 72 localities. We identified 3 major lineages corresponding to nonoverlapping geographic regions: a northern California clade, a central Oregon clade, and a northern Oregon clade. The Yaquina River may be a phylogeographic barrier between the northern Oregon and central Oregon clades, whereas the Smith River in northern California appears to correspond to the discontinuity between the central Oregon and northern California clades. Spatial analyses of genetic variation within regions encompassing major clades indicated that the extent of genetic structure is comparable among regions. We discuss our results in the context of conservation efforts for Southern torrent salamanders. ?? The American Genetic Association. 2006. All rights reserved.

  17. Spatial genetic structure and regional demography in the southern torrent salamander: Implications for conservation and management

    USGS Publications Warehouse

    Miller, Mark P.; Haig, Susan M.; Wagner, R.S.

    2006-01-01

    The Southern torrent salamander (Rhyacotriton variegatus) was recently found not warranted for listing under the US Endangered Species Act due to lack of information regarding population fragmentation and gene flow. Found in small-order streams associated with late-successional coniferous forests of the US Pacific Northwest, threats to their persistence include disturbance related to timber harvest activities. We conducted a study of genetic diversity throughout this species' range to 1) identify major phylogenetic lineages and phylogeographic barriers and 2) elucidate regional patterns of population genetic and spatial phylogeographic structure. Cytochrome b sequence variation was examined for 189 individuals from 72 localities. We identified 3 major lineages corresponding to nonoverlapping geographic regions: a northern California clade, a central Oregon clade, and a northern Oregon clade. The Yaquina River may be a phylogeographic barrier between the northern Oregon and central Oregon clades, whereas the Smith River in northern California appears to correspond to the discontinuity between the central Oregon and northern California clades. Spatial analyses of genetic variation within regions encompassing major clades indicated that the extent of genetic structure is comparable among regions. We discuss our results in the context of conservation efforts for Southern torrent salamanders.

  18. Spontaneous nephroblastoma in a Japanese giant salamander (Andrias japonicus).

    PubMed

    Kawasumi, Taiga; Kudo, Tomoo; Une, Yumi

    2012-05-01

    An adult male Japanese giant salamander (Andrias japonicus) died accidentally, and necropsy showed a white mass (23 × 15 mm) in the left kidney and hepatorrhexis with hemoperitoneum. Histologically, the renal mass was mainly composed of immature nephroblastic tumor cells. In the tumor tissue, a trabecular pattern lined by oval to polygonal tumor cells with a rich interstitium, solid growth and a few tubular structures was observed. Nephroblastic tumor cells were strongly positive for vimentin and weakly positive, and epithelium-like tumor cells were strongly positive for cytokeratin. However, antibody for Wilms' tumor protein 1 did not react with the salamander's cells. On electron microscopy, a desmosome junction was observed between tumor cells. This is the first report of nephroblastoma in a Japanese giant salamander.

  19. Crystalline marble beats limestone for fluegas desulfurization

    SciTech Connect

    1996-05-01

    NovaCon Energy Systems, Inc. (Bedford, NY) has developed an alternative to conventional limestone sorbents. The new process uses a class of marble, selected with a proprietary model. Recent pilot- and full-scale demonstrations in pulverized-coal (PC) and circulating fluidized bed (CFB) boilers suggest that these patented sorbents outperform conventional limestone for the simultaneous control of SOx, NOx, and particulates during the combustion of coal and sulfur-rich fuels, such as oil, mixed municipal waste and used tires. Dubbed thermally active marbles (TAMs), these sorbents are chemically identical to grainy limestone (whose main constituent is calcium carbonate or calcite). However, thanks to the increased pressures and temperatures experienced during their geologic history, these metamorphic minerals have a regular crystalline structure that offers some advantages in the combustion zone. TAMs, on the other hand, enjoy better calcium-utilization rates because upon heating, they cleave along inter- and intra-crystalline faces, continuously exposing fresh surfaces. By minimizing the self-extinguishment suffered by limestone sorbents, TAMs are effective over operating temperatures from 1,200 F to 2,800 F, which is 400 F higher than other calcium-based sorbents. This allows them to be injected closer to the burner or combustion grate to maximize residence time in the unit.

  20. The Marble Experiment: Overview and Simulations

    NASA Astrophysics Data System (ADS)

    Douglas, M. R.; Murphy, T. J.; Cobble, J. A.; Fincke, J. R.; Haines, B. M.; Hamilton, C. E.; Lee, M. N.; Oertel, J. A.; Olson, R. E.; Randolph, R. B.; Schmidt, D. W.; Shah, R. C.; Smidt, J. M.; Tregillis, I. L.

    2015-11-01

    The Marble ICF platform has recently been launched on both OMEGA and NIF with the goal to investigate the influence of heterogeneous mix on fusion burn. The unique separated reactant capsule design consists of an ``engineered'' CH capsule filled with deuterated plastic foam that contains pores or voids that are filled with tritium gas. Initially the deuterium and tritium are separated, but as the implosion proceeds, the D and T mix, producing a DT signature. The results of these experiments will be used to inform a probability density function (PDF) burn modelling approach for un-resolved cell morphology. Initial targets for platform development have consisted of either fine-pore foams or gas mixtures, with the goal to field the engineered foams in 2016. An overview of the Marble experimental campaign will be presented and simulations will be discussed. This work is supported by US DOE/NNSA, performed at LANL, operated by LANS LLC under contract DE-AC52-06NA25396.

  1. Ecological implications of metabolic compensation at low temperatures in salamanders

    PubMed Central

    2016-01-01

    Global warming is influencing the biology of the world’s biota. Temperature increases are occurring at a faster pace than that experienced by organisms in their evolutionary histories, limiting the organisms’ response to new conditions. Mechanistic models that include physiological traits can help predict species’ responses to warming. Changes in metabolism at high temperatures are often examined; yet many species are behaviorally shielded from high temperatures. Salamanders generally favor cold temperatures and are one of few groups of metazoans to be most species-rich in temperate regions. I examined variation in body temperature, behavioral activity, and temperature dependence of resting heart rate, used as a proxy for standard metabolic rate, in fire salamanders (Salamandra salamandra). Over 26 years, I found that salamanders are behaviorally active at temperatures as low as 1 °C, and aestivate at temperatures above 16 °C. Infrared thermography indicates limited thermoregulation opportunities for these nocturnal amphibians. Temperature affects resting heart rate, causing metabolic depression above 11 °C, and metabolic compensation below 8 °C: heart rate at 3 °C is 224% the expected heart rate. Thus, salamanders operating at low temperatures during periods of peak behavioral activity are able to maintain a higher metabolic rate than the rate expected in absence of compensation. This compensatory mechanism has important ecological implications, because it increases estimated seasonal heart rates. Increased heart rate, and thus metabolism, will require higher caloric intake for field-active salamanders. Thus, it is important to consider a species performance breadth over the entire temperature range, and particularly low temperatures that are ecologically relevant for cold tolerant species such as salamanders. PMID:27257549

  2. Ecological implications of metabolic compensation at low temperatures in salamanders.

    PubMed

    Catenazzi, Alessandro

    2016-01-01

    Global warming is influencing the biology of the world's biota. Temperature increases are occurring at a faster pace than that experienced by organisms in their evolutionary histories, limiting the organisms' response to new conditions. Mechanistic models that include physiological traits can help predict species' responses to warming. Changes in metabolism at high temperatures are often examined; yet many species are behaviorally shielded from high temperatures. Salamanders generally favor cold temperatures and are one of few groups of metazoans to be most species-rich in temperate regions. I examined variation in body temperature, behavioral activity, and temperature dependence of resting heart rate, used as a proxy for standard metabolic rate, in fire salamanders (Salamandra salamandra). Over 26 years, I found that salamanders are behaviorally active at temperatures as low as 1 °C, and aestivate at temperatures above 16 °C. Infrared thermography indicates limited thermoregulation opportunities for these nocturnal amphibians. Temperature affects resting heart rate, causing metabolic depression above 11 °C, and metabolic compensation below 8 °C: heart rate at 3 °C is 224% the expected heart rate. Thus, salamanders operating at low temperatures during periods of peak behavioral activity are able to maintain a higher metabolic rate than the rate expected in absence of compensation. This compensatory mechanism has important ecological implications, because it increases estimated seasonal heart rates. Increased heart rate, and thus metabolism, will require higher caloric intake for field-active salamanders. Thus, it is important to consider a species performance breadth over the entire temperature range, and particularly low temperatures that are ecologically relevant for cold tolerant species such as salamanders. PMID:27257549

  3. Ontogenetic evidence for the Paleozoic ancestry of salamanders.

    PubMed

    Schoch, Rainer R; Carroll, Robert L

    2003-01-01

    The phylogenetic positions of frogs, salamanders, and caecilians have been difficult to establish. Data matrices based primarily on Paleozoic taxa support a monophyletic origin of all Lissamphibia but have resulted in widely divergent hypotheses of the nature of their common ancestor. Analysis that concentrates on the character states of the stem taxa of the extant orders, in contrast, suggests a polyphyletic origin from divergent Paleozoic clades. Comparison of patterns of larval development in Paleozoic and modern amphibians provides a means to test previous phylogenies based primarily on adult characteristics. This proves to be highly informative in the case of the origin of salamanders. Putative ancestors of salamanders are recognized from the Permo-Carboniferous boundary of Germany on the basis of ontogenetic changes observed in fossil remains of larval growth series. The entire developmental sequence from hatching to metamorphosis is revealed in an assemblage of over 600 specimens from a single locality, all belonging to the genus Apateon. Apateon forms the most speciose genus of the neotenic temnospondyl family Branchiosauridae. The sequence of ossification of individual bones and the changing configuration of the skull closely parallel those observed in the development of primitive living salamanders. These fossils provide a model of how derived features of the salamander skull may have evolved in the context of feeding specializations that appeared in early larval stages of members of the Branchiosauridae. Larvae of Apateon share many unique derived characters with salamanders of the families Hynobiidae, Salamandridae, and Ambystomatidae, which have not been recognized in any other group of Paleozoic amphibians. PMID:12752770

  4. Modular functional organisation of the axial locomotor system in salamanders.

    PubMed

    Cabelguen, Jean-Marie; Charrier, Vanessa; Mathou, Alexia

    2014-02-01

    Most investigations on tetrapod locomotion have been concerned with limb movements. However, there is compelling evidence that the axial musculoskeletal system contributes to important functions during locomotion. Adult salamanders offer a remarkable opportunity to examine these functions because these amphibians use axial undulations to propel themselves in both aquatic and terrestrial environments. In this article, we review the currently available biological data on axial functions during various locomotor modes in salamanders. We also present data showing the modular organisation of the neural networks that generate axial synergies during locomotion. The functional implication of this modular organisation is discussed.

  5. Perceived predation risk as a function of predator dietary cues in terrestrial salamanders.

    PubMed

    Murray; Jenkins

    1999-01-01

    Prey often avoid predator chemical cues, and in aquatic systems, prey may even appraise predation risk via cues associated with the predator's diet. However, this relationship has not been shown for terrestrial predator-prey systems, where the proximity of predators and prey, and the intensity of predator chemical cues in the environment, may be less than in aquatic systems. In the laboratory, we tested behavioural responses (avoidance, habituation and activity) of terrestrial red-backed salamanders, Plethodon cinereus, to chemical cues from garter snakes, Thamnophis sirtalis, fed either red-backed salamanders or earthworms (Lumbricus spp.). We placed salamanders in arenas lined with paper towels pretreated with snake chemicals, and monitored salamander movements during 120 min. Salamanders avoided substrates preconditioned by earthworm-fed (avoidanceX+/-SE=91.1+/-2.5%, N=25) and salamander-fed (95.2+/-2.5%, N=25) snakes, when tested against untreated substrate (control). Salamanders avoided cues from salamander-fed snakes more strongly (75.2+/-5.5%, N=25) than earthworm-fed snakes when subjected to both treatments simultaneously, implying that salamanders were sensitive to predator diet. Salamanders tended to avoid snake substrate more strongly during the last 60 min of a trial, but activity patterns were similar between salamanders exposed exclusively to control substrate versus those subject to snake cues. In another experiment, salamanders failed to avoid cues from dead conspecifics, suggesting that the stronger avoidance of salamander-fed snakes in the previous experiment was not directly due to chemical cues emitted by predator-killed salamanders. Salamanders also did not discriminate between cues from a salamander-fed snake versus a salamander-fed snake that was recently switched (i.e. <14 days) to an earthworm diet. Our results imply that terrestrial salamanders are sensitive to perceived predation risk via by-products of predator diet, and that snake

  6. Perceived predation risk as a function of predator dietary cues in terrestrial salamanders.

    PubMed

    Murray; Jenkins

    1999-01-01

    Prey often avoid predator chemical cues, and in aquatic systems, prey may even appraise predation risk via cues associated with the predator's diet. However, this relationship has not been shown for terrestrial predator-prey systems, where the proximity of predators and prey, and the intensity of predator chemical cues in the environment, may be less than in aquatic systems. In the laboratory, we tested behavioural responses (avoidance, habituation and activity) of terrestrial red-backed salamanders, Plethodon cinereus, to chemical cues from garter snakes, Thamnophis sirtalis, fed either red-backed salamanders or earthworms (Lumbricus spp.). We placed salamanders in arenas lined with paper towels pretreated with snake chemicals, and monitored salamander movements during 120 min. Salamanders avoided substrates preconditioned by earthworm-fed (avoidanceX+/-SE=91.1+/-2.5%, N=25) and salamander-fed (95.2+/-2.5%, N=25) snakes, when tested against untreated substrate (control). Salamanders avoided cues from salamander-fed snakes more strongly (75.2+/-5.5%, N=25) than earthworm-fed snakes when subjected to both treatments simultaneously, implying that salamanders were sensitive to predator diet. Salamanders tended to avoid snake substrate more strongly during the last 60 min of a trial, but activity patterns were similar between salamanders exposed exclusively to control substrate versus those subject to snake cues. In another experiment, salamanders failed to avoid cues from dead conspecifics, suggesting that the stronger avoidance of salamander-fed snakes in the previous experiment was not directly due to chemical cues emitted by predator-killed salamanders. Salamanders also did not discriminate between cues from a salamander-fed snake versus a salamander-fed snake that was recently switched (i.e. <14 days) to an earthworm diet. Our results imply that terrestrial salamanders are sensitive to perceived predation risk via by-products of predator diet, and that snake

  7. Insights into the mating habits of the tiger salamander (Ambystoma tigrinum tigrinum) as revealed by genetic parentage analyses.

    PubMed

    Gopurenko, David; Williams, Rod N; McCormick, Cory R; DeWoody, J Andrew

    2006-06-01

    Among urodeles, ambystomatid salamanders are particularly amenable to genetic parentage analyses because they are explosive aggregate breeders that typically have large progeny arrays. Such analyses can lead to direct inferences about otherwise cryptic aspects of salamander natural history, including the rate of multiple mating, individual reproductive success, and the spatial distribution of clutches. In 2002, we collected eastern tiger salamander (Ambystoma tigrinum tigrinum) egg masses (> 1000 embryos) from a approximately 80 m linear transect in Indiana, USA. Embryos were genotyped at four variable microsatellite loci and the resulting progeny array data were used to reconstruct multilocus genotypes of the parental dams and sires for each egg mass. UPGMA analysis of genetic distances among embryos resolved four instances of egg mass admixture, where two or more females had oviposited at exactly the same site resulting in the mixing of independent cohorts. In total, 41 discrete egg masses were available for parentage analyses. Twenty-three egg masses (56%) consisted exclusively of full-siblings (i.e. were singly sired) and 18 (44%) were multiply sired (mean 2.6 males/clutch). Parentage could be genetically assigned to one of 17 distinct parent pairs involving at least 15 females and 14 different males. Reproductive skew was evident among males who sired multiply sired clutches. Additional evidence of the effects of sexual selection on male reproductive success was apparent via significant positive correlations between male mating and reproductive success. Females frequently partitioned their clutches into multiple discrete egg masses that were separated from one another by as many as 43 m. Collectively, these data provide the first direct evidence for polygynandry in a wild population of tiger salamanders. PMID:16689907

  8. Phylogeography and evolution of the Red Salamander (Pseudotriton ruber).

    PubMed

    Folt, Brian; Garrison, Nicole; Guyer, Craig; Rodriguez, Juanita; Bond, Jason E

    2016-05-01

    Phylogeographic studies frequently result in the elevation of subspecific taxa to species given monophyly, or the synonymy of subspecies that are not monophyletic. However, given limited or incongruent datasets, retention of subspecies can be useful to describe hypothesized incipient species or to illustrate interesting biological phenomena driving morphological diversity. Four subspecific taxa have been used to describe largely allopatric geographic variation within the species Pseudotriton ruber, a plethodontid salamander occupying stream and spring habitats across eastern North America: P. r. vioscai occurs in lowland Coastal Plain habitats, while P. r. ruber, P. r. nitidus, and P. r. schencki occupy upland regions in and around the Appalachian Mountains. Pseudotriton ruber co-occurs through its distribution with the aposematic newt Notophthalmus viridescens, and both species are hypothesized to be part of a Müllerian mimicry complex. In this study, we sequenced regions of two mitochondrial (cytochrome b, NADH dehydrogenase subunit 2) and one single copy nuclear protein-coding gene (pro-opiomelanocortin) from individuals sampled across much of the distribution of P. ruber and then used maximum-likelihood and Bayesian phylogenetic inference to test the monophyly of subspecies, reconstruct biogeographic history, and make inferences about morphological evolution. Phylogeographic hypotheses from mitochondrial and nuclear datasets described structure among populations of P. ruber which separated Coastal Plain and upland Appalachian populations, but subspecies were not monophyletic. Biogeographic reconstruction estimated the ancestor of all populations to have occupied and initially diverged in the Coastal Plain during the Pliocene (∼3.6mya), before one lineage subsequently invaded upland areas of Appalachia. Bold bright coloration of high elevation subspecies P. r. nitidus and P. r. schencki appears to have evolved twice. We hypothesize that the Müllerian mimicry

  9. Phylogeography and evolution of the Red Salamander (Pseudotriton ruber).

    PubMed

    Folt, Brian; Garrison, Nicole; Guyer, Craig; Rodriguez, Juanita; Bond, Jason E

    2016-05-01

    Phylogeographic studies frequently result in the elevation of subspecific taxa to species given monophyly, or the synonymy of subspecies that are not monophyletic. However, given limited or incongruent datasets, retention of subspecies can be useful to describe hypothesized incipient species or to illustrate interesting biological phenomena driving morphological diversity. Four subspecific taxa have been used to describe largely allopatric geographic variation within the species Pseudotriton ruber, a plethodontid salamander occupying stream and spring habitats across eastern North America: P. r. vioscai occurs in lowland Coastal Plain habitats, while P. r. ruber, P. r. nitidus, and P. r. schencki occupy upland regions in and around the Appalachian Mountains. Pseudotriton ruber co-occurs through its distribution with the aposematic newt Notophthalmus viridescens, and both species are hypothesized to be part of a Müllerian mimicry complex. In this study, we sequenced regions of two mitochondrial (cytochrome b, NADH dehydrogenase subunit 2) and one single copy nuclear protein-coding gene (pro-opiomelanocortin) from individuals sampled across much of the distribution of P. ruber and then used maximum-likelihood and Bayesian phylogenetic inference to test the monophyly of subspecies, reconstruct biogeographic history, and make inferences about morphological evolution. Phylogeographic hypotheses from mitochondrial and nuclear datasets described structure among populations of P. ruber which separated Coastal Plain and upland Appalachian populations, but subspecies were not monophyletic. Biogeographic reconstruction estimated the ancestor of all populations to have occupied and initially diverged in the Coastal Plain during the Pliocene (∼3.6mya), before one lineage subsequently invaded upland areas of Appalachia. Bold bright coloration of high elevation subspecies P. r. nitidus and P. r. schencki appears to have evolved twice. We hypothesize that the Müllerian mimicry

  10. Genetic drift and rapid evolution of viviparity in insular fire salamanders (Salamandra salamandra).

    PubMed

    Velo-Antón, G; Zamudio, K R; Cordero-Rivera, A

    2012-04-01

    Continental islands offer an excellent opportunity to investigate adaptive processes and to time microevolutionary changes that precede macroevolutionary events. We performed a population genetic study of the fire salamander (Salamandra salamandra), a species that displays unique intraspecific diversity of reproductive strategies, to address the microevolutionary processes leading to phenotypic and genetic differentiation of island, coastal and interior populations. We used eight microsatellite markers to estimate genetic diversity, population structure and demographic parameters in viviparous insular populations and ovoviviparous coastal and interior populations. Our results show considerable genetic differentiation (F(ST) range: 0.06-0.27), and no clear signs of gene flow among populations, except between the large and admixed interior populations. We find no support for island colonization by rafting or intentional/accidental anthropogenic introductions, indicating that rising sea levels were responsible for isolation of the island populations approximately 9000 years ago. Our study provides evidence of rapid genetic differentiation between island and coastal populations, and rapid evolution of viviparity driven by climatic selective pressures on island populations, geographic isolation with genetic drift, or a combination of these factors. Studies of these viviparous island populations in early stages of divergence help us better understand the microevolutionary processes involved in rapid phenotypic shifts. PMID:22086081

  11. Genetic drift and rapid evolution of viviparity in insular fire salamanders (Salamandra salamandra)

    PubMed Central

    Velo-Antón, G; Zamudio, K R; Cordero-Rivera, A

    2012-01-01

    Continental islands offer an excellent opportunity to investigate adaptive processes and to time microevolutionary changes that precede macroevolutionary events. We performed a population genetic study of the fire salamander (Salamandra salamandra), a species that displays unique intraspecific diversity of reproductive strategies, to address the microevolutionary processes leading to phenotypic and genetic differentiation of island, coastal and interior populations. We used eight microsatellite markers to estimate genetic diversity, population structure and demographic parameters in viviparous insular populations and ovoviviparous coastal and interior populations. Our results show considerable genetic differentiation (FST range: 0.06–0.27), and no clear signs of gene flow among populations, except between the large and admixed interior populations. We find no support for island colonization by rafting or intentional/accidental anthropogenic introductions, indicating that rising sea levels were responsible for isolation of the island populations approximately 9000 years ago. Our study provides evidence of rapid genetic differentiation between island and coastal populations, and rapid evolution of viviparity driven by climatic selective pressures on island populations, geographic isolation with genetic drift, or a combination of these factors. Studies of these viviparous island populations in early stages of divergence help us better understand the microevolutionary processes involved in rapid phenotypic shifts. PMID:22086081

  12. Genetic drift and rapid evolution of viviparity in insular fire salamanders (Salamandra salamandra).

    PubMed

    Velo-Antón, G; Zamudio, K R; Cordero-Rivera, A

    2012-04-01

    Continental islands offer an excellent opportunity to investigate adaptive processes and to time microevolutionary changes that precede macroevolutionary events. We performed a population genetic study of the fire salamander (Salamandra salamandra), a species that displays unique intraspecific diversity of reproductive strategies, to address the microevolutionary processes leading to phenotypic and genetic differentiation of island, coastal and interior populations. We used eight microsatellite markers to estimate genetic diversity, population structure and demographic parameters in viviparous insular populations and ovoviviparous coastal and interior populations. Our results show considerable genetic differentiation (F(ST) range: 0.06-0.27), and no clear signs of gene flow among populations, except between the large and admixed interior populations. We find no support for island colonization by rafting or intentional/accidental anthropogenic introductions, indicating that rising sea levels were responsible for isolation of the island populations approximately 9000 years ago. Our study provides evidence of rapid genetic differentiation between island and coastal populations, and rapid evolution of viviparity driven by climatic selective pressures on island populations, geographic isolation with genetic drift, or a combination of these factors. Studies of these viviparous island populations in early stages of divergence help us better understand the microevolutionary processes involved in rapid phenotypic shifts.

  13. Computer-assisted photo identification outperforms visible implant elastomers in an endangered salamander, Eurycea tonkawae.

    PubMed

    Bendik, Nathan F; Morrison, Thomas A; Gluesenkamp, Andrew G; Sanders, Mark S; O'Donnell, Lisa J

    2013-01-01

    Despite recognition that nearly one-third of the 6300 amphibian species are threatened with extinction, our understanding of the general ecology and population status of many amphibians is relatively poor. A widely-used method for monitoring amphibians involves injecting captured individuals with unique combinations of colored visible implant elastomer (VIE). We compared VIE identification to a less-invasive method - computer-assisted photographic identification (photoID) - in endangered Jollyville Plateau salamanders (Eurycea tonkawae), a species with a known range limited to eight stream drainages in central Texas. We based photoID on the unique pigmentation patterns on the dorsal head region of 1215 individual salamanders using identification software Wild-ID. We compared the performance of photoID methods to VIEs using both 'high-quality' and 'low-quality' images, which were taken using two different camera types and technologies. For high-quality images, the photoID method had a false rejection rate of 0.76% compared to 1.90% for VIEs. Using a comparable dataset of lower-quality images, the false rejection rate was much higher (15.9%). Photo matching scores were negatively correlated with time between captures, suggesting that evolving natural marks could increase misidentification rates in longer term capture-recapture studies. Our study demonstrates the utility of large-scale capture-recapture using photo identification methods for Eurycea and other species with stable natural marks that can be reliably photographed. PMID:23555669

  14. Computer-Assisted Photo Identification Outperforms Visible Implant Elastomers in an Endangered Salamander, Eurycea tonkawae

    PubMed Central

    Bendik, Nathan F.; Morrison, Thomas A.; Gluesenkamp, Andrew G.; Sanders, Mark S.; O’Donnell, Lisa J.

    2013-01-01

    Despite recognition that nearly one-third of the 6300 amphibian species are threatened with extinction, our understanding of the general ecology and population status of many amphibians is relatively poor. A widely-used method for monitoring amphibians involves injecting captured individuals with unique combinations of colored visible implant elastomer (VIE). We compared VIE identification to a less-invasive method – computer-assisted photographic identification (photoID) – in endangered Jollyville Plateau salamanders (Eurycea tonkawae), a species with a known range limited to eight stream drainages in central Texas. We based photoID on the unique pigmentation patterns on the dorsal head region of 1215 individual salamanders using identification software Wild-ID. We compared the performance of photoID methods to VIEs using both ‘high-quality’ and ‘low-quality’ images, which were taken using two different camera types and technologies. For high-quality images, the photoID method had a false rejection rate of 0.76% compared to 1.90% for VIEs. Using a comparable dataset of lower-quality images, the false rejection rate was much higher (15.9%). Photo matching scores were negatively correlated with time between captures, suggesting that evolving natural marks could increase misidentification rates in longer term capture-recapture studies. Our study demonstrates the utility of large-scale capture-recapture using photo identification methods for Eurycea and other species with stable natural marks that can be reliably photographed. PMID:23555669

  15. Aquatic herbicide exposure increases salamander desiccation risk eight months later in a terrestrial environment.

    PubMed

    Rohr, Jason R; Palmer, Brent D

    2005-05-01

    Contaminants and climate change may be factors in amphibian declines. However, few studies have explored their joint impacts on postmetamorphic amphibians, a life stage of great importance to amphibian population dynamics. Here, we examine the effects of premetamorphic exposure (mean exposure of 64 d) to ecologically relevant concentrations of the globally common herbicide atrazine (0, 4, 40, 400 microg/L) on the behavior and water retention of lone and grouped postmetamorphic, streamside salamanders, Ambystoma barbouri. Salamanders exposed to > or = 40 microg/L of atrazine exhibited greater activity, fewer water-conserving behaviors, and accelerated water loss four and eight months after exposure compared to controls. No recovery from atrazine exposure was detected and its effects were independent of the presence of conspecifics. These results are consistent with the hypothesis that adverse climatic conditions and contaminants can interact to harm post-metamorphic amphibians; however, they suggest that these two stressors need not be experienced simultaneously to do so. These results emphasize the importance of considering both latent and cumulative effects of temporally linked stressors in ecotoxicology.

  16. Aquatic herbicide exposure increases salamander desiccation risk eight months later in a terrestrial environment.

    PubMed

    Rohr, Jason R; Palmer, Brent D

    2005-05-01

    Contaminants and climate change may be factors in amphibian declines. However, few studies have explored their joint impacts on postmetamorphic amphibians, a life stage of great importance to amphibian population dynamics. Here, we examine the effects of premetamorphic exposure (mean exposure of 64 d) to ecologically relevant concentrations of the globally common herbicide atrazine (0, 4, 40, 400 microg/L) on the behavior and water retention of lone and grouped postmetamorphic, streamside salamanders, Ambystoma barbouri. Salamanders exposed to > or = 40 microg/L of atrazine exhibited greater activity, fewer water-conserving behaviors, and accelerated water loss four and eight months after exposure compared to controls. No recovery from atrazine exposure was detected and its effects were independent of the presence of conspecifics. These results are consistent with the hypothesis that adverse climatic conditions and contaminants can interact to harm post-metamorphic amphibians; however, they suggest that these two stressors need not be experienced simultaneously to do so. These results emphasize the importance of considering both latent and cumulative effects of temporally linked stressors in ecotoxicology. PMID:16111008

  17. Effect of coatings on hardness of commercial marbles

    NASA Astrophysics Data System (ADS)

    Zedef, Veysel

    2016-04-01

    In this study, three type of marble and one granite were chosen to understand if the coating is effective on hardness of the commercial rocks. To understand the hardness of the rock, Schmidt hammer tests were undertaken. The used device allowed us uniaxial compressive strength (UCS) as well as Schmidt rebound (R). The coated samples have clearly high R and UCS values when compared to uncoated samples. The Elazig visne, the well-known marble of Turkey, have 35.6 R and 44.2 MPa UCS values of coated samples. On the other hand, uncoated surface of the same marble have 30.5 R and 35.4 MPa UCS.

  18. Robust liquid marbles stabilized with surface-modified halloysite nanotubes.

    PubMed

    Wu, Hui; Watanabe, Hirohmi; Ma, Wei; Fujimoto, Aya; Higuchi, Takeshi; Uesugi, Kentaro; Takeuchi, Akihisa; Suzuki, Yoshio; Jinnai, Hiroshi; Takahara, Atsushi

    2013-12-01

    We have demonstrated the fabrication of fluorine-free liquid marbles from halloysite nanotube. Halloysite is a naturally occurring inorganic nanotube that has a high aspect ratio, and the surface was modified with octadecyltrimethoxysilane. The surface-modified halloysite formed pincushion agglomerates on the surface of the liquid droplets, which create superhydrophobic surface similar to that of the plant gall surface prepared by aphids. As a result, the liquid marbles showed high mechanical strength upon impact without the use of low surface energy fluoroalkyl or fluorine-modified materials. Our results suggest a new strategy for designing novel materials for liquid marbles inspired by nature.

  19. Blue Marble: Remote Characterization of Habitable Planets

    NASA Technical Reports Server (NTRS)

    Woolf, Neville; Lewis, Brian; Chartres, James; Genova, Anthony

    2009-01-01

    The study of the nature and distribution of habitable environments beyond the Solar System is a key area for Astrobiology research. At the present time, our Earth is the only habitable planet that can be characterized in the same way that we might characterize planets beyond the Solar System. Due to limitations in our current and near-future technology, it is likely that extra-solar planets will be observed as single-pixel objects. To understand this data, we must develop skills in analyzing and interpreting the radiation obtained from a single pixel. These skills must include the study of the time variation of the radiation, and the range of its photometric, spectroscopic and polarimetric properties. In addition, to understand whether we are properly analyzing the single pixel data, we need to compare it with a ground truth of modest resolution images in key spectral bands. This paper discusses the concept for a mission called Blue Marble that would obtain data of the Earth using a combination of spectropolarimetry, spectrophotometry, and selected band imaging. To obtain imagery of the proper resolution, it is desirable to place the Blue Marble spacecraft no closer than the outer region of cis-lunar space. This paper explores a conceptual mission design that takes advantage of low-cost launchers, bus designs and mission elements to provide a cost effective observing platform located at one of the stable Earth-moon Lagrangian points (L4, L5). The mission design allows for the development and use of novel technologies, such as a spinning moon sensor for attitude control, and leverages lessons-learned from previous low-cost spacecraft such as Lunar Prospector to yield a low-risk mission concept.

  20. Analysis of climatic factors influencing migrations of the salamander Ambystoma talpoideum

    SciTech Connect

    Semlitsch, R.D.

    1985-01-01

    Migrations of breeding adult and metamorphosing juvenile mole salamanders, Ambystoma talpoideum, were studied in five populations in South Carolina from September 1978 through July 1982. Onset of breeding immigrations occurred as early as September but migrations ''en masse'' did not occur until November, December, or January. Time of peak migration varied annually depending upon meteorological conditions. Total number of breeding adults or breeding population size, was significantly correlated with cumulative rainfall during the time of immigration. Sex ratio of immigrating adults was significantly biased towards males at the beginning of the breeding season whereas by the end of the season it was biased towards females. During the very dry year of 1980 - 1981 water levels in two relatively permanent breeding sites were substantially metamorphosis and emigration of sexually mature gilled morphs. Statistical models which predict the magnitude of migrations indicated that rainfall, water level, and minimum air temperature were consistently important environmental variables.

  1. Slow DNA loss in the gigantic genomes of salamanders.

    PubMed

    Sun, Cheng; López Arriaza, José R; Mueller, Rachel Lockridge

    2012-01-01

    Evolutionary changes in genome size result from the combined effects of mutation, natural selection, and genetic drift. Insertion and deletion mutations (indels) directly impact genome size by adding or removing sequences. Most species lose more DNA through small indels (i.e., ~1-30 bp) than they gain, which can result in genome reduction over time. Because this rate of DNA loss varies across species, small indel dynamics have been suggested to contribute to genome size evolution. Species with extremely large genomes provide interesting test cases for exploring the link between small indels and genome size; however, most large genomes remain relatively unexplored. Here, we examine rates of DNA loss in the tetrapods with the largest genomes-the salamanders. We used low-coverage genomic shotgun sequence data from four salamander species to examine patterns of insertion, deletion, and substitution in neutrally evolving non-long terminal repeat (LTR) retrotransposon sequences. For comparison, we estimated genome-wide DNA loss rates in non-LTR retrotransposon sequences from five other vertebrate genomes: Anolis carolinensis, Danio rerio, Gallus gallus, Homo sapiens, and Xenopus tropicalis. Our results show that salamanders have significantly lower rates of DNA loss than do other vertebrates. More specifically, salamanders experience lower numbers of deletions relative to insertions, and both deletions and insertions are skewed toward smaller sizes. On the basis of these patterns, we conclude that slow DNA loss contributes to genomic gigantism in salamanders. We also identify candidate molecular mechanisms underlying these differences and suggest that natural variation in indel dynamics provides a unique opportunity to study the basis of genome stability. PMID:23175715

  2. Conservation of the marbled murrelet under the Northwest Forest Plan.

    PubMed

    Raphael, Martin G

    2006-04-01

    The Marbled Murrelet (Brachyramphus marmoratus) was listed as threatened in 1992, primarily because of loss of its old-forest nesting habitat. Monitoring conducted over the first 10 years following implementation of the Northwest Forest Plan shows at-sea murrelet populations appear to be stationary, but recruitment is very low and demographic models project a 4-6% annual rate of decline. Monitoring of nesting habitat indicated there were about 1.6 million ha of higher-suitability nesting habitat on all lands at the start of the plan, about half of which occurred on federal lands. Most (88%) of higher-suitability habitat on federal lands was protected within reserves. Over the past 10 years, losses of habitat due primarily to fire have totaled about 2% on federal lands. Losses have been much greater (12%) on nonfederal lands, due primarily to timber harvest. Habitat is expected to accrue within reserves as younger forest matures and attains sufficient diameter to support nesting sites. At-sea estimates of population size are strongly and positively correlated with amounts of adjacent nesting habitat at a broad scale, supporting the idea that amounts of nesting habitat are a primary driver in wide-scale murrelet population distribution. Conditions at sea, however such as temperature regimes, prey availability, and pollutants, continue to affect murrelet populations. The system of large reserves seems to have achieved the short-term objective of conserving much of the remaining nesting habitat on federal lands. These reserves are also likely to contribute to the long-term objective of creating large, contiguous blocks of nesting habitat. The plan has a primary role in conserving and restoring nesting habitat on federal land but will succeed in this role only if land allocations calling for such protection are in place for many decades.

  3. 5. March 1960 LIVING ROOM CHIMNEY BREAST SHOWING MARBLE MANTEL ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    5. March 1960 LIVING- ROOM CHIMNEY BREAST SHOWING MARBLE MANTEL AND PLASTER RUN CORNICE - Rutgers University, Doolittle-Demarest House, George Street & Seminary Place, New Brunswick, Middlesex County, NJ

  4. Women's toilet with marble stalls and wooden doors, east end ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Women's toilet with marble stalls and wooden doors, east end of first floor. View to southwest. - San Bernardino Valley College, Life Science Building, 701 South Mount Vernon Avenue, San Bernardino, San Bernardino County, CA

  5. Interior view of shower room 216 with original marble surround ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Interior view of shower room 2-16 with original marble surround and double sash windows, facing east. - Marine Barracks, Panama Canal, Barracks Building, 100' North of Thatcher Highway, Balboa, Former Panama Canal Zone, CZ

  6. 35. SECOND FLOOR, SOUTHEAST ROOM, NORTH WALL: BLACK MARBLE MANTLE. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    35. SECOND FLOOR, SOUTHEAST ROOM, NORTH WALL: BLACK MARBLE MANTLE. Grape clusters above columns repeat in upper part of cornice and probably in destroyed ceiling centerpiece - Governor Thomas Bennett House, 1 Lucas Street, Charleston, Charleston County, SC

  7. Geographic variation, genetic structure and conservation unit designation in the larch mountain salamander( Plethodon larselli)

    USGS Publications Warehouse

    Wagner, R.S.; Miller, Mark P.; Crisafulli, Charles; Haig, Susan M.

    2005-01-01

    The Larch Mountain salamander (Plethodon larselli Burns, 1954) is an endemic species in the Pacific northwestern United States facing threats related to habitat destruction. To facilitate development of conservation strategies, we used DNA sequences and RAPDs (random amplified polymorphic DNA) to examine differences among populations of this species. Phylogenetic analyses of cytochrome b revealed a clade of haplotypes from populations north of the Columbia River derived from a clade containing haplotypes from the river's southwestern region. Haplotypes from southeastern populations formed a separate clade. Nucleotide diversity was reduced in northern populations relative to southern populations. These results were corroborated by analyses of RAPD loci, which revealed similar patterns of clustering and diversity. Network analyses suggested that northern populations were colonized following a range expansion mediated by individuals from populations located southwest of the river. Changes in the Columbia River's location during the Pliocene and Pleistocene likely released distributional constraints on this species, permitting their northern range expansion. Based on the barrier presented by the Columbia River's present location and differences in haplotype diversity and population structure observed between northern and southern populations, we suggest that designation of separate management units encompassing each region may assist with mitigating different threats to this species.

  8. Can the eastern red-backed salamander (Plethodon cinereus) persist in an acidified landscape?

    USGS Publications Warehouse

    Bondi, Cheryl A; Beier, Colin M.; Ducey, Peter K; Lawrence, Gregory B.; Bailey, Scott W.

    2016-01-01

    Hardwood forests of eastern North America have experienced decades of acidic deposition, leading to soil acidification where base cation supply was insufficient to neutralize acid inputs. Negative impacts of soil acidity on amphibians include disrupted embryonic development, lower growth rates, and habitat loss. However, some amphibians exhibit intraspecific variation in acid tolerance, suggesting the potential for local adaptation in areas where soils are naturally acidic. The eastern red-backed salamander (Plethodon cinereus) is a highly abundant top predator of the northern hardwood forest floor. Early research found that P. cinereus was sensitive to acidic soils, avoiding substrates with pH < 3.8 and experiencing decreased growth rates in acidic habitats. However, recent studies have documented P. cinereus populations in lower pH conditions than previously observed, suggesting some populations may persist in acidic conditions. Here, we evaluated relationships between organic horizon soil pH and P. cinereus abundance, adult health (body size and condition), and microhabitat selection, based on surveys of 34 hardwood forests in northeastern United States that encompass a regional soil pH gradient. We found no associations between soil pH and P. cinereus abundance or health, and observed that this salamander used substrates with pH similar to that available, suggesting that pH does not mediate their fine-scale distributions. The strongest negative predictor of P. cinereus abundance was the presence of dusky salamanders (Desmognathus spp.), which were most abundant in the western Adirondacks. Our results indicate that P. cinereus occupies a wider range of soil pH than has been previously thought, which has implications for their functional role in forest food webs and nutrient cycles in acid-impaired ecosystems. Tolerance of P. cinereus for more acidic habitats, including anthropogenically acidified forests, may be due to local adaptation in

  9. The Marble Types of Thassos Island through the Ages

    NASA Astrophysics Data System (ADS)

    Laskaridis, Kostas; Patronis, Michael; Papatrechas, Christos; Schouenborg, Björn

    2013-04-01

    The first references to the "white whole-grain" marble of Thassos Island, Greece, date back to the 6th century BC when stones were quarried at Alyki peninsula and at Fanari and Vathy capes. Since that time, Thassos marble was exported to Samothraki and other neighbouring islands, Asia Minor coastal cities, Southern Greece and Rome. In ancient times, there were two principal types of marble quarries in Thassos: (a) those producing material for the construction of temples and for the creation of various art pieces, i.e. ornamental stones, and (b) those for extraction of rough blocks for export. This paper aims at describing the Thassos marble, the geological setting in brief, its historic use and future supply possibilities and other reasons why it is a time-enduring ornamental stone. The aesthetical characteristics and the physical mechanical properties of its two main types (i.e. calcitic and dolomitic) are described and evaluated. The relevant results justify the wide application range and the continuous use of Thassos marble from ancient to present times and confirm the ability of this stone to survive over time. Keywords: Thassos, Marble, Ornamental Stones, Physical Mechanical Properties, Historic use

  10. Wetting and elasto-plasticity based sculpture of liquid marbles.

    PubMed

    Liu, Jianlin; Zuo, Pingcheng

    2016-02-01

    As an emerging material with exotic properties, liquid marble holds great potential for such areas as microfluidics, stimuli-responsive sensors, micro-chemical reactors, micro-bioreactors, energy harvesting devices, and mechanical structures. In this study, we mainly concentrate on the mechanical behaviors, such as elasto-plasticity of liquid marble with the decrease of liquid volume. The contact radius with the substrate and Young's contact angle of liquid marble are both measured with the change of water volume, and those of a water droplet are compared. The mechanism for the different responses for liquid marble and water droplet is clarified according to the mechanics analysis. Moreover, it is found that liquid marble can behave like an elasto-plastic material when the particle surface density is big enough. Based upon this fact, liquid marble can be sculpted to all kinds of special shapes as expected. These investigations may cast new light on how to engineer multifunctional materials and devices, which are beneficial to microprinting and micromachining.

  11. Wetting and elasto-plasticity based sculpture of liquid marbles.

    PubMed

    Liu, Jianlin; Zuo, Pingcheng

    2016-02-01

    As an emerging material with exotic properties, liquid marble holds great potential for such areas as microfluidics, stimuli-responsive sensors, micro-chemical reactors, micro-bioreactors, energy harvesting devices, and mechanical structures. In this study, we mainly concentrate on the mechanical behaviors, such as elasto-plasticity of liquid marble with the decrease of liquid volume. The contact radius with the substrate and Young's contact angle of liquid marble are both measured with the change of water volume, and those of a water droplet are compared. The mechanism for the different responses for liquid marble and water droplet is clarified according to the mechanics analysis. Moreover, it is found that liquid marble can behave like an elasto-plastic material when the particle surface density is big enough. Based upon this fact, liquid marble can be sculpted to all kinds of special shapes as expected. These investigations may cast new light on how to engineer multifunctional materials and devices, which are beneficial to microprinting and micromachining. PMID:26920520

  12. Hellbender genome sequences shed light on genomic expansion at the base of crown salamanders.

    PubMed

    Sun, Cheng; Mueller, Rachel Lockridge

    2014-07-01

    Among animals, genome sizes range from 20 Mb to 130 Gb, with 380-fold variation across vertebrates. Most of the largest vertebrate genomes are found in salamanders, an amphibian clade of 660 species. Thus, salamanders are an important system for studying causes and consequences of genomic gigantism. Previously, we showed that plethodontid salamander genomes accumulate higher levels of long terminal repeat (LTR) retrotransposons than do other vertebrates, although the evolutionary origins of such sequences remained unexplored. We also showed that some salamanders in the family Plethodontidae have relatively slow rates of DNA loss through small insertions and deletions. Here, we present new data from Cryptobranchus alleganiensis, the hellbender. Cryptobranchus and Plethodontidae span the basal phylogenetic split within salamanders; thus, analyses incorporating these taxa can shed light on the genome of the ancestral crown salamander lineage, which underwent expansion. We show that high levels of LTR retrotransposons likely characterize all crown salamanders, suggesting that disproportionate expansion of this transposable element (TE) class contributed to genomic expansion. Phylogenetic and age distribution analyses of salamander LTR retrotransposons indicate that salamanders' high TE levels reflect persistence and diversification of ancestral TEs rather than horizontal transfer events. Finally, we show that relatively slow DNA loss rates through small indels likely characterize all crown salamanders, suggesting that a decreased DNA loss rate contributed to genomic expansion at the clade's base. Our identification of shared genomic features across phylogenetically distant salamanders is a first step toward identifying the evolutionary processes underlying accumulation and persistence of high levels of repetitive sequence in salamander genomes. PMID:25115007

  13. Status Review of the Marbled Murrelet (Brachyramphus marmoratus) in Alaska and British Columbia

    USGS Publications Warehouse

    Piatt, J.F.; Kuletz, K.J.; Burger, A.E.; Hatch, Shyla A.; Friesen, V.L.; Birt, T.P.; Arimitsu, M.L.; Drew, G.S.; Harding, A.M.A.; Bixler, K.S.

    2007-01-01

    The Marbled Murrelet (Brachyramphus marmoratus) is a small, diving seabird inhabiting inshore waters of the Northeastern Pacific Ocean. This species feeds on small, schooling fishes and zooplankton, and nests primarily on the moss-covered branches of large, old-growth conifers, and also, in some parts of its range, on the ground. We reviewed existing information on this species to evaluate its current status in the northern part of its range-Alaska (U.S.) and British Columbia (Canada). Within the southern part of its range (Washington, Oregon, and California, U.S.), the Marbled Murrelet was listed as a threatened species under the Endangered Species Act (ESA) in 1993, and the U.S. Fish and Wildlife Service (USFWS) needed information on the species throughout its range for ESA deliberations. We compiled published information on the conservation status, population biology, foraging ecology, population genetics, population status and trends, demography, marine and nesting habitat characteristics, threats, and ongoing conservation efforts for Marbled Murrelets in Alaska and British Columbia. We conducted a new genetic study using samples from a segment of the range that had not been included in previous studies (Washington, Oregon) and additional nuclear intron and microsatellite markers. We also analyzed available at-sea survey data from several locations for trend. To understand the reasonableness of the empirical trend data, we developed demographic models incorporating stochasticity to discern what population trends were possible by chance. The genetic studies substantially confirmed previous findings on population structure in the Marbled Murrelet. Our present work finds three populations: (1) one comprising birds in the central and western Aleutian Islands; (2) one comprising birds in central California; and (3) one comprising birds within the center of the range from the eastern Aleutians to northern California. Our knowledge of genetic structure within this

  14. Fluctuations in a metapopulation of nesting four-toed salamanders, Hemidactylium scutatum, in the Great Smoky Mountains National Park, USA, 1999-2003

    USGS Publications Warehouse

    Corser, J.D.; Dodd, C.K.

    2004-01-01

    We tested two predictions associated with the hypothesis that certain populations of pond-breeding amphibians are structured into metapopulations using minimum relative abundance estimates of nesting four-toed salamanders (Hemidactylium scutatum Schlegel) from 11 different ponds in the Great Smoky Mountains National Park. Coefficients of variation (CV) for counts at individual ponds ranged from 0.25 to 1.26, and the overall mean CV at all 11 ponds was 0.34. Many pairs of ponds had negative correlations in abundance from 1999-2003, whereas others had various degrees of positive correlation (mean r = 0.29). Thus, nesting population size fluctuated semi-independently among the ponds from year to year, inferring the existence of inter-pond dispersal. The mean number of nesting females at a pond was negatively, but non-significantly, correlated (r = -0.27; P = 0.40; 10 d.f.) to the pond's isolation. Owing to physiological constraints on plethodontid salamander energetics, precipitation during the nesting season (February and March) appeared to play an important role (r = 0.78; P = 0.12; 4 d.f.) in the number of nesting females we observed. Unlike some other plethodontid salamander populations in more fragmented southern Appalachian forest ecosystems, this (meta)population within Great Smoky Mountains National Park does not appear to be declining.

  15. The effects of 24-h exposure to carbaryl or atrazine on the locomotor performance and overwinter growth and survival of juvenile spotted salamanders (Ambystoma maculatum).

    PubMed

    Mitchkash, Matthew G; McPeek, Tammy; Boone, Michelle D

    2014-03-01

    Understanding the effects of pesticide exposure on organisms throughout their life cycle is critical to predict population-level effects. For many taxa, including amphibians, juveniles are the main dispersal stage and are disproportionally important to population persistence when compared with other life stages. In the present study, we examined the effects of a single 24-h exposure to the insecticide carbaryl or the herbicide atrazine on locomotor performance (endurance, distance traveled, speed, and fatigue) in the laboratory and terrestrial growth and survival through overwintering in field enclosures using recent metamorphs of spotted salamanders (Ambystoma maculatum). We found that neither atrazine nor carbaryl impacted endurance, but fatigue increased with carbaryl exposure, which could leave salamanders less able to escape repeated attacks by predators. Terrestrial growth and overwinter survival were not affected by short-term exposure to carbaryl or atrazine, suggesting that when individuals can overcome acute effects, no long-term consequences result for the endpoints measured.

  16. High occupancy of stream salamanders despite high ranavirus prevalence in a southern appalachians watershed.

    PubMed

    Rothermel, Betsie B; Travis, Emilie R; Miller, Debra L; Hill, Robert L; McGuire, Jessica L; Yabsley, Michael J

    2013-06-01

    The interactive effects of environmental stressors and emerging infectious disease pose potential threats to stream salamander communities and their headwater stream ecosystems. To begin assessing these threats, we conducted occupancy surveys and pathogen screening of stream salamanders (Family Plethodontidae) in a protected southern Appalachians watershed in Georgia and North Carolina, USA. Of the 101 salamanders screened for both chytrid fungus (Batrachochytrium dendrobatidis) and Ranavirus, only two exhibited low-level chytrid infections. Prevalence of Ranavirus was much higher (30.4% among five species of Desmognathus). Despite the ubiquity of ranaviral infections, we found high probabilities of site occupancy (≥0.60) for all stream salamander species.

  17. Genealogical relationships of southern Ontario polyploid unisexual salamanders (genus Ambystoma) inferred from intergenomic exchanges and major rDNA cytotypes.

    PubMed

    Bi, Ke; Bogart, James P; Fu, Jinzhong

    2008-01-01

    North American unisexual salamanders in the genus Ambystoma are common around the Great Lakes region of North America. They contain an almost identical mitochondrial genome across their distribution that is unlike that of any of the four species whose genomes may be included in their nuclei. Thus, sequence-based phylogenies of unisexual populations are confusing. We used chromosomal intergenomic exchanges and major rDNA cytotypes as combined cytogenetic markers to tentatively construct a genealogy of unisexual Ambystoma in southern Ontario. We employed GISH and sequential/simultaneous GISH/FISH-rDNA to reveal intergenomic exchanges and rDNA cytotypes in unisexual A. laterale--2 jeffersonianum (LJJ) triploids and their tetraploid derivative A. laterale--3 jeffersonianum (LJJJ). We identified 10 different patterns of intergenomic exchanges from 18 isolated populations and used them as primary cytogenetic markers. Major rDNA cytotypes served as independent and supplementary markers. Our results suggest that current LJJ and LJJJ populations in southern Ontario are likely derived from a few unisexual individuals. Intergenomic exchanges are common phenomena and widely distributed in the salamanders of the A. laterale--A. jeffersonianum unisexual complex. Integration of GISH and FISH can exhibit multiple unrelated chromosomal markers on the same chromosome spread and demonstrate lineage relationships in unisexual populations. Similar methods may be applied for studying the molecular cytogenetics of other unisexuals to improve our understanding of their genealogical relationships and historical dispersal. PMID:18175200

  18. Detecting cryptic species in phylogeographic studies: speciation in the California Slender Salamander, Batrachoseps attenuatus.

    PubMed

    Highton, Richard

    2014-02-01

    A study of DNA sequence variation in the plethodontid salamander Batrachoseps attenuatus by Martínez-Solano et al. (2007) revealed more species than acknowledged by the authors. They sequenced 677 base pairs of the cytochrome-b mitochondrial gene in 178 individuals from 123 populations of the currently recognized species B. attenuatus from throughout most of its known range in southwestern Oregon and northern and central California. Their data show that the common ancestor of the species diverged into five clades during the late Miocene Epoch, an estimated 9.2-5.5 mya, with subsequent divergences producing at least 39 living lineages that replace each other geographically. These groups have been diverging independently from each other throughout the Pleistocene Epoch and many of them have probably reached the species level of divergence.

  19. Salamander Blue-sensitive Cones Lost During Metamorphosis†

    PubMed Central

    Chen, Ying; Znoiko, Sergey; DeGrip, Willem J.; Crouch, Rosalie K.; Ma, Jian-xing

    2009-01-01

    The tiger salamander lives in shallow water with bright light in the aquatic phase, and in dim tunnels or caves in the terrestrial phase. In the aquatic phase, there are five types of photoreceptors—two types of rods and three types of cones. Our previous studies showed that the green rods and blue-sensitive cones contain the same visual pigment and have the same absorbance spectra; however, the green rods have a larger photon-catch area and thus have higher light sensitivity than the blue-sensitive cones. Here we show that after metamorphosis, the terrestrial salamander looses the blue-sensitive cones, while the density of the green rods increases. Moreover, the size of the green rod outer segments is increased in the terrestrial phase, compared to that in the aquatic phase. This switch from the blue-sensitive cones to the green rods may represent an adaptation to the dim light environment of the terrestrial phase. PMID:18331398

  20. Ecological radiation with limited morphological diversification in salamanders.

    PubMed

    Blankers, Thomas; Adams, D C; Wiens, J J

    2012-04-01

    A major goal of evolutionary biology is to explain morphological diversity among species. Many studies suggest that much morphological variation is explained by adaptation to different microhabitats. Here, we test whether morphology and microhabitat use are related in plethodontid salamanders, which contain the majority of salamander species, and have radiated into a striking diversity of microhabitats. We obtained microhabitat data for 189 species that also had both morphometric and phylogenetic data. We then tested for associations between morphology and microhabitat categories using phylogenetic comparative methods. Associations between morphology and ecology in plethodontids are largely confined to a single clade within one subfamily (Bolitoglossinae), whereas variation in morphology across other plethodontids is unrelated to microhabitat categories. These results demonstrate that ecological radiation and morphological evolution can be largely decoupled in a major clade. The results also offer a striking contrast to lizards, which typically show close relationships between morphology and microhabitat.

  1. Ecological radiation with limited morphological diversification in salamanders.

    PubMed

    Blankers, Thomas; Adams, D C; Wiens, J J

    2012-04-01

    A major goal of evolutionary biology is to explain morphological diversity among species. Many studies suggest that much morphological variation is explained by adaptation to different microhabitats. Here, we test whether morphology and microhabitat use are related in plethodontid salamanders, which contain the majority of salamander species, and have radiated into a striking diversity of microhabitats. We obtained microhabitat data for 189 species that also had both morphometric and phylogenetic data. We then tested for associations between morphology and microhabitat categories using phylogenetic comparative methods. Associations between morphology and ecology in plethodontids are largely confined to a single clade within one subfamily (Bolitoglossinae), whereas variation in morphology across other plethodontids is unrelated to microhabitat categories. These results demonstrate that ecological radiation and morphological evolution can be largely decoupled in a major clade. The results also offer a striking contrast to lizards, which typically show close relationships between morphology and microhabitat. PMID:22268991

  2. Identification of conservation units of the hynobiid salamander Pachyhynobius shangchengensis.

    PubMed

    Su, L-N; Zhao, Y-Y; Wu, X-M; Zhang, H-F; Li, X-C

    2015-08-19

    The evolutionary significant units (ESUs) of the salamander Pachyhynobius shangchengensis (Hynobiidae) in the Dabieshan mountains, southeastern China, were identified based on mitochondrial DNA data. We used methods for detecting cryptic species, such as the minimum spanning tree, the automatic barcode gap discovery, and the generalized mixed Yule-coalescent model; geographical partitioning was also used to identify the ESUs. A total of four ESUs were identified.

  3. Salamander growth rates increase along an experimental stream phosphorus gradient.

    PubMed

    Bumpers, Phillip M; Maerz, John C; Rosemond, Amy D; Benstead, Jonathan P

    2015-11-01

    Nutrient-driven perturbations to the resource base of food webs are predicted to attenuate with trophic distance, so it is unclear whether higher-level consumers will generally respond to anthropogenic nutrient loading. Few studies have tested whether nutrient (specifically, nitrogen [N] and phosphorus [P]) enrichment of aquatic ecosystems propagates through multiple trophic levels to affect predators, or whether N vs. P is relatively more important in driving effects on food webs. We conducted two-year whole-stream N and P additions to five streams to generate gradients in N and P concentration and N:P ratio (target N:P = 2, 8, 16, 32, 128). Larval salamanders are vertebrate predators of primary and secondary macroinvertebrate consumers in many heterotrophic headwater streams in which the basal resources are detritus and associated microorganisms. We determined the effects of N and P on the growth rates of caged and free-roaming larval Desmognathus quadramaculatus and the average body size of larval Eurycea wilderae. Growth rates and average body size increased by up to 40% and 60%, respectively, with P concentration and were negatively related to N:P ratio. These findings were consistent across both species of salamanders using different methodologies (cage vs. free-roaming) and at different temporal scales (3 months vs. 2 yr). Nitrogen concentration was not significantly related to increased growth rate or body size of the salamander species tested. Our findings suggest that salamander growth responds to the relaxation of ecosystem-level P limitation and that moderate P enrichment can have relatively large effects on vertebrate predators in detritus-based food webs.

  4. Salamander growth rates increase along an experimental stream phosphorus gradient.

    PubMed

    Bumpers, Phillip M; Maerz, John C; Rosemond, Amy D; Benstead, Jonathan P

    2015-11-01

    Nutrient-driven perturbations to the resource base of food webs are predicted to attenuate with trophic distance, so it is unclear whether higher-level consumers will generally respond to anthropogenic nutrient loading. Few studies have tested whether nutrient (specifically, nitrogen [N] and phosphorus [P]) enrichment of aquatic ecosystems propagates through multiple trophic levels to affect predators, or whether N vs. P is relatively more important in driving effects on food webs. We conducted two-year whole-stream N and P additions to five streams to generate gradients in N and P concentration and N:P ratio (target N:P = 2, 8, 16, 32, 128). Larval salamanders are vertebrate predators of primary and secondary macroinvertebrate consumers in many heterotrophic headwater streams in which the basal resources are detritus and associated microorganisms. We determined the effects of N and P on the growth rates of caged and free-roaming larval Desmognathus quadramaculatus and the average body size of larval Eurycea wilderae. Growth rates and average body size increased by up to 40% and 60%, respectively, with P concentration and were negatively related to N:P ratio. These findings were consistent across both species of salamanders using different methodologies (cage vs. free-roaming) and at different temporal scales (3 months vs. 2 yr). Nitrogen concentration was not significantly related to increased growth rate or body size of the salamander species tested. Our findings suggest that salamander growth responds to the relaxation of ecosystem-level P limitation and that moderate P enrichment can have relatively large effects on vertebrate predators in detritus-based food webs. PMID:27070018

  5. Apparent predation by Gray Jays, Perisoreus canadensis, on Long-toed Salamanders, Ambystoma macrodactylum, in the Oregon Cascade Range

    USGS Publications Warehouse

    Murray, M.P.; Pearl, C.A.; Bury, R.B.

    2005-01-01

    We report observations of Gray Jays (Perisoreus canadensis) appearing to consume larval Long-toed Salamanders (Ambystoma macrodactylum) in a drying subalpine pond in Oregon, USA. Corvids are known to prey upon a variety of anuran amphibians, but to our knowledge, this is the first report of predation by any corvid on aquatic salamanders. Long-toed Salamanders appear palatable to Gray Jays, and may provide a food resource to Gray Jays when salamander larvae are concentrated in drying temporary ponds.

  6. Hellbender Genome Sequences Shed Light on Genomic Expansion at the Base of Crown Salamanders

    PubMed Central

    Sun, Cheng; Mueller, Rachel Lockridge

    2014-01-01

    Among animals, genome sizes range from 20 Mb to 130 Gb, with 380-fold variation across vertebrates. Most of the largest vertebrate genomes are found in salamanders, an amphibian clade of 660 species. Thus, salamanders are an important system for studying causes and consequences of genomic gigantism. Previously, we showed that plethodontid salamander genomes accumulate higher levels of long terminal repeat (LTR) retrotransposons than do other vertebrates, although the evolutionary origins of such sequences remained unexplored. We also showed that some salamanders in the family Plethodontidae have relatively slow rates of DNA loss through small insertions and deletions. Here, we present new data from Cryptobranchus alleganiensis, the hellbender. Cryptobranchus and Plethodontidae span the basal phylogenetic split within salamanders; thus, analyses incorporating these taxa can shed light on the genome of the ancestral crown salamander lineage, which underwent expansion. We show that high levels of LTR retrotransposons likely characterize all crown salamanders, suggesting that disproportionate expansion of this transposable element (TE) class contributed to genomic expansion. Phylogenetic and age distribution analyses of salamander LTR retrotransposons indicate that salamanders’ high TE levels reflect persistence and diversification of ancestral TEs rather than horizontal transfer events. Finally, we show that relatively slow DNA loss rates through small indels likely characterize all crown salamanders, suggesting that a decreased DNA loss rate contributed to genomic expansion at the clade’s base. Our identification of shared genomic features across phylogenetically distant salamanders is a first step toward identifying the evolutionary processes underlying accumulation and persistence of high levels of repetitive sequence in salamander genomes. PMID:25115007

  7. Better than fish on land? Hearing across metamorphosis in salamanders

    PubMed Central

    Christensen, Christian Bech; Lauridsen, Henrik; Christensen-Dalsgaard, Jakob; Pedersen, Michael; Madsen, Peter Teglberg

    2015-01-01

    Early tetrapods faced an auditory challenge from the impedance mismatch between air and tissue in the transition from aquatic to terrestrial lifestyles during the Early Carboniferous (350 Ma). Consequently, tetrapods may have been deaf to airborne sounds for up to 100 Myr until tympanic middle ears evolved during the Triassic. The middle ear morphology of recent urodeles is similar to that of early ‘lepospondyl’ microsaur tetrapods, and experimental studies on their hearing capabilities are therefore useful to understand the evolutionary and functional drivers behind the shift from aquatic to aerial hearing in early tetrapods. Here, we combine imaging techniques with neurophysiological measurements to resolve how the change from aquatic larvae to terrestrial adult affects the ear morphology and sensory capabilities of salamanders. We show that air-induced pressure detection enhances underwater hearing sensitivity of salamanders at frequencies above 120 Hz, and that both terrestrial adults and fully aquatic juvenile salamanders can detect airborne sound. Collectively, these findings suggest that early atympanic tetrapods may have been pre-equipped to aerial hearing and are able to hear airborne sound better than fish on land. When selected for, this rudimentary hearing could have led to the evolution of tympanic middle ears. PMID:25652830

  8. Mechanisms underlying vertebrate limb regeneration: lessons from the salamander.

    PubMed

    Brockes, Jeremy P; Gates, Phillip B

    2014-06-01

    Limb regeneration in adult salamanders proceeds by formation of a mound of progenitor cells called the limb blastema. It provides several pointers for regenerative medicine. These include the role of differentiated cells in the origin of the blastema, the role of regenerating axons of peripheral nerves and the importance of cell specification in conferring morphogenetic autonomy on the blastema. One aspect of regeneration that has received less attention is the ability to undergo multiple episodes without detectable change in the outcome, and with minimal effect of aging. We suggest that, although such pointers are valuable, it is important to understand why salamanders are the only adult tetrapod vertebrates able to regenerate their limbs. Although this remains a controversial issue, the existence of salamander-specific genes that play a significant role in the mechanism of regeneration provides evidence for the importance of local evolution, rather than a purely ancestral mechanism. The three-finger protein called Prod1 is discussed in the present article as an exemplar of this approach.

  9. Origin and diversification of a salamander sex pheromone system.

    PubMed

    Janssenswillen, Sunita; Vandebergh, Wim; Treer, Dag; Willaert, Bert; Maex, Margo; Van Bocxlaer, Ines; Bossuyt, Franky

    2015-02-01

    Sex pheromones form an important facet of reproductive strategies in many organisms throughout the Animal Kingdom. One of the oldest known sex pheromones in vertebrates are proteins of the Sodefrin Precursor-like Factor (SPF) system, which already had a courtship function in early salamanders. The subsequent evolution of salamanders is characterized by a diversification in courtship and reproduction, but little is known on how the SPF pheromone system diversified in relation to changing courtship strategies. Here, we combined transcriptomic, genomic, and phylogenetic analyses to investigate the evolution of the SPF pheromone system in nine salamandrid species with distinct courtship displays. First, we show that SPF originated from vertebrate three-finger proteins and diversified through multiple gene duplications in salamanders, while remaining a single copy in frogs. Next, we demonstrate that tail-fanning newts have retained a high phylogenetic diversity of SPFs, whereas loss of tail-fanning has been associated with a reduced importance or loss of SPF expression in the cloacal region. Finally, we show that the attractant decapeptide sodefrin is cleaved from larger SPF precursors that originated by a 62 bp insertion and consequent frameshift in an ancestral Cynops lineage. This led to the birth of a new decapeptide that rapidly evolved a pheromone function independently from uncleaved proteins.

  10. Better than fish on land? Hearing across metamorphosis in salamanders.

    PubMed

    Christensen, Christian Bech; Lauridsen, Henrik; Christensen-Dalsgaard, Jakob; Pedersen, Michael; Madsen, Peter Teglberg

    2015-03-01

    Early tetrapods faced an auditory challenge from the impedance mismatch between air and tissue in the transition from aquatic to terrestrial lifestyles during the Early Carboniferous (350 Ma). Consequently, tetrapods may have been deaf to airborne sounds for up to 100 Myr until tympanic middle ears evolved during the Triassic. The middle ear morphology of recent urodeles is similar to that of early 'lepospondyl' microsaur tetrapods, and experimental studies on their hearing capabilities are therefore useful to understand the evolutionary and functional drivers behind the shift from aquatic to aerial hearing in early tetrapods. Here, we combine imaging techniques with neurophysiological measurements to resolve how the change from aquatic larvae to terrestrial adult affects the ear morphology and sensory capabilities of salamanders. We show that air-induced pressure detection enhances underwater hearing sensitivity of salamanders at frequencies above 120 Hz, and that both terrestrial adults and fully aquatic juvenile salamanders can detect airborne sound. Collectively, these findings suggest that early atympanic tetrapods may have been pre-equipped to aerial hearing and are able to hear airborne sound better than fish on land. When selected for, this rudimentary hearing could have led to the evolution of tympanic middle ears.

  11. Predator perception of Batesian mimicry and conspicuousness in a salamander.

    PubMed

    Kraemer, Andrew C; Adams, Dean C

    2014-04-01

    In Batesian mimicry a palatable mimic deceives predators by resembling an unpalatable model. The evolution of Batesian mimicry relies on the visual capabilities of the potential predators, as prey detection provides the selective force driving evolutionary change. We compared the visual capabilities of several potential predators to test predictions stemming from the hypothesis of Batesian mimicry between two salamanders: the model species Notophthalmus viridescens, and polymorphic mimic, Plethodon cinereus. First, we found mimicry to be restricted to coloration, but not brightness. Second, only bird predators appeared able to discriminate between the colors of models and nonmimic P. cinereus. Third, estimates of salamander conspicuousness were background dependent, corresponding to predictions only for backgrounds against which salamanders are most active. These results support the hypothesis that birds influence the evolution of Batesian mimicry in P. cinereus, as they are the only group examined capable of differentiating N. viridescens and nonmimetic P. cinereus. Additionally, patterns of conspicuousness suggest that selection from predators may drive the evolution of conspicuousness in this system. This study confirms the expectation that the visual abilities of predators may influence the evolution of Batesian mimicry, but the role of conspicuousness may be more complex than previously thought.

  12. A portable detection instrument based on DSP for beef marbling

    NASA Astrophysics Data System (ADS)

    Zhou, Tong; Peng, Yankun

    2014-05-01

    Beef marbling is one of the most important indices to assess beef quality. Beef marbling is graded by the measurement of the fat distribution density in the rib-eye region. However quality grades of beef in most of the beef slaughtering houses and businesses depend on trainees using their visual senses or comparing the beef slice to the Chinese standard sample cards. Manual grading demands not only great labor but it also lacks objectivity and accuracy. Aiming at the necessity of beef slaughtering houses and businesses, a beef marbling detection instrument was designed. The instrument employs Charge-coupled Device (CCD) imaging techniques, digital image processing, Digital Signal Processor (DSP) control and processing techniques and Liquid Crystal Display (LCD) screen display techniques. The TMS320DM642 digital signal processor of Texas Instruments (TI) is the core that combines high-speed data processing capabilities and real-time processing features. All processes such as image acquisition, data transmission, image processing algorithms and display were implemented on this instrument for a quick, efficient, and non-invasive detection of beef marbling. Structure of the system, working principle, hardware and software are introduced in detail. The device is compact and easy to transport. The instrument can determine the grade of beef marbling reliably and correctly.

  13. Introducing a new aspect in marble quarry rehabilitation in Greece

    NASA Astrophysics Data System (ADS)

    Kaliampakos, D. C.; Mavrikos, A. A.

    2006-06-01

    For many years the marble extraction sector of the Greek mining industry has been in conflict with the public, especially in terms of rehabilitation of marble quarry sites. One of the main reasons for that is that the marble extraction sector has been unable to adjust to the existing legislative guidelines for the rehabilitation, such as extensive backfilling and re-vegetation. In the majority of cases these methods fail due to erosion of the backfill soil and adverse climatic conditions. As a result the number of abandoned marble quarry sites is continuously increasing. The present paper suggests a different approach regarding the rehabilitation of marble quarries. More specifically, the paper questions the applicability, the effectiveness, and the social usefulness of the above-mentioned guidelines and suggests the establishment of new land-uses, which are based on an in-depth analysis of the area’s special features, by taking full advantage of its potentials. What is more, the rehabilitation scheme proposes that the new land-uses and the quarrying activity may co-exist and operate simultaneously for a long period of time.

  14. Mammalian cell cryopreservation by using liquid marbles.

    PubMed

    Serrano, M Concepción; Nardecchia, Stefania; Gutiérrez, María C; Ferrer, M Luisa; del Monte, Francisco

    2015-02-18

    Liquid marbles (LMs) are nonsticky droplets covered by micro- or nanometrically scaled particles and obtained by simply rolling small amounts of a liquid in a very hydrophobic powder. Since pioneer work by Aussillous and Quéré, a wide palette of hydrophobic materials for the preparation of LMs, as well as potential applications, have been reported. Because of the bioinspired origin of this concept, the applicability of LMs in biomedicine is gaining increasing attention, with remarkable advances in their use as microbioreactors for blood typing, drug screening, and tumor growth, among others. Herein, we explore the novel use of LMs as a biotechnological tool for the cryopreservation of mammalian cells as an alternative to conventional methods, which typically require the use of cryopreservant agents that commonly associate with some degree of cell toxicity. Murine L929 fibroblasts, a reference cell line for cytotoxicity studies, and poly(tetrafluoroethylene), a hydrophobic polymer widely used in cardiovascular surgery, were selected for the preparation of the cell-containing LMs. Our results reveal that there is a safe range of droplet volumes and cell densities that can be successfully used to cryopreserve mammalian cell lines and recover them after thawing without significantly affecting major cellular parameters such as adhesion, morphology, viability, proliferation, and cell cycle. We envision that progress in the exploration of cell-containing LMs could also open their impact as microreactors for the miniaturization of cytotoxicity procedures of drugs and materials in which powerful tools for cell evaluation such as flow cytometry could be used because of the elevated amount of cells handled.

  15. Erasmus syndrome in a marble worker.

    PubMed

    Bello, S; Rinaldi, A; Trabucco, S; Serafino, L; Bonali, C; Lapadula, G

    2015-01-01

    Erasmus syndrome is defined as the association of silica exposure and subsequent development of systemic sclerosis. The limited number of cases reported in the literature mainly involves miners and only sporadically other professionals. We describe a case of Erasmus syndrome in a marble worker. A 68 year old man came to our observation complaining pelvic and scapular girdle pain, evening fever, intense weakness and emaciation for about 1 month. He also reported to have had Raynaud's phenomenon in his hands for the last 13 years. Also, his occupational history revealed a chronic exposure to silica dust. The patient presented pain in his shoulders and hips, moderate skin thickening and sclerosis in his hands and fingers extending proximally to his wrists. The diagnosis of systemic sclerosis was determined according to his clinical and medical history, the positivity of anti-Scl 70 antibodies, the nailfold capillaroscopy suggestive of an active scleroderma pattern and the detection of a mild restrictive pulmonary syndrome. The evaluation of the organbased complications excluded a gastroenterological and cardiovascular involvement, while the chest computed tomography (CT) detected multiple small nodules with a mantle distribution and enlarged lymph nodes with no signs of interstitial lung disease and fibrosis. Additional tests (positron emission tomography-CT, flexible bronchoscopy and broncho-alveolar lavage) excluded infectious diseases and cancer. However, given the pulmonary involvement, we performed a histological examination of the parenchyma and lymph nodes, which revealed a picture of pneumoconiosis. In the end, the occupational history and the findings from the diagnostic procedures led to the diagnosis of pulmonary silicosis. The precise definition of the pulmonary involvement was essential to the therapeutic approach to this patient. PMID:26876191

  16. The molecular phylogenetics of endangerment: cryptic variation and historical phylogeography of the California tiger salamander, Ambystoma californiense.

    PubMed

    Shaffer, H Bradley; Pauly, Gregory B; Oliver, Jeffrey C; Trenham, Peter C

    2004-10-01

    A primary goal of conservation genetics is the discovery, delimitation and protection of phylogenetic lineages within sensitive or endangered taxa. Given the importance of lineage protection, a combination of phylogeography, historical geology and molecular clock analyses can provide an important historical context for overall species conservation. We present the results of a range-wide survey of genetic variation in the California tiger salamander, Ambystoma californiense, as well as a summary of the past several million years of inundation and isolation of the Great Central Valley and surrounding uplands that constitute its limited range. A combination of population genetic and phylogenetic analyses of mitochondrial DNA variation among 696 samples from 84 populations revealed six well-supported genetic units that are geographically discrete and characterized by nonoverlapping haplotype distributions. Populations from Santa Barbara and Sonoma Counties are particularly well differentiated and geographically isolated from all others. The remaining units in the Southern San Joaquin Valley, Central Coast Range, Central Valley and Bay Area are separated by geological features, ecological zone boundaries, or both. The geological history of the California landscape is consistent with molecular clock evidence suggesting that the Santa Barbara unit has been isolated for at least 0.74-0.92 Myr, and the Sonoma clade is equally ancient. Our work places patterns of genetic differentiation into both temporal- and landscape-level contexts, providing important insights into the conservation genetics of the California tiger salamander.

  17. Early Miocene origin and cryptic diversification of South American salamanders

    PubMed Central

    2013-01-01

    Background The currently recognized species richness of South American salamanders is surprisingly low compared to North and Central America. In part, this low richness may be due to the salamanders being a recent arrival to South America. Additionally, the number of South American salamander species may be underestimated because of cryptic diversity. The aims of our present study were to infer evolutionary relationships, lineage diversity, and timing of divergence of the South American Bolitoglossa using mitochondrial and nuclear sequence data from specimens primarily from localities in the Andes and upper Amazon Basin. We also estimated time of colonization of South America to test whether it is consistent with arrival via the Panamanian Isthmus, or land bridge connection, at its traditionally assumed age of 3 million years. Results Divergence time estimates suggest that Bolitoglossa arrived in South America from Central America by at least the Early Miocene, ca. 23.6 MYA (95% HPD 15.9-30.3 MYA), and subsequently diversified. South American salamanders of the genus Bolitoglossa show strong phylogeographic structure at fine geographic scales and deep divergences at the mitochondrial gene cytochrome b (Cytb) and high diversity at the nuclear recombination activating gene-1 (Rag1). Species often contain multiple genetically divergent lineages that are occasionally geographically overlapping. Single specimens from two southeastern localities in Ecuador are sister to the equatoriana-peruviana clade and genetically distinct from all other species investigated to date. Another single exemplar from the Andes of northwestern Ecuador is highly divergent from all other specimens and is sister to all newly studied samples. Nevertheless, all sampled species of South American Bolitoglossa are members of a single clade that is one of several constituting the subgenus Eladinea, one of seven subgenera in this large genus. Conclusions The ancestors of South American salamanders

  18. Biogeography, phylogeny, and morphological evolution of central Texas cave and spring salamanders

    PubMed Central

    2013-01-01

    Background Subterranean faunal radiations can result in complex patterns of morphological divergence involving both convergent or parallel phenotypic evolution and cryptic species diversity. Salamanders of the genus Eurycea in central Texas provide a particularly challenging example with respect to phylogeny reconstruction, biogeography and taxonomy. These predominantly aquatic species inhabit karst limestone aquifers and spring outflows, and exhibit a wide range of morphological and genetic variation. We extensively sampled spring and cave populations of six Eurycea species within this group (eastern Blepsimolge clade), to reconstruct their phylogenetic and biogeographic history using mtDNA and examine patterns and origins of cave- and surface-associated morphological variation. Results Genetic divergence is generally low, and many populations share ancestral haplotypes and/or show evidence of introgression. This pattern likely indicates a recent radiation coupled with a complex history of intermittent connections within the aquatic karst system. Cave populations that exhibit the most extreme troglobitic morphologies show no or very low divergence from surface populations and are geographically interspersed among them, suggesting multiple instances of rapid, parallel phenotypic evolution. Morphological variation is diffuse among cave populations; this is in contrast to surface populations, which form a tight cluster in morphospace. Unexpectedly, our analyses reveal two distinct and previously unrecognized morphological groups encompassing multiple species that are not correlated with spring or cave habitat, phylogeny or geography, and may be due to developmental plasticity. Conclusions The evolutionary history of this group of spring- and cave-dwelling salamanders reflects patterns of intermittent isolation and gene flow influenced by complex hydrogeologic dynamics that are characteristic of karst regions. Shallow genetic divergences among several species

  19. Mechanical and thermal properties of the Czech marbles

    NASA Astrophysics Data System (ADS)

    Čáchová, Monika; Koňáková, Dana; Vejmelková, Eva; Keppert, Martin; Černý, Robert

    2016-06-01

    The paper is dealing with selected parameters of four marbles with respect to their utilization as building materials. Stones from four function quarries in the Czech Republic were chosen and scopes of physical properties were determined. Basic physical, mechanical and thermal properties belong among studied characteristics. Bulk density of studied marbles is in average 2750 kg/m3, matrix density 2770 kg/m3, open porosity 0.7%. Pore structure show similar distributions. Mechanical properties show more differences; however minimal value of compressive strength was 66.5 MPa, while maximum was 174 MPa. Thermal conductivity of studied marbles was about 2.955 W/mK. Last measured characteristic was specific heat capacity; its average value was 609 J/kgK.

  20. Self-assembly of Fmoc-diphenylalanine inside liquid marbles.

    PubMed

    Braun, Hans-Georg; Cardoso, André Zamith

    2012-09-01

    Liquid marbles made from Lycopodium clavatum spores are used to encapsulate aqueous solutions of 9-fluorenylmethoxycarbonyl-diphenylalanine (Fmoc-FF). Acidification of the Fmoc-FF solution at the liquid/air interface of the liquid marble triggers the self-assembly of ribbon-like peptide fibrils into an ultrathin peptide membrane (50-500 nm). The membrane incorporates the lycopodium microparticles and as a result stabilizes the liquid marble against collapse, that could otherwise occur through particle disintegration at the floating interphase. Ultrathin nanostructured peptide membrane formation at the liquid/air interface is also observed within artificial microstructured floating objects. Thus, peptide membranes formed were inspected by SEM and TEM. Electron diffraction data reveal information about the molecular organization inside the oligopeptide membranes.

  1. Linking extinction–colonization dynamics to genetic structure in a salamander metapopulation

    PubMed Central

    Cosentino, Bradley J.; Phillips, Christopher A.; Schooley, Robert L.; Lowe, Winsor H.; Douglas, Marlis R.

    2012-01-01

    Theory predicts that founder effects have a primary role in determining metapopulation genetic structure. However, ecological factors that affect extinction–colonization dynamics may also create spatial variation in the strength of genetic drift and migration. We tested the hypothesis that ecological factors underlying extinction–colonization dynamics influenced the genetic structure of a tiger salamander (Ambystoma tigrinum) metapopulation. We used empirical data on metapopulation dynamics to make a priori predictions about the effects of population age and ecological factors on genetic diversity and divergence among 41 populations. Metapopulation dynamics of A. tigrinum depended on wetland area, connectivity and presence of predatory fish. We found that newly colonized populations were more genetically differentiated than established populations, suggesting that founder effects influenced genetic structure. However, ecological drivers of metapopulation dynamics were more important than age in predicting genetic structure. Consistent with demographic predictions from metapopulation theory, genetic diversity and divergence depended on wetland area and connectivity. Divergence was greatest in small, isolated wetlands where genetic diversity was low. Our results show that ecological factors underlying metapopulation dynamics can be key determinants of spatial genetic structure, and that habitat area and isolation may mediate the contributions of drift and migration to divergence and evolution in local populations. PMID:22113029

  2. An examination of intergenomic exchanges in A. laterale-dependent unisexual salamanders in the genus Ambystoma.

    PubMed

    Bi, K; Bogart, J P; Fu, J

    2009-01-01

    The evolutionary longevity of unisexual salamanders in the genus Ambystoma may be attributed to their flexible reproductive system and meiotic intergenomic interactions. More than 20 different unisexual genomic combinations have been found and all the unisexuals live with at least one of the sexual species A. laterale, A. jeffersonianum, A. texanum, and A. tigrinum. Most unisexuals rely on A. laterale orA. jeffersonianum as sperm donors. Intergenomic exchanges were previously reported in A. jeffersonianum-dependent unisexual populations from southern Ontario and are believed to be an important meiotic mechanism that provides genetic diversity. The situations of intergenomic exchanges in many of A. laterale-dependent unisexual populations, however, remain unknown. In this study we collected specimens from populations where unisexuals use A. laterale as sperm donors, including mainly triploid A. 2 laterale--jeffersonianum (or LLJ), and employed genomic in situ hybridization (GISH) to examine the intergenomic exchanges. Five patterns of intergenomic exchanges were detected. Intergenomic exchanges are less frequent and lack association among populations in A. laterale-dependent than in A. jeffersonianum- dependent unisexual populations, but more recombined homeologues were observed in LLJ unisexuals. Our observations show that the patterns and frequencies of intergenomic exchanges are different when unisexuals use different sexual species as sperm donors. We propose a few possible mechanisms that may account for these different observations. PMID:19372668

  3. Cyto-nuclear discordance suggests complex evolutionary history in the cave-dwelling salamander, Eurycea lucifuga.

    PubMed

    Edgington, Hilary A; Ingram, Colleen M; Taylor, Douglas R

    2016-09-01

    Our understanding of the evolutionary history and ecology of cave-associated species has been driven historically by studies of morphologically adapted cave-restricted species. Our understanding of the evolutionary history and ecology of nonrestricted cave species, troglophiles, is limited to a few studies, which present differing accounts of troglophiles' relationship with the cave habitat, and its impact on population dynamics. Here, we used phylogenetics, demographic statistics, and population genetic methods to study lineage divergence, dates of divergence, and population structure in the Cave Salamander, Eurycea lucifuga, across its range. In order to perform these analyses, we sampled 233 individuals from 49 populations, using sequence data from three gene loci as well as genotyping data from 19 newly designed microsatellite markers. We find, as in many other species studied in a phylogeographic context, discordance between patterns inferred from mitochondrial relationships and those inferred by nuclear markers indicating a complicated evolutionary history in this species. Our results suggest Pleistocene-based divergence among three main lineages within E. lucifuga corresponding to the western, central, and eastern regions of the range, similar to patterns seen in species separated in multiple refugia during climatic shifts. The conflict between mitochondrial and nuclear patterns is consistent with what we would expect from secondary contact between regional populations following expansion from multiple refugia. PMID:27648230

  4. Liquid marbles stabilized by charged polymer latexes: how does the drying of the latex particles affect the properties of liquid marbles?

    PubMed

    Sun, Guanqing; Sheng, Yifeng; Wu, Jie; Ma, Guanghui; Ngai, To

    2014-10-28

    The coating of solid particles on the surface of liquid in air makes liquid marbles a promising approach in the transportation of a small amount of liquid. The stabilization of liquid marbles by polymeric latex particles imparts extra triggers such as pH and temperature, leading to the remote manipulation of droplets for many potential applications. Because the functionalized polymeric latexes can exist either as colloidally stable latex or as flocculated latex in a dispersion, the drying of latex dispersions under different conditions may play a significant role in the stabilization of subsequent liquid marbles. This article presents the investigation of liquid marbles stabilized by poly(styrene-co-methacrylic acid) (PS-co-MAA) particles drying under varied conditions. Protonation of the particles before freeze drying makes the particles excellent liquid marble stabilizers, but it is hard to stabilize liquid marbles for particles dried in their deprotonated states. The static properties of liquid marbles with increasing concentrations of protonating reagent revealed that the liquid marbles are gradually undermined by protonating the stabilizers. Furthermore, the liquid marbles stabilized by different particles showed distinct behaviors in separation and merging manipulated by tweezers. This study shows that the initial state of the particles should be carefully taken into account in formulating liquid marbles.

  5. Deep divergences and extensive phylogeographic structure in a clade of lowland tropical salamanders

    PubMed Central

    2012-01-01

    Background The complex geological history of Mesoamerica provides the opportunity to study the impact of multiple biogeographic barriers on population differentiation. We examine phylogeographic patterns in a clade of lowland salamanders (Bolitoglossa subgenus Nanotriton) using two mitochondrial genes and one nuclear gene. We use several phylogeographic analyses to infer the history of this clade and test hypotheses regarding the geographic origin of species and location of genetic breaks within species. We compare our results to those for other taxa to determine if historical events impacted different species in a similar manner. Results Deep genetic divergence between species indicates that they are relatively old, and two of the three widespread species show strong phylogeographic structure. Comparison of mtDNA and nuclear gene trees shows no evidence of hybridization or introgression between species. Isolated populations of Bolitoglossa rufescens from Los Tuxtlas region constitute a separate lineage based on molecular data and morphology, and divergence between Los Tuxtlas and other areas appears to predate the arrival of B. rufescens in other areas west of the Isthmus of Tehuantepec. The Isthmus appears responsible for Pliocene vicariance within B. rufescens, as has been shown for other taxa. The Motagua-Polochic fault system does not appear to have caused population vicariance, unlike in other systems. Conclusions Species of Nanotriton have responded to some major geological events in the same manner as other taxa, particularly in the case of the Isthmus of Tehuantepec. The deep divergence of the Los Tuxtlas populations of B. rufescens from other populations highlights the contribution of this volcanic system to patterns of regional endemism, and morphological differences observed in the Los Tuxtlas populations suggests that they may represent an undescribed species of Bolitoglossa. The absence of phylogeographic structure in B. nympha, in contrast to the

  6. 16. CELLAR, UNDER WEST MEETING ROOM, LOOKING SOUTHEAST. Discarded marble ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    16. CELLAR, UNDER WEST MEETING ROOM, LOOKING SOUTHEAST. Discarded marble range top incorporated into a low brick partition. It is possible the range originally stood between the two brick walls beyond to the right. There appears to be a bricked-up fire box opening in the far wall. The fragments of the marble range top have been catalogued into the Architectural Study Collection of Independence National Historical Park. Dimensions recorded in Field Records. - Twelfth Street Meeting House, 20 South Twelfth Street, Philadelphia, Philadelphia County, PA

  7. Effects of acid rain and sulfur dioxide on marble dissolution

    SciTech Connect

    Schuster, P.F.; Reddy, M.M. ); Sherwood, S.I. )

    1994-01-01

    Acid precipitation and the dry deposition of sulfur dioxide (SO[sub 2]) accelerate damage to carbonate-stone monuments and building materials. This study identified and quantified environmental damage to a sample of Vermont marble during storms and their preceding dry periods. Results from field experiments indicated the deposition of SO[sub 2] gas to the stone surface during dry periods and a twofold increase in marble dissolution during coincident episodes of low rain rate and decreased rainfall pH. The study is widely applicable to the analysis of carbonate-stone damage at locations affected by acid rain and air pollution.

  8. [Caplan's syndrome in marble workers as occupational disease].

    PubMed

    Leikin, Evgeny; Zickel-Shalom, Karin; Balabir-Gurman, Alexandra; Goralnik, Luda; Valdovsky, Evgeny

    2009-08-01

    Rheumatoid pneumoconiosis is an uncommon combination of occupational lung disease caused by exposure to harmful silica dust with rheumatoid inflammation of the joints, rheumatoid arthritis, with an autoimmune background. Until now, the disease was observed mostly among coal and gold miners and granite workers. Written documents on the theme are summarized. This case study outlines the syndrome pathology with typical features presented by the worker, employed for many years in the marble industry. Although in general marble is free of silica, the collection of occupational anamnesis and familiarity with the patient's work conditions and demands gave the authors an opportunity to uncover the exposure source and to determine the most probable diagnosis.

  9. Effects of acid rain and sulfur dioxide on marble dissolution

    USGS Publications Warehouse

    Schuster, Paul F.; Reddy, Michael M.; Sherwood, Susan I.

    1994-01-01

    Acid precipitation and the dry deposition of sulfur dioxide (SO2) accelerate damage to carbonate-stone monuments and building materials. This study identified and quantified environmental damage to a sample of Vermont marble during storms and their preceding dry periods. Results from field experiments indicated the deposition of SO2 gas to the stone surface during dry periods and a twofold increase in marble dissolution during coincident episodes of low rain rate and decreased rainfall pH. The study is widely applicable to the analysis of carbonate-stone damage at locations affected by acid rain and air pollution.

  10. Energy flow and subsidies associated with the complex life cycle of ambystomatid salamanders in ponds and adjacent forest in southern Illinois.

    PubMed

    Regester, Kurt J; Lips, Karen R; Whiles, Matt R

    2006-03-01

    Breeding adults and metamorphosing larval amphibians transfer energy between freshwater and terrestrial ecosystems during seasonal migrations and emergences, although rarely has this been quantified. We intensively sampled ambystomatid salamander assemblages (Ambystoma opacum,A. maculatum, and A. tigrinum) in five forested ponds in southern Illinois to quantify energy flow associated with egg deposition, larval production, and emergence of metamorphosed larvae. Oviposition by female salamanders added 7.0-761.4 g ash-free dry mass (AFDM) year(-1) to ponds (up to 5.5 g AFDM m(-2) year(-1)). Larval production ranged from 0.4 to 7.4 g AFDM m(-2) year(-1) among populations in three ponds that did not dry during larval development, with as much as 7.9 g AFDM m(-2) year(-1) produced by an entire assemblage. Mean larval biomass during cohort production intervals in these three ponds ranged from 0.1 to 2.3 g AFDM m(-2) and annual P/B (production/biomass) ranged from 4 to 21 for individual taxa. Emergent biomass averaged 10% (range = 2-35%) of larval production; larval mortality within ponds accounted for the difference. Hydroperiod and intraguild predation limited larval production in some ponds, but emerging metamorphs exported an average of 70.0+/-33.9 g AFDM year(-1) (range = 21.0-135.2 g AFDM year(-1)) from ponds to surrounding forest. For the three ponds where larvae survived to metamorphosis, salamander assemblages provided an average net flux of 349.5+/-140.8 g AFDM year(-1) into pond habitats. Among all ponds, net flux into ponds was highest for the largest pond and decreased for smaller ponds with higher perimeter to surface area ratios (r2 = 0.94, P<0.05, n = 5). These results are important in understanding the multiple functional roles of salamanders and the impact of amphibian population declines on ecosystems. PMID:16200399

  11. Gene lineages and eastern North American palaeodrainage basins: phylogeography and speciation in salamanders of the Eurycea bislineata species complex.

    PubMed

    Kozak, Kenneth H; Blaine, Russell A; Larson, Allan

    2006-01-01

    Contemporary North American drainage basins are composites of formerly isolated drainages, suggesting that fragmentation and fusion of palaeodrainage systems may have been an important factor generating current patterns of genetic and species diversity in stream-associated organisms. Here, we combine traditional molecular-phylogenetic, multiple-regression, nested clade, and molecular-demographic analyses to investigate the relationship between phylogeographic variation and the hydrogeological history of eastern North American drainage basins in semiaquatic plethodontid salamanders of the Eurycea bislineata species complex. Four hundred forty-two sequences representing 1108 aligned bases from the mitochondrial genome are reported for the five formally recognized species of the E. bislineata complex and three outgroup taxa. Within the in-group, 270 haplotypes are recovered from 144 sampling locations. Geographic patterns of mtDNA-haplotype coalescence identify 13 putatively independent population-level lineages, suggesting that the current taxonomy of the group underestimates species-level diversity. Spatial and temporal patterns of phylogeographic divergence are strongly associated with historical rather than modern drainage connections, indicating that shifts in major drainage patterns played a pivotal role in the allopatric fragmentation of populations and build-up of lineage diversity in these stream-associated salamanders. More generally, our molecular genetic results corroborate geological and faunistic evidence suggesting that palaeodrainage connections altered by glacial advances and headwater erosion occurring between the mid-Miocene and Pleistocene epochs explain regional patterns of biodiversity in eastern North American streams.

  12. The importance of comparative phylogeography in diagnosing introduced species: a lesson from the seal salamander, Desmognathus monticola

    PubMed Central

    Bonett, Ronald M; Kozak, Kenneth H; Vieites, David R; Bare, Alison; Wooten, Jessica A; Trauth, Stanley E

    2007-01-01

    Background In most regions of the world human influences on the distribution of flora and fauna predate complete biotic surveys. In some cases this challenges our ability to discriminate native from introduced species. This distinction is particularly critical for isolated populations, because relicts of native species may need to be conserved, whereas introduced species may require immediate eradication. Recently an isolated population of seal salamanders, Desmognathus monticola, was discovered on the Ozark Plateau, ~700 km west of its broad continuous distribution in the Appalachian Mountains of eastern North America. Using Nested Clade Analysis (NCA) we test whether the Ozark isolate results from population fragmentation (a natural relict) or long distance dispersal (a human-mediated introduction). Results Despite its broad distribution in the Appalachian Mountains, the primary haplotype diversity of D. monticola is restricted to less than 2.5% of the distribution in the extreme southern Appalachians, where genetic diversity is high for other co-distributed species. By intensively sampling this genetically diverse region we located haplotypes identical to the Ozark isolate. Nested Clade Analysis supports the hypothesis that the Ozark population was introduced, but it was necessary to include haplotypes that are less than or equal to 0.733% divergent from the Ozark population in order to arrive at this conclusion. These critical haplotypes only occur in < 1.2% of the native distribution and NCA excluding them suggest that the Ozark population is a natural relict. Conclusion Our analyses suggest that the isolated population of D. monticola from the Ozarks is not native to the region and may need to be extirpated rather than conserved, particularly because of its potential negative impacts on endemic Ozark stream salamander communities. Diagnosing a species as introduced may require locating nearly identical haplotypes in the known native distribution, which may be

  13. Extensive unidirectional introgression between two salamander lineages of ancient divergence and its evolutionary implications.

    PubMed

    Canestrelli, Daniele; Bisconti, Roberta; Nascetti, Giuseppe

    2014-10-01

    Hybridization and introgression, contrary to previous beliefs, are now considered to be widespread processes even among animal species. Nonetheless, the range of their possible outcomes and roles in moulding biodiversity patterns are still far from being fully appraised. Here we investigated the pattern of hybridization and introgression between Salamandrina perspicillata and S. terdigitata, two salamanders endemic to the Italian peninsula. Using a set of diagnostic or differentiated genetic markers (9 nuclear and 1 mitochondrial), we documented extensive unidirectional introgression of S. terdigitata alleles into the S. perspicillata gene pool in central Italy, indicating that barriers against hybridization were permeable when they came into secondary contact, and despite their ancient divergence. Nonetheless, purebred S. terdigitata, as well as F1, F2, and backcrosses were not found within the hybrid zone. Moreover, Bayesian analyses of population structure identified admixed populations belonging to a differentiated gene pool with respect to both parental populations. Overall, the observed genetic structure, together with their geographic pattern of distribution, suggests that Salamandrina populations in central Italy could have entered a distinct evolutionary pathway. How far they have gone along this pathway will deserve future investigation.

  14. Study of marble deterioration at City Hall, Schenectady, New York

    SciTech Connect

    Cheng, R.J.; Castillo, R.

    1984-01-01

    Constructed in 1930 at a cost of over one million dollars, the City Hall in Schenectady, New York, is listed in the U.S. Register of Historical Buildings. The masonry materials were the finest available at the time of construction; granite, fire hardened exterior brick and Vermont marble - Imperical Danby, an equivalent to Carrara marble from Italy. It is known today that the lack of impurities in the Imperial Danby leads to weak crystalline properties. Cleaned with water, sponges and stiff brushes upon completion of construction, the exterior was not cleaned over a fifty-year period. The research indicated that the marble grains are being structurally weakened by a chemical conversion process of marble to gypsum crystals. The surface zone of chemical activity (2-5 mm) shows the presence of fly ash and iron particles and points to the possibility of a catalytic mechanism for the conversion of sulfur dioxide to sulfate. This research has established symptoms which are consistent with prior reported research into building material deterioration. However, the results presented are not supportive of one mechanism over another.

  15. Measuring Marbles: Demonstrating the Basic Tenets of Measurement Theory

    ERIC Educational Resources Information Center

    Wininger, Steven R.

    2007-01-01

    A hands-on activity is described in which students attempt to measure something that they cannot see. In small groups, students estimate the number of marbles in sealed boxes. Next, students' estimates are compared with the actual numbers. Last, values from both the students' estimates and actual numbers are used to explain measurement theory and…

  16. 10. MARBLE BRIDGE MIDSPAN OF EAST ARCH. THE PLATE READS ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    10. MARBLE BRIDGE MIDSPAN OF EAST ARCH. THE PLATE READS MORRIS RUN BRIDGE, 1908, C.F. MOYER, C.Y. STRADLINGS, S.M. FITE, COMMRR'S, S.B. TWINING CO. CONTR, W. CADWALLADER CLERK. - Morris Run Bridge, Rickert Road (TR 417) spanning Morris Run in Hilltown Township, Dublin, Bucks County, PA

  17. Measuring stone weathering in cities: Surface reduction on marble monuments

    SciTech Connect

    Dragovich, D. )

    1987-01-01

    The purpose of this study was to establish whether measurements of stone weathering recorded by different observers could be aggregated into a simple data base for evaluating pollution effects on calcareous building stone. Apparent differences in recorded weathering rates on marble tombstones were here found to be partly a result of lettering size measured, measuring devices used, and individual observers.

  18. A Unit Cell Laboratory Experiment: Marbles, Magnets, and Stacking Arrangements

    ERIC Educational Resources Information Center

    Collins, David C.

    2011-01-01

    An undergraduate first-semester general chemistry laboratory experiment introducing face-centered, body-centered, and simple cubic unit cells is presented. Emphasis is placed on the stacking arrangement of solid spheres used to produce a particular unit cell. Marbles and spherical magnets are employed to prepare each stacking arrangement. Packing…

  19. The MARBLE Project: A Collaborative Framework for Educational Courseware Design.

    ERIC Educational Resources Information Center

    Price, Sarah; McAndrew, Patrick; Rist, Roger; Mayes, Terry; Bonharme, Eric; Land, Ray; Cuttle, Mary; Haywood, Jeff; MacLeod, Hamish

    The MARBLE Project is a collaborative venture that provides on-line resource-based learning materials to students at three higher education institutions in Scotland. As per capita funding from central government decreases without a decline in graduate quality, new methods are sought in universities to cope with this challenge. This paper discusses…

  20. 69. (Credit JTL) View beneath marble meter bench showing hydraulic ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    69. (Credit JTL) View beneath marble meter bench showing hydraulic lines leading to water valve hydraulic control cylinders from control handles in bench; strings and pulleys activate meters. - McNeil Street Pumping Station, McNeil Street & Cross Bayou, Shreveport, Caddo Parish, LA

  1. Axial dynamics during locomotion in vertebrates lesson from the salamander.

    PubMed

    Cabelguen, Jean-Marie; Ijspeert, Auke; Lamarque, Stéphanie; Ryczko, Dimitri

    2010-01-01

    Much of what we know about the flexibility of the locomotor networks in vertebrates is derived from studies examining the adaptation of limb movements during stepping in various conditions. However, the body movements play important roles during locomotion: they produce the thrust during undulatory locomotion and they help to increase the stride length during legged locomotion. In this chapter, we review our current knowledge about the flexibility in the neuronal circuits controlling the body musculature during locomotion. We focus especially on salamander because, as an amphibian, this animal is able to display a rich repertoire of aquatic and terrestrial locomotor modes.

  2. Acid precipitation and embryonic mortality of spotted salamanders, Ambystoma maculatum.

    PubMed

    Pough, F H

    1976-04-01

    Spotted salamanders breed in temporary pools formed in early spring by melted snow and rain. Many of these pools reflect the low pH of precipitation in the northeastern United States. Egg mortality is low (less than 1 percent) in pools near neutrality, but high (greater than 60 percent) in pools more acid than pH 6. Developmental anomalies and the embryonic stage at which death occurs are the same in field situations as at corresponding pH's in laboratory experiments.

  3. Telocytes in ileum of the Chinese giant salamander: ultrastructural evidence.

    PubMed

    Zhang, Hui; Zhong, Shengwei; Ge, Tingting; Peng, Shasha; Yu, Pengcheng; Zhou, Zuohong; Guo, Xiaoquan

    2016-03-01

    Telocytes (TCs) and their telopodes (Tps) have been found in various organs of many mammals, including in lower animals. However, knowledge of TCs in lower animals is still very limited. This study identified TCs and their Tps in the ileum of the Chinese giant salamander, Andrias davidianus (Amphibia: Caudata), by transmission electron microscopy. The TCs/Tps were found near epithelial cells, glandular cells and unmyelinated nerve fibres. Moreover, exosomes were also found to be present in between TCs/Tps and these cells. PMID:26805522

  4. Novel Hydroxyapatite Coatings for the Conservation of Marble and Limestone

    NASA Astrophysics Data System (ADS)

    Naidu, Sonia

    Marble and limestone are calcite-based materials used in the construction of various structures, many of which have significant artistic and architectural value. Unfortunately, due to calcite's high dissolution rate, these stones are susceptible to chemically-induced weathering in nature. Limestone, due to its inherent porosity, also faces other environmental weathering processes that cause weakening from disintegration at grain boundaries. The treatments presently available are all deficient in one way or another. The aim of this work is to examine the feasibility of using hydroxyapatite (HAP) as a novel protective coating for marble and limestone, with two goals: i) to reduce acid corrosion of marble and ii) to consolidate physically weathered limestone. The motivation for using HAP is its low dissolution rate and structural compatibility with calcite. Mild, wet chemical synthesis routes, in which inorganic phosphate-based solutions were reacted with marble and limestone, alone and with other precursors, were used to produce HAP films. Film nucleation, growth and phase evolution were studied on marble to understand film formation and determine the optimal synthesis route. An acid resistance test was developed to investigate the attack mechanism on marble and quantify the efficacy of HAP-based coatings. Film nucleation and growth were dependent on substrate surface roughness and increased with calcium and carbonate salt additions during synthesis. Acid attack on marble occurred via simultaneous dissolution at grain boundaries, twin boundaries and grain surfaces. HAP provided intermediate protection against acid attack, when compared to two conventional treatments. Its ability to protect the stone from acid was not as significant as predicted from dissolution kinetics and this was attributed to incomplete coverage and residual porosity within the film, arising from its flake-like crystal growth habit, which enabled acid to access the underlying substrate. The

  5. Earthworms, as ecosystem engineers, influence multiple aspects of a salamander's ecology.

    PubMed

    Ransom, Tami S

    2011-03-01

    Ecosystem engineers create habitat that can be used by other species in multiple ways, such as refugees from predators, places to breed, or areas with increased prey resources. I conducted a series of enclosure experiments to: (1) determine if salamanders use earthworm burrows, and (2) examine the potential influence of earthworm burrow use and indirect effects on salamander intra- and interspecific competition, predator avoidance, and seasonal performance. I found that one species of woodland salamander, Plethodon cinereus, used earthworm burrows 50% of the time when burrows were present. Neither adults nor juveniles of the congeneric P. glutinosus used earthworm burrows. Intraspecific, but not interspecific, competition by P. cinereus affected salamander behavior when earthworms were absent, with P. cinereus found under cover objects >70% of the time when alone or with a P. glutinosus, but only 40% of the time when with another P. cinereus. When earthworms were present, the behavior of P. cinereus was similar across salamander treatments. Earthworms decreased the amount of leaf litter and microinvertebrates, although this did not affect salamander mass. In subsequent experiments using only P. cinereus, the refuge provided by earthworm burrows increased the survival of P. cinereus over the winter and allowed P. cinereus to avoid being consumed by the common garter snake (Thamnophis sirtalis). Because earthworm burrows provide a refuge for P. cinereus during intraspecific encounters, in the presence of a predator and over the winter, they may serve as an important belowground-aboveground linkage in eastern forests where salamanders are common.

  6. 77 FR 70159 - Marble River, LLC v. Noble Clinton Windpark I, LLC, Noble Ellenburg Windpark, LLC, Noble...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-11-23

    ... Energy Regulatory Commission Marble River, LLC v. Noble Clinton Windpark I, LLC, Noble Ellenburg Windpark..., Marble River, LLC (Marble River or Complainant) filed a formal complaint against Noble Clinton Windpark I... pay Marble River for headroom created by common system upgrade facilities that benefit Noble and...

  7. Genetic dissection of marbling trait through integration of mapping and expression profiling.

    PubMed

    Yamada, Takahisa

    2014-04-01

    Marbling traits, defined by the amount of intramuscular fat, has a heritable component and are quantitative in nature, being influenced by many genes of variable individual effects. The identification of the genetic variation associated with marbling is an important step toward the improvement of beef quality through breeding programs and the understanding of the biological network of marbling. A lot of genomic studies based on functional candidate gene approach and quantitative trait locus (QTL) mapping and many transcriptome studies based on expression profiling, respectively, provide information on variation in genomic regions and individual genes associated with marbling and of genes with marbling-associated expression changes. Further, the integrative approach combining mapping and expression profiling data is proving useful for identifying the causal genes for marbling QTLs. Application of this integrative approach to our marbling study using a rat model, Otsuka Long-Evans Tokushima Fatty (OLETF) rat and Japanese Black beef cattle is introduced finally in this review.

  8. Male pheromone protein components activate female vomeronasal neurons in the salamander Plethodon shermani

    PubMed Central

    Wirsig-Wiechmann, Celeste R; Houck, Lynne D; Wood, Jessica M; Feldhoff, Pamela W; Feldhoff, Richard C

    2006-01-01

    Background The mental gland pheromone of male Plethodon salamanders contains two main protein components: a 22 kDa protein named Plethodon Receptivity Factor (PRF) and a 7 kDa protein named Plethodon Modulating Factor (PMF), respectively. Each protein component individually has opposing effects on female courtship behavior, with PRF shortening and PMF lengthening courtship. In this study, we test the hypothesis that PRF or PMF individually activate vomeronasal neurons. The agmatine-uptake technique was used to visualize chemosensory neurons that were activated by each protein component individually. Results Vomeronasal neurons exposed to agmatine in saline did not demonstrate significant labeling. However, a population of vomeronasal neurons was labeled following exposure to either PRF or PMF. When expressed as a percent of control level labeled cells, PRF labeled more neurons than did PMF. These percentages for PRF and PMF, added together, parallel the percentage of labeled vomeronasal neurons when females are exposed to the whole pheromone. Conclusion This study suggests that two specific populations of female vomeronasal neurons are responsible for responding to each of the two components of the male pheromone mixture. These two neural populations, therefore, could express different receptors which, in turn, transmit different information to the brain, thus accounting for the different female behavior elicited by each pheromone component. PMID:16553953

  9. Generalisation within specialization: inter-individual diet variation in the only specialized salamander in the world.

    PubMed

    Costa, Andrea; Salvidio, Sebastiano; Posillico, Mario; Matteucci, Giorgio; De Cinti, Bruno; Romano, Antonio

    2015-08-21

    Specialization is typically inferred at population and species level but in the last decade many authors highlighted this trait at the individual level, finding that generalist populations can be composed by both generalist and specialist individual. Despite hundreds of reported cases of individual specialization there is a complete lack of information on inter-individual diet variation in specialist species. We studied the diet of the Italian endemic Spectacled Salamander (Salamandrina perspicillata), in a temperate forest ecosystem, to disclose the realised trophic niche, prey selection strategy in function of phenotypic variation and inter-individual diet variation. Our results showed that Salamandrina is highly specialized on Collembola and the more specialized individuals are the better performing ones. Analyses of inter-individual diet variation showed that a subset of animals exhibited a broader trophic niche, adopting different foraging strategies. Our findings reflects the optimal foraging theory both at population and individual level, since animals in better physiological conditions are able to exploit the most profitable prey, suggesting that the two coexisting strategies are not equivalent. At last this species, feeding on decomposers of litter detritus, could play a key role determining litter retention rate, nutrient cycle and carbon sequestration.

  10. Understanding positional cues in salamander limb regeneration: implications for optimizing cell-based regenerative therapies.

    PubMed

    McCusker, Catherine D; Gardiner, David M

    2014-06-01

    Regenerative medicine has reached the point where we are performing clinical trials with stem-cell-derived cell populations in an effort to treat numerous human pathologies. However, many of these efforts have been challenged by the inability of the engrafted populations to properly integrate into the host environment to make a functional biological unit. It is apparent that we must understand the basic biology of tissue integration in order to apply these principles to the development of regenerative therapies in humans. Studying tissue integration in model organisms, where the process of integration between the newly regenerated tissues and the 'old' existing structures can be observed and manipulated, can provide valuable insights. Embryonic and adult cells have a memory of their original position, and this positional information can modify surrounding tissues and drive the formation of new structures. In this Review, we discuss the positional interactions that control the ability of grafted cells to integrate into existing tissues during the process of salamander limb regeneration, and discuss how these insights could explain the integration defects observed in current cell-based regenerative therapies. Additionally, we describe potential molecular tools that can be used to manipulate the positional information in grafted cell populations, and to promote the communication of positional cues in the host environment to facilitate the integration of engrafted cells. Lastly, we explain how studying positional information in current cell-based therapies and in regenerating limbs could provide key insights to improve the integration of cell-based regenerative therapies in the future.

  11. Generalisation within specialization: inter-individual diet variation in the only specialized salamander in the world

    PubMed Central

    Costa, Andrea; Salvidio, Sebastiano; Posillico, Mario; Matteucci, Giorgio; De Cinti, Bruno; Romano, Antonio

    2015-01-01

    Specialization is typically inferred at population and species level but in the last decade many authors highlighted this trait at the individual level, finding that generalist populations can be composed by both generalist and specialist individual. Despite hundreds of reported cases of individual specialization there is a complete lack of information on inter-individual diet variation in specialist species. We studied the diet of the Italian endemic Spectacled Salamander (Salamandrina perspicillata), in a temperate forest ecosystem, to disclose the realised trophic niche, prey selection strategy in function of phenotypic variation and inter-individual diet variation. Our results showed that Salamandrina is highly specialized on Collembola and the more specialized individuals are the better performing ones. Analyses of inter-individual diet variation showed that a subset of animals exhibited a broader trophic niche, adopting different foraging strategies. Our findings reflects the optimal foraging theory both at population and individual level, since animals in better physiological conditions are able to exploit the most profitable prey, suggesting that the two coexisting strategies are not equivalent. At last this species, feeding on decomposers of litter detritus, could play a key role determining litter retention rate, nutrient cycle and carbon sequestration. PMID:26292804

  12. Generalisation within specialization: inter-individual diet variation in the only specialized salamander in the world.

    PubMed

    Costa, Andrea; Salvidio, Sebastiano; Posillico, Mario; Matteucci, Giorgio; De Cinti, Bruno; Romano, Antonio

    2015-01-01

    Specialization is typically inferred at population and species level but in the last decade many authors highlighted this trait at the individual level, finding that generalist populations can be composed by both generalist and specialist individual. Despite hundreds of reported cases of individual specialization there is a complete lack of information on inter-individual diet variation in specialist species. We studied the diet of the Italian endemic Spectacled Salamander (Salamandrina perspicillata), in a temperate forest ecosystem, to disclose the realised trophic niche, prey selection strategy in function of phenotypic variation and inter-individual diet variation. Our results showed that Salamandrina is highly specialized on Collembola and the more specialized individuals are the better performing ones. Analyses of inter-individual diet variation showed that a subset of animals exhibited a broader trophic niche, adopting different foraging strategies. Our findings reflects the optimal foraging theory both at population and individual level, since animals in better physiological conditions are able to exploit the most profitable prey, suggesting that the two coexisting strategies are not equivalent. At last this species, feeding on decomposers of litter detritus, could play a key role determining litter retention rate, nutrient cycle and carbon sequestration. PMID:26292804

  13. Range-wide phylogeography and conservation genetics of a narrowly endemic stream salamander, Pachyhynobius shangchengensis (Caudata, Hynobiidae): implications for conservation.

    PubMed

    Pan, T; Wang, H; Hu, C-C; Shi, W-B; Zhao, K; Huang, X; Zhang, B-W

    2014-02-13

    The Shangcheng stout salamander (Pachyhynobius shangchengensis) is an endangered amphibian endemic to the Dabie Mountains, southeast China, and is currently threatened by habitat loss and illegal poaching. Here we used the mitochondrial DNA control region sequence (768 bp) to conduct a comprehensive investigation of genetic diversity, phylogeographic pattern, and demographic history of the species across its geographic distribution to assist its conservation. We concluded that the levels of genetic variation are relatively low in all four populations. Analysis of molecular variance indicated that the most likely phylogeographic pattern is [JGT] [KHJ] [TM, BYM]. Two distinct clades were identified in the phylogenetic tree of 28 haplotypes, corresponding to the two southern populations (TM, BYM) and two northern populations (JGT, KHJ). Significant population differentiation (FST) was detected among all populations. Among the four populations, historical demographic analyses (e.g., the g parameter, the Tajima D test, and the Fu Fs test) did not reveal definite information on population expansion except for the BYM population, which had undergone a strong population expansion event. Based on the analysis of a Bayesian skyline plot, the total population underwent a significant population fluctuation around 20 kya. This may have been triggered by the end of the last glacial maximum. In conclusion, the existence of three evolutionarily significant units (BMY-TM, KHJ, and JGT) and four management units (BMY, TM, KHJ, and JGT) is supported by our study.

  14. Range-wide phylogeography and conservation genetics of a narrowly endemic stream salamander, Pachyhynobius shangchengensis (Caudata, Hynobiidae): implications for conservation.

    PubMed

    Pan, T; Wang, H; Hu, C-C; Shi, W-B; Zhao, K; Huang, X; Zhang, B-W

    2014-01-01

    The Shangcheng stout salamander (Pachyhynobius shangchengensis) is an endangered amphibian endemic to the Dabie Mountains, southeast China, and is currently threatened by habitat loss and illegal poaching. Here we used the mitochondrial DNA control region sequence (768 bp) to conduct a comprehensive investigation of genetic diversity, phylogeographic pattern, and demographic history of the species across its geographic distribution to assist its conservation. We concluded that the levels of genetic variation are relatively low in all four populations. Analysis of molecular variance indicated that the most likely phylogeographic pattern is [JGT] [KHJ] [TM, BYM]. Two distinct clades were identified in the phylogenetic tree of 28 haplotypes, corresponding to the two southern populations (TM, BYM) and two northern populations (JGT, KHJ). Significant population differentiation (FST) was detected among all populations. Among the four populations, historical demographic analyses (e.g., the g parameter, the Tajima D test, and the Fu Fs test) did not reveal definite information on population expansion except for the BYM population, which had undergone a strong population expansion event. Based on the analysis of a Bayesian skyline plot, the total population underwent a significant population fluctuation around 20 kya. This may have been triggered by the end of the last glacial maximum. In conclusion, the existence of three evolutionarily significant units (BMY-TM, KHJ, and JGT) and four management units (BMY, TM, KHJ, and JGT) is supported by our study. PMID:24615095

  15. Use of expected progeny differences for marbling in beef: II. Carcass and palatability traits.

    PubMed

    Gwartney, B L; Calkins, C R; Rasby, R J; Stock, R A; Vieselmeyer, B A; Gosey, J A

    1996-05-01

    A 2-yr study was conducted to determine the effect of EPD for marbling on marbling score, palatability traits, and carcass fatness in beef. Steer (n = 122) and heifer (n = 123) carcasses were obtained by mating Angus bulls having a high ( > .4) or low ( < -.16) EPD for marbling to MARC II cows (1/4 Angus, 1/4 Hereford, 1/4 Simmental, and 1/4 Gelbvieh). Carcass traits, composition of primals, quarters, and sides, palatability, and shear force data were obtained and adjusted to the mean number of days on feed, equal marbling score (Small50), fat thickness (1.0 cm), and carcass weight (318 kg) end points. Steer carcasses from the high marbling EPD group, adjusted to the mean number of days on feed, had significantly more marbling (P < .01) and less subcutaneous fat in the side and the hindquarter (P < .10) than their low marbling EPD counterparts. Adjusting steers to Small50 marbling produced smaller longissimus muscle area (by 5 cm2), less fat thickness (1.15 vs 1.28 cm), and lighter side weights (306 vs 333 kg) for high marbling vs low marbling EPD groups, indicating a faster rate of marbling deposition. Similar relationships of a greater magnitude were found for heifers, perhaps because the heifers were older than the steers at slaughter. No differences in taste panel ratings or shear force values were noted among steer carcasses. Heifer carcasses from the high marbling EPD group had better (P < .05) ratings for juiciness, muscle fiber tenderness, and overall tenderness than the low marbling EPD group heifers. These results indicate that it is possible, using existing genetic resources, to maintain marbling score and decrease fat in other depots of the carcass without compromising palatability. PMID:8726733

  16. Breeding biology of the spotted salamander Ambystoma maculatum (Shaw) in acidic temporary ponds at Cape Cod, USA

    USGS Publications Warehouse

    Portnoy, J.W.

    1990-01-01

    The relationship between water chemistry and breeding success of spotted salamanders Ambystoma maculatum (Shaw) was examined in temporary woodland ponds on outer Cape Cod, Massachusetts in 1985 and 1986. Most pond waters were dilute (3median coductivity = 57 umhos cm-1 (1 umhos cm-1 = 0?1 mSm-1)), acidic (median pH = 4?82), and highly colored (median = 140 Pt-Co units). Most acidity was due to abundant organic acids. Salamander survival to hatching was over 80% at 8 of 12 ponds monitored. Complete mortality, preceded by gross abnormalities, was observed only among embryos in the most acidic spawning pond (pH 4?3-4?5) in both years. Embryo transfers between ponds and laboratory studies indicated that reduced survival was due to the interaction of low pH with high tannin-lignin concentration. The use of amphibian embryonic survival to indicate acid rain effects is complicated by multiple habitat parameters and should only be attempted in conjunction with long-term population monitoring.

  17. Science Review for the Scott Bar Salamander (Plethodon asupak) and the Siskiyou Mountains Salamander (P. stormi): Biology, Taxonomy, Habitat, and Detection Probabilities/Occupancy

    USGS Publications Warehouse

    DeGross, Douglas J.; Bury, R. Bruce

    2007-01-01

    The Plethodon elongatus Complex in the Klamath-Siskiyou Ecoregion of southern Oregon and northern California includes three species: the Del Norte salamander, Plethodon elongatus; the Siskiyou Mountains salamander, P. stormi; and the Scott Bar salamander, P. asupak. This review aims to summarize the current literature and information available on select topics for P. stormi and P. asupak. These are both terrestrial salamanders belonging to the Family Plethodontidae, which contains more species and has a wider geographic distribution than any other family of salamanders (Wake 1966, 2006; Pough 1989). The genera of this family have greatly diversified ecologically across North America, Central America, northern South America, Sardinia, southeastern France and northwestern Italy, and have recently been discovered on the Korean peninsula (Min et al. 2005). The genus Plethodon is found exclusively in North America and is split into three distinct clades, based upon morphology and phylogenetics (Highton and Larson 1979): eastern small Plethodon, eastern large Plethodon, and the western Plethodon. The western Plethodon are the greatest representation of Plethodontidae in the Pacific Northwest, with 8 species. The two species with the most restricted ranges of these regional congeners are the Siskiyou Mountains and Scott Bar salamanders. These salamanders occupy the interior of the Klamath-Siskiyou Ecoregion which straddles the California and Oregon state lines, between Siskiyou County (CA) and Jackson and Josephine Counties (OR). The relatively recent discovery of P. asupak (Mead et al. 2005) and the limited range of both species have created an environment of uncertain conservation status for these species. This review will focus on four central topics of concern for land and resource managers: Biology; Taxonomy; Habitat; and Detection Probabilities/Occupancy.

  18. A new species of salamander (Caudata: Plethodontidae, Bolitoglossa) from Sierra Nevada de Mérida, Venezuela.

    PubMed

    García-Gutiérrez, Javier; Escalona, Moisés; Mora, Andrés; Díaz De Pascual, Amelia; Fermin, Gustavo

    2013-01-01

    In this article, a new species of salamander of the genus Bolitoglossa (Eladinea) from the cloud forest near La Mucuy in Sierra Nevada de Mérida, Venezuelan Andes, is described. Bolitoglossa mucuyensis sp. nov. differs from all Venezuelan salamanders, except B. orestes, by a larger SVL/TL ratio, and from La Culata salamander B. orestes by a reduced webbing extension of the front and hind limbs. Additionally, B. mucuyensis sp. nov. and B. orestes diverge 3.12% in terms of the nucleotide sequence of the 16S rRNA gene, as previously reported, and in 8.1% for the cytb gene as shown in this study.

  19. A field test of the effect of acidic rain on ion balance in a woodland salamander

    SciTech Connect

    Frisbie, M.P.; Wyman, R.L. )

    1994-06-01

    Earlier laboratory studies demonstrated that red-backed salamanders, Plethodon cinereus, are susceptible to osmotic disruption by low pH substrates. In natural systems, however, acidic input from precipitation may be mediated by soils before it impacts salamanders. We tested the effect of acidic rain on sodium balance in salamanders by confining individuals in enclosure in two forest types (hemlock, beech) for 34 d. Enclosures received artificial rain of either pH 3 or 5 every 3-4 d. Soils inside enclosures in the hemlock forest were more acidic than those in the beech forest at the outset. At termination, [H[sup +

  20. Extreme negative temperatures and body mass loss in the Siberian salamander (Salamandrella keyserlingii, amphibia, hynobiidae).

    PubMed

    Berman, D I; Meshcheryakova, E N; Bulakhova, N A

    2016-05-01

    Frozen Siberian salamander safely tolerates long (45 days) stay at-35°C. Short-term (3 days) cooling down to-50°C was tolerable for 40% of adult individuals; down to-55°C, for 80% of the underyearlings. Generally, the salamanders lose about 28% of the body mass during the pre-hibernating period (before winter, at temperatures as low as 0°C) and during the process of freezing (as low as-5°C). The body weight remained constant upon further cooling (to-35°C). The frozen salamanders have no physiological mechanisms protecting from sublimation. PMID:27411827

  1. Effect of packaging atmospheres on storage quality characteristics of heavily marbled beef longissimus steaks.

    PubMed

    Yang, Xiaoyin; Zhang, Yimin; Zhu, Lixian; Han, Mingshan; Gao, Shujuan; Luo, Xin

    2016-07-01

    The objective of this study was to investigate the effects of modified atmosphere packaging (MAP) systems on shelf-life and quality of beef steaks with high marbling. Four packaging types were used including 80% O2 MAP (80% O2+20% CO2), 50% O2 MAP (50% O2+30% CO2+20% N2), carbon monoxide MAP (0.4% CO+30% CO2+69.6% N2) and vacuum packaging (VP). Steaks were displayed under simulated retail conditions at 4°C for 12days. Purge loss, pH, color stability, oxidative stability and microbial counts were monitored. Aerobically packaged steaks exhibited a bright-red color at the first 4days. However, discoloration and oxidation became major factors limiting their shelf-life to 8days. Compared with aerobic packaging, anaerobic packaging extended shelf-life of heavily marbled beef steaks, due to better color stability, together with lower oxidation and microbial populations. Among all packaging methods, CO-MAP had the best preservation for steaks, with more red color than other packaging types. PMID:26946476

  2. Phylogeny, evolution, and biogeography of Asiatic Salamanders (Hynobiidae).

    PubMed

    Zhang, Peng; Chen, Yue-Qin; Zhou, Hui; Liu, Yi-Fei; Wang, Xiu-Ling; Papenfuss, Theodore J; Wake, David B; Qu, Liang-Hu

    2006-05-01

    We sequenced 15 complete mitochondrial genomes and performed comprehensive molecular phylogenetic analyses to study the origin and phylogeny of the Hynobiidae, an ancient lineage of living salamanders. Our phylogenetic analyses show that the Hynobiidae is a clade with well resolved relationships, and our results contrast with a morphology-based phylogenetic hypothesis. These salamanders have low vagility and are limited in their distribution primarily by deserts, mountains, and oceans. Our analysis suggests that the relationships among living hynobiids have been shaped primarily by geography. We show that four-toed species assigned to Batrachuperus do not form a monophyletic group, and those that occur in Afghanistan and Iran are transferred to the resurrected Paradactylodon. Convergent morphological characters in different hynobiid lineages are likely produced by similar environmental selective pressures. Clock-independent molecular dating suggests that hynobiids originated in the Middle Cretaceous [ approximately 110 million years ago (Mya)]. We propose an "out of North China" hypothesis for hynobiid origins and hypothesize an ancestral stream-adapted form. Given the particular distributional patterns and our molecular dating estimates, we hypothesize that: (i) the interior desertification from Mongolia to Western Asia began approximately 50 Mya; (ii) the Tibetan plateau (at least on the eastern fringe) experienced rapid uplift approximately 40 Mya and reached an altitude of at least 2,500 m; and (iii) the Ailao-Red River shear zone underwent the most intense orogenic movement approximately 24 Mya.

  3. Spermatogenic cycle of a plethodontid salamander, Eurycea longicauda (Amphibia, Urodela)

    PubMed Central

    Siegel, Dustin S; Alvino, Sam; Trauth, Stanley E; Sever, David M; Gribbins, Kevin M

    2014-01-01

    Previous investigators have described the spermatogenic cycles of numerous species of plethodontid salamanders. Most studies describe a fairly stereotypical cycle with meiotic divisions of spermatogenesis commencing in the spring/summer. However, many studies lack details obtainable from histological examination and/or testicular squashes and, instead, provide only mensural data from the testes. Studies that lacked microscopic evaluation often revealed spermatogenic cycles that varied greatly from that of the stereotypical cycle with meiotic divisions commencing in the fall/winter. Those studies hamper comparisons between the spermatogenic cycles of different species and their environments, as they do not provide a correlation between testicular size and any aspect of the spermatogenic cycle. In the following manuscript, we elucidate the spermatogenic cycle of Eurycea longicauda longicauda in an effort to outline an appropriate protocol for analyzing spermatogenesis in salamanders that will facilitate future comparative studies. Like many Nearctic plethodontids, E. l. longicauda exhibits a meiotic wave that travels through the testes during the summer; this process is followed by spermiogenesis, spermiation, and recrudescence in the fall, winter, and spring. PMID:26413402

  4. Sensitivity of two salamander (Ambystoma) species to ultraviolet radiation

    USGS Publications Warehouse

    Calfee, R.D.; Bridges, C.M.; Little, E.E.

    2006-01-01

    Increased ultraviolet-B (UV-B) radiation reaching the Earth's surface has been implicated in amphibian declines. Recent studies have shown that many amphibian species have differences in sensitivity depending on developmental stage. Embryos and larvae of Ambystoma maculatum (Spotted Salamander) and larvae of Ambystoma talpoideum (Mole Salamander) were exposed to five simulated UV-B treatments in controlled laboratory experiments to determine the relative sensitivity of different lifestages. Hatching success of the embryos exceeded 95% in all treatments; however, the larvae of both species exhibited greater sensitivity to UV-B exposure. Older larvae of A. maculatum that were not exposed to UV-B as embryos were more sensitive than larvae that had hatched during exposure to UV-B. Growth of surviving larvae of A. maculatum was significantly reduced as UV-B intensity increased, whereas growth of A. talpoideum was unaffected. These results were compared to ambient UV-B conditions in natural environments. It appears that the embryo stage is relatively unaffected by UV-B levels observed in natural habitats, probably because of protection from vegetation, organic matter in the water column, oviposition depth, and egg jelly. The larval stage of these species may be at greater risk, particularly if there is an increase in UV-B radiation exposure caused by increases in water clarity and/or decreases in dissolved organic carbon.

  5. Potential rapid evolution of foot morphology in Italian plethodontid salamanders (Hydromantes strinatii) following the colonization of an artificial cave.

    PubMed

    Salvidio, S; Crovetto, F; Adams, D C

    2015-07-01

    How organisms respond to environmental change is a long-standing question in evolutionary biology. Species invading novel habitats provide an opportunity to examine contemporary evolution in action and decipher the pace of evolutionary change over short timescales. Here, we characterized phenotypic evolution in the Italian plethodontid salamander, Hydromantes strinatii, following the recent colonization of an artificial cave by a forest floor population. When compared with a nearby and genetically related population in the natural forest floor and a nearby cave population, the artificial cave population displayed significant differences in overall foot shape, with more interdigital webbing relative to the other populations. Further, this population evolved significantly larger feet, which corresponded more closely to those found in other cave populations than to forest floor populations to which the cave population is closely related. Finally, we quantified the rate of evolution for both foot shape and foot area, and found that both traits displayed large and significant evolutionary rates, at levels corresponding to other classic cases of rapid evolution in vertebrates. Together, these findings reveal that the response to novel environmental pressures can be large and rapid and that the anatomical shifts observed in the artificial cave population of H. strinatii may represent a case of rapid evolution in response to novel environmental pressures.

  6. Life history differences influence the impacts of drought on two pond-breeding salamanders.

    PubMed

    Anderson, Thomas L; Ousterhout, Brittany H; Peterman, William E; Drake, Dana L; Semlitsch, Raymond D

    2015-10-01

    Drought is a strong density-independent environmental filter that contributes to population regulation and other ecological processes. Not all species respond similarly to drought, and the overall impacts can vary depending on life histories. Such differences can necessitate management strategies that incorporate information on individual species to maximize conservation success. We report the effects of a short-term drought on occupancy and reproductive success of two pond-breeding salamanders that differ in breeding phenology (fall vs. spring breeder) across an active military base landscape in Missouri, USA: We surveyed ~200 ponds for the presence of eggs, larvae, and metamorphs from 2011 to 2013. This period coincided with before, during, and after a severe drought that occurred in 2012. The two species showed contrasting responses to drought, where high reproductive failure (34% of ponds) was observed for the spring breeder during a single drought year. Alternatively, the fall breeder only showed a cumulative 8% failure over two years. The number of breeding ponds available for use in the fall decreased during the drought due to pond drying and/or a lack of re-filling. Estimates of occupancy probability declined for the fall-breeding salamander between 2012 and 2013, whereas occupancy probability estimates of the spring breeder increased post-drought. The presence of fish, hydroperiod, the amount of forest cover surrounding ponds, and canopy cover were all found to affect estimates of occupancy probabilities of each species. Pond clustering (distance to nearest pond and the number of ponds within close proximity), hydroperiod, forest cover, and canopy cover influenced both estimates of colonization and extinction probabilities. Our results show life history variation can be important in determining the relative susceptibility of a species to drought conditions, and that sympatric species experiencing the same environmental conditions can respond differently

  7. Overwintered Bullfrog tadpoles negatively affect Salamanders and Anurans in native amphibian communities

    USGS Publications Warehouse

    Boone, M.D.; Little, E.E.; Semlitsch, R.D.

    2004-01-01

    We examined the interactive effects of overwintered Bullfrog (Rana catesbeiana) tadpoles and pond hydroperiod on a community of larval amphibians in outdoor mesocosms including American Toads (Bufo americanus), Southern Leopard Frogs (Rana sphenocephala), and Spotted Salamanders (Ambystoma maculatum) - species within the native range of Bullfrogs. Spotted Salamanders and Southern Leopard Frogs were negatively influenced by the presence of overwintered Bullfrogs. Spotted Salamanders had shorter larval periods and slightly smaller masses at metamorphosis, and Southern Leopard Frogs had smaller masses at metamorphosis when reared with Bullfrogs than without. Presence of overwintered Bullfrogs, however, did not significantly affect American Toads. Longer pond hydroperiods resulted in greater survival, greater size at metamorphosis, longer larval periods, and later time until emergence of the first metamorphs for Southern Leopard Frog tadpoles and Spotted Salamander larvae. Our study demonstrated that overwintered Bullfrog tadpoles can respond to changing pond hydroperiods and can negatively impact metamorphosis of native amphibians.

  8. Larval salamanders and channel geomorphology are indicators of hydrologic permanence in forested headwater streams

    EPA Science Inventory

    Regulatory agencies need rapid indicators of hydrologic permanence for jurisdictional determinations of headwater streams. Our study objective was to assess the utility of larval salamander presence and assemblage structure and habitat variables for determining stream permanence ...

  9. [Phylogenetic relationships among Asiatic salamanders of the genus Salamandrella based on variability of nuclear genes].

    PubMed

    Maliarchuk, B A; Derenko, M V; Denisova, G A

    2015-01-01

    Based on sequence variation of three nuclear genome genes (BDNF, POMC, and RAG1), the phylogenetic relationships among Asiatic salamanders of the genus Salamandrella, Siberian salamander (S. keyserlingii) and Schrenk salamander (S. schrenkii), were examined. Both species demonstrated high levels of heterozygosity determined by intraspecific polymorphism. Fixed interspecific differences were revealed at one nucleotide position of the RAG1 gene, and thus the level of interspecific divergence over the three genes constituted only 0.04%. Analysis of the RAG1 polymorphism across the whole range of S. keyserlingii showed that only one gene variant, encoding for modified RAG1 recombinase, had the highest distribution to the north of the Amur region (west and northeast of Siberia). It is possible that the changes in the RAG1 gene in Siberian salamander are of an adaptive nature. However, cases of interspecific hybridization were identified in Jewish autonomous oblast (JAO), which contains one of the range borders between the two Salamandrella species. PMID:25857197

  10. Radiation Shielding Properties of Some Marbles in Turkey

    SciTech Connect

    Guenoglu, K.; Akkurt, I.

    2011-12-26

    Especially after development of technology, radiation started to be used in a large fields such as medicine, industry and energy. Using radiation in those fields bring hazardous effect of radiation into humancell. Thus radiation protection becomes important in physics. Although there are three ways for radiation protection, shielding of the radiation is the most commonly used method. Natural Stones such as marble is used as construction material especially in critical building and thus its radiation shielding capability should be determined.In this study, gamma ray shielding properties of some different types of marble mined in Turkey, have been measured using a NaI(Tl) scintillator detector. The measured results were also compared with the theoretical calculations XCOM.

  11. Laboratory testing of sealants with a marble substrate

    SciTech Connect

    Farmer, M.C.; Cechner, R.A.

    1996-12-31

    Polyurethane and silicone sealants are widely specified for installations with porous substrates such as some stones. However, when a sealant is used against such surfaces, there is a potential for a lack of adequate adhesion, or staining of the tone by misapplication or migration of the liquid components of the sealant system, such as primers or plasticizers in the formulation. Some varieties of marble in particular have been reported to be susceptible to staining and discoloration over time from sealants. Application of new sealant over existing sealants is also of great concern for remedial applications. Determining the level of substrate preparation necessary to achieve adequate bond is critical to the success of the remedial construction project. This paper discusses the development and results of a test program conducted to determine the relative performance of sealants installed on a white marble substrate. The tests performed included wet adhesion tests, accelerated weathering studies, and staining due to plasticizer migration.

  12. Oxalate films and red stains on Carrara marble.

    PubMed

    Realini, Marco; Colombo, Chiara; Sansonetti, Antonio; Rampazzi, Laura; Colombini, Maria Perla; Bonaduce, Ilaria; Zanardini, Elisabetta; Abbruscato, Pamela

    2005-01-01

    The analytical studies carried out during two different diagnostic surveys, respectively in 1983 and 2003, offered the opportunity to control decay phenomena development on stones facing Certosa of Pavia (Italy). Calcium oxalate films and red stains, present on Carrara marble surface, have been particularly focused; these are the only decay phenomena which apparently have remained unchanged during a period of twenty years. More sensitive and in-depth analytical studies (FTIR equipped with diamond cell, GC-MS, SEM-EDS and optical microscopy) achieved a better knowledge about their composition. Results allowed a critical evaluation of the role of oxalate films on the external marble surface and to suggest new hypotheses about the formation of red stains. PMID:16485663

  13. Radiation Shielding Properties of Some Marbles in Turkey

    NASA Astrophysics Data System (ADS)

    Günoǧlu, K.; Akkurt, I.

    2011-12-01

    Especially after development of technology, radiation started to be used in a large fields such as medicine, industry and energy. Using radiation in those fields bring hazordous effect of radition into humancell. Thus radiation protection becomes important in physics. Although there are three ways for radiation protection, shielding of the radiation is the most commonly used method. Natural Stones such as marble is used as construction material especially in critical building and thus its radiation shielding capability should be determined. In this study, gamma ray shielding properties of some different types of marble mined in Turkey, have been measured using a NaI(Tl) scintillator detector. The measured results were also compared with the theoretical calculations XCOM.

  14. Diagnostic and molecular evaluation of three iridovirus-associated salamander mortality events

    USGS Publications Warehouse

    Docherty, D.E.; Meteyer, C.U.; Wang, Jingyuan; Mao, J.; Case, S.T.; Chinchar, V.G.

    2003-01-01

    In 1998 viruses were isolated from tiger salamander larvae (Ambystoma tigrinum diaboli and A. tigrinum melanostictum) involved in North Dakota and Utah (USA) mortality events and spotted salamander (A. maculatum) larvae in a third event in Maine (USA). Although sympatric caudates and anurans were present at all three sites only ambystomid larvae appeared to be affected. Mortality at the North Dakota site was in the thousands while at the Utah and Maine sites mortality was in the hundreds. Sick larvae were lethargic and slow moving. They swam in circles with obvious buoyancy problems and were unable to remain upright. On the ventral surface, near the gills and hind limbs, red spots or swollen areas were noted. Necropsy findings included: hemorrhages and ulceration of the skin, subcutaneous and intramuscular edema, swollen and pale livers with multifocal hemorrhage, and distended fluid-filled intestines with areas of hemorrhage. Light microscopy revealed intracytoplasmic inclusions, suggestive of a viral infection, in a variety of organs. Electron microscopy of ultra thin sections of the same tissues revealed iridovirus-like particles within the inclusions. These viruses were isolated from a variety of organs, indicating a systemic infection. Representative viral isolates from the three mortality events were characterized using molecular assays. Characterization confirmed that the viral isolates were iridoviruses and that the two tiger salamander isolates were similar and could be distinguished from the spotted salamander isolate. The spotted salamander isolate was similar to frog virus 3, the type species of the genus Ranavirus, while the tiger salamander isolates were not. These data indicate that different species of salamanders can become infected and die in association with different iridoviruses. Challenge assays are required to determine the fish and amphibian host range of these isolates and to assess the susceptibility of tiger and spotted salamanders to

  15. Tiger salamanders' (Ambystoma tigrinum) response learning and usage of visual cues.

    PubMed

    Kundey, Shannon M A; Millar, Roberto; McPherson, Justin; Gonzalez, Maya; Fitz, Aleyna; Allen, Chadbourne

    2016-05-01

    We explored tiger salamanders' (Ambystoma tigrinum) learning to execute a response within a maze as proximal visual cue conditions varied. In Experiment 1, salamanders learned to turn consistently in a T-maze for reinforcement before the maze was rotated. All learned the initial task and executed the trained turn during test, suggesting that they learned to demonstrate the reinforced response during training and continued to perform it during test. In a second experiment utilizing a similar procedure, two visual cues were placed consistently at the maze junction. Salamanders were reinforced for turning towards one cue. Cue placement was reversed during test. All learned the initial task, but executed the trained turn rather than turning towards the visual cue during test, evidencing response learning. In Experiment 3, we investigated whether a compound visual cue could control salamanders' behaviour when it was the only cue predictive of reinforcement in a cross-maze by varying start position and cue placement. All learned to turn in the direction indicated by the compound visual cue, indicating that visual cues can come to control their behaviour. Following training, testing revealed that salamanders attended to stimuli foreground over background features. Overall, these results suggest that salamanders learn to execute responses over learning to use visual cues but can use visual cues if required. Our success with this paradigm offers the potential in future studies to explore salamanders' cognition further, as well as to shed light on how features of the tiger salamanders' life history (e.g. hibernation and metamorphosis) impact cognition. PMID:26796198

  16. Using a GIS model to assess terrestrial salamander response to alternative forest management plans.

    PubMed

    Gustafson, E J; Murphy, N L; Crow, T R

    2001-11-01

    A GIS model predicting the spatial distribution of terrestrial salamander abundance based on topography and forest age was developed using parameters derived from the literature. The model was tested by sampling salamander abundance across the full range of site conditions used in the model. A regression of the predictions of our GIS model against these sample data showed that the model has a modest but significant ability to predict both salamander abundance and mass per unit area. The model was used to assess the impacts of alternative management plans for the Hoosier National Forest (Indiana, USA) on salamanders. These plans differed in the spatial delineation of management areas where timber harvest was permitted, and the intensity of timber harvest within those management areas. The spatial pattern of forest openings produced by alternative forest management scenarios based on these plans was projected over 150 years using a timber-harvest simulator (HARVEST). We generated a predictive map of salamander abundance for each scenario over time, and summarized each map by calculating mean salamander abundance and the mean colonization distance (average distance from map cells with low predicted abundance to those with relatively high abundance). Projected salamander abundance was affected more by harvest rate (area harvested each decade) than by the management area boundaries. The alternatives had a varying effect on the mean distance salamanders would have to travel to colonize regenerating stands. Our GIS modeling approach is an example of a spatial analytical tool that could help resource management planners to evaluate the potential ecological impact of management alternatives. PMID:11775500

  17. Plethodon cinerius (eastern red-backed salamander) movement

    USGS Publications Warehouse

    Sterrett, Sean; Brand, Adrianne; Fields, William R.; Katz, Rachel A.; Grant, Evan H. Campbell

    2015-01-01

    Lungless salamanders (family Plethodontidae) are relatively sedentary and are presumed to have limited dispersal ability (Marsh et al. 2004. Ecology 85:3396–3405). Site fidelity in Plethodontidae is high, and individuals displaced 90 m return to home territories (Kleeberger and Werner 1982. Copeia 1982:409–415). Individuals defend territories (Jaeger et al. 1982. Anim. Behav. 30:490–496) and female home ranges have been estimated to be 24.34 m2 (Kleeberger and Werner 1982, op. cit.). Females may seek out suitable subsurface habitat to oviposit eggs, yet little is known about their maximum movement distances (Petranka 1998. Salamanders of the United States and Canada. Smithsonian Institution Press, Washington. 587 pp.).On 18 September 2014, a female P. cinereus (lead back morphotype; SVL = 44.68 mm; 0.89 g) was found under a coverboard during a standard sampling event and uniquely marked using visual implant elastomer at the S.O. Conte Anadromous Fish Research Center, Massachusetts, USA (42.59280°N, 72.58070°W, datum WGS84; elev. 74 m). This individual was subsequently recaptured at ~1500 h on 8 October 2014 under a coverboard within 3 m of the original capture location and then again ~1430 h on 16 October 2014 under a log, within the same forest patch, though in a 50 x 150 m area adjacent to the original study area. Because we found the marked salamander while collecting multiple individuals for a laboratory study, the exact recapture location of the marked individual is not known. However, the distance between the 8 October capture location and the nearest edge of the 16 October search area (i.e. 50 x 150 m) was 143 m, indicating a minimum movement distance. As far as we are aware, this is the longest recorded movement for P. cinereus by more than 53 m (Kleeberger and Werner 1982, op. cit.). This finding followed a rain event of 1.63 cm within 24 h and the second largest sustained rain event during October. The movement we observed may have been due to

  18. Weathering rates of marble in laboratory and outdoor conditions

    SciTech Connect

    Yerrapragada, S.S.; Chirra, S.R.; Jaynes, J.H.; Bandyopadhyay, J.K.; Gauri, K.L.; Li, S.

    1996-09-01

    In the modern urban atmosphere SO{sub 2} and NO{sub 2} attack calcite (CaCO{sub 3}) in marble exposed at rain-sheltered surfaces creating largely gypsum (CaSO{sub 4}{center_dot}2H{sub 2}O) crusts that eventually exfoliate. In combination with CO{sub 2} these gases erode the marble at unsheltered surfaces. the authors report the development of mathematical models to predict the rate of growth of crust and the rate of surface recession. To determine the rate of growth of crust the kinetic rate constant, diffusion rate, and the order of reaction were determined by the application of the shrinking-core model applied to data generated in laboratory experiments. Based on these parameters /and average ambient levels of 10 parts per billion (ppb) SO{sub 2} and 25 ppb NO{sub 2} in Louisville, Ky., the rate of crust formation for this metro area was calculated to be 1.8 {micro}m in the first year. However, the rate of recession was modeled from data obtained by exposing marble slabs to rainfalls. A surface recession of 15 {micro}m/yr was calculated. The models predicted well the rate of growth of crust observed at several sites in Louisville and the predicted surface recession compared well with values reported in the literature.

  19. MARBLE: A system for executing expert systems in parallel

    NASA Technical Reports Server (NTRS)

    Myers, Leonard; Johnson, Coe; Johnson, Dean

    1990-01-01

    This paper details the MARBLE 2.0 system which provides a parallel environment for cooperating expert systems. The work has been done in conjunction with the development of an intelligent computer-aided design system, ICADS, by the CAD Research Unit of the Design Institute at California Polytechnic State University. MARBLE (Multiple Accessed Rete Blackboard Linked Experts) is a system of C Language Production Systems (CLIPS) expert system tool. A copied blackboard is used for communication between the shells to establish an architecture which supports cooperating expert systems that execute in parallel. The design of MARBLE is simple, but it provides support for a rich variety of configurations, while making it relatively easy to demonstrate the correctness of its parallel execution features. In its most elementary configuration, individual CLIPS expert systems execute on their own processors and communicate with each other through a modified blackboard. Control of the system as a whole, and specifically of writing to the blackboard is provided by one of the CLIPS expert systems, an expert control system.

  20. On trajectories of rolling marbles in cones and other funnels

    NASA Astrophysics Data System (ADS)

    White, Gary D.

    2013-12-01

    We report on theoretical and experimental results for a ball that rolls without slipping on a surface of revolution, whose symmetry axis is aligned with a uniform gravitational field, particularly investigating both near-circular orbits and scattering-type orbits in cones. The experimental data give support for the theoretical treatment, a non-trivial application of Newton's second law that expands on our previous work and related work of others. Our findings refine those from a recent article in this journal, and largely replicate those obtained from an earlier Lagrangian approach, adding some new details and commentary. While the orbits of marbles rolling in cones do not match inverse-square-law orbits quantitatively (e.g., instead of Kepler's 3rd law, we have T2∝R), we argue that students should experience these qualitative phenomena—precession of orbits, escape velocity behavior, spin-orbit coupling, conservation laws for angular momentum, energy, and spin projection—as much for the fun and kinesthetic impressions as for the raw learning. We also report on a heretofore largely ignored variable in the exploration of rolling orbits in a gravity well: the marble's spin about its own axis as it rolls. Experimenters can, intentionally or not, vary this initial condition and produce different orbital periods for a given orbital radius—a distinctly non-celestial behavior. Careful selection of the initial spin direction and speed for a particular cone can result in marble orbits that mimic the planetary ellipses.

  1. Development of gypsum alteration on marble and limestone

    USGS Publications Warehouse

    McGee, E.S.

    1996-01-01

    Blackened alteration crusts of gypsum plus particulates that form on sheltered areas on marble and limestone buildings pose a challenge for rehabilitation and cleaning. Fresh marble and limestone samples exposed at monitored exposure sites present conditions of simple geometry and well-documented exposures but have short exposure histories (one to five years). The gypsum alteration crusts that develop on these samples provide insight into the early stages and rate of alteration crust formation. Alteration crusts from buildings give a longer, but less well known exposure history and present much more complex surfaces for gypsum accumulation. Integrated observations and measurements of alteration crusts from exposure samples and from buildings identify four factors that are important in the formation and development of alteration crusts on marble and limestone: (1) pollution levels, (2) exposure to rain or washing, (3) geometry of exposure of the stone surface, and (4) permeability of the stone. The combination of these factors contributes to both the distribution and the physical characteristics of the gypsum crusts which may affect cleaning decisions.

  2. Organisation of the spinal central pattern generators for locomotion in the salamander: biology and modelling.

    PubMed

    Chevallier, Stéphanie; Jan Ijspeert, Auke; Ryczko, Dimitri; Nagy, Frédéric; Cabelguen, Jean-Marie

    2008-01-01

    Among living tetrapods, salamanders are regarded as most closely resembling the first terrestrial vertebrates, and are therefore an interesting group in which the evolutionary changes in the locomotor behaviour from aquatic to terrestrial habitats can be inferred. Salamanders exhibit two locomotor modes: swimming and terrestrial stepping. The swimming is anguilliform and resembles closely that of the lamprey. On the ground, the salamander switches to a stepping gait with axial undulations that is also observed in many reptiles. The salamander is therefore ideally suited for examining the neural mechanisms for the generation of these two locomotor modes, as well as the neural mechanisms of gait transition. In the present paper, we describe the kinematics and patterns of activation of axial and limb muscles during stepping and swimming in adult salamanders. We then review the current neurobiological data about the organisation of the spinal networks underlying swimming and stepping, and the mechanisms of gait transition. Finally we report modelling studies aimed at understanding the organisation and operation of the salamander locomotor circuits. Altogether, the neurobiological and the modelling data support the hypothesis of a phylogenetic conservatism from agnathians to amphibians of the spinal locomotor networks generating axial motor patterns.

  3. Mercury bioaccumulation in northern two-lined salamanders from streams in the northeastern United States

    USGS Publications Warehouse

    Bank, M.S.; Loftin, C.S.; Jung, R.E.

    2005-01-01

    Mercury (Hg) bioaccumulation in salamanders has received little attention despite widespread Hg contamination of aquatic ecosystems and worldwide amphibian declines. Here we report concentrations of methyl Hg (MeHg) and total Hg in larval northern two-lined salamanders (Eurycea bislineata bislineata) collected from streams in Acadia National Park (ANP), Maine, and Bear Brook Watershed, Maine (BBWM; a paired, gauged watershed treated with bimonthly applications (25 kg/ha/yr) of ammonium sulfate [(NH4)(2)SO4]) since 1989), and Shenandoah National Park (SNP), Virginia. MeHg comprised 73-97% of total Hg in the larval salamander composite samples from ANP. At BBWM we detected significantly higher total Hg levels in larvae from the (NH4)(2)SO4 treatment watershed. At ANP total Hg concentrations in salamander larvae were significantly higher from streams in unburned watersheds in contrast with larval samples collected from streams located in watersheds burned by the 1947 Bar Harbor fire. Additionally, total Hg levels were significantly higher in salamander larvae collected at ANP in contrast with SNP. Our results suggest that watershed-scale attributes including. re history, whole-catchment (NH4)(2)SO4 additions, wetland extent, and forest cover type influence mercury bioaccumulation in salamanders inhabiting lotic environments. We also discuss the use of this species as an indicator of Hg bioaccumulation in stream ecosystems.

  4. A re-examination and re-evaluation of salamander orbital glands.

    PubMed

    Rehorek, Susan J; Grand-Pierre, Alix E; Cummings, Joshua R; Jewell, Bridgette; Constantine, Julieanne; Hillenius, W Jaap

    2013-11-01

    The amphibian integument contains numerous multicellular glands. Although two of these, the nasolabial and orbital glands and the associated nasolacrimal duct (NLD), have historically received considerable attention, interpretation of the original observations can be problematic in the context of current literature. Salamanders, in particular, are frequently regarded as at least indicative of aspects of the morphology of the common ancestor to all extant tetrapods; hence, an understanding of these glands in salamanders might prove to be informative about their evolution. For this study, the orbitonasal region of salamanders from three families was histologically examined. Three themes emerged: (1) examination of the effect of phylogeny on the nasolabial gland and NLD revealed a combination of features that may be unique to plethodontid salamanders, and may be correlated to their nose-tapping behavior by which substances are moved into the vomeronasal organ; (2) ecology appears to impact the relative development of the orbital glands, but not necessarily the nasolabial gland, with smaller glands being present in the aquatic species; (3) the nomenclature of the salamander orbital gland remains problematic, especially in light of comparative studies, as several alternate possibilities are viable. From this nomenclatural conundrum, however, it could be concluded that there may be a global pattern in the location of tetrapod orbital gland development. Molecular questions in terms of ontogeny and genetic homology affect the nature of the debate on orbital gland nomenclature. These observations suggest that rather than reflecting an ancestral condition, salamanders may instead represent a case of specialized, convergent evolution.

  5. Soil acidity affects distribution, behavior, and physiology of the salamander Plethodon cinereus

    SciTech Connect

    Wyman, R.L.; Hawksley-Lescault, D.S.

    1987-12-01

    Censuses at two sites in Delaware County, New York from spring 1981 through spring 1985 indicated that the density and distribution of Plethodon cinereus were influenced by soil pH but not by soil temperature or moisture. Of 1044 1-m/sup 2/ quadrats of forest litter searched, 284 had a pH of 3.7 or less and only 25 of these (8.8%) contained salamanders. Of 760 quadrats with a pH 3.8 or more, 386 (50.8%) contained salamanders. Juvenile salamanders were never found on soils with a pH less than or equal to 3.7. Seasonal salamander density was correlated (r = -0.92) with the percentage of quadrats with a pH of 3.7 and less. Salamanders apparently were excluded from 27% of forest habitat because of low soil pH. In the laboratory, P. cinereus preferred to occupy substrates near neutral pH when given a choice among three levels of substrate acidity. The acutely lethal pH was between 2.5 and 3 and the 8-mo chronically lethal pH was between 3 and 4. Growth and respiration were reduced at low pHs. The influence of soil pH on salamander distribution might fundamentally change the forest floor decomposer food web of which P. cinereus is an upper-level consumer.

  6. Thermal equilibrium and temperature differences among body regions in European plethodontid salamanders.

    PubMed

    Lunghi, Enrico; Manenti, Raoul; Canciani, Giancarlo; Scarì, Giorgio; Pennati, Roberta; Ficetola, Gentile Francesco

    2016-08-01

    Information on species thermal physiology is extremely important to understand species responses to environmental heterogeneity and changes. Thermography is an emerging technology that allows high resolution and accurate measurement of body temperature, but until now it has not been used to study thermal physiology of amphibians in the wild. Hydromantes terrestrial salamanders are strongly depending on ambient temperature for their activity and gas exchanges, but information on their body temperature is extremely limited. In this study we tested if Hydromantes salamanders are thermoconform, we assessed whether there are temperature differences among body regions, and evaluated the time required to reach the thermal equilibrium. During summers of 2014 and 2015 we analysed 56 salamanders (Hydromantes ambrosii and Hydromantes italicus) using infrared thermocamera. We photographed salamanders at the moment in which we found them and 1, 2, 3, 4, 5 and 15min after having kept them in the hands. Body temperature was equal to air temperature; salamanders attained the equilibrium with air temperature in about 8min, the time required to reach equilibrium was longer in individuals with large body size. We detected small temperature differences between body parts, the head being slightly warmer than the body and the tail (mean difference: 0.05°C). These salamanders quickly reach the equilibrium with the environment, thus microhabitat measurement allows obtaining accurate information on their tolerance limits. PMID:27503719

  7. Pathology, isolation, and preliminary molecular characterization of a novel iridovirus from tiger salamanders in Saskatchewan.

    PubMed

    Bollinger, T K; Mao, J; Schock, D; Brigham, R M; Chinchar, V G

    1999-07-01

    All iridovirus was confirmed to be the cause of an epizootic in larval and adult tiger salamanders (Ambystoma tigrinum diaboli) from four separate ponds in southern Saskatchewan (Canada) during the summer of 1997. This organism also is suspected, based on electron microscopic findings, to be the cause of mortality of larval tiger salamanders in a pond over 200 km to the north during the same year. Salamanders developed a generalized viremia which resulted in various lesions including: necrotizing, vesicular and ulcerative dermatitis; gastrointestinal ulceration; and necrosis of hepatic, splenic, renal, lymphoid, and hematopoietic tissues. In cells associated with these lesions, large lightly basophilic cytoplasmic inclusions and vacuolated nuclei with marginated chromatin were consistently found. Virus was isolated from tissue homogenates of infected salamanders following inoculation of epithelioma papilloma cyprini (EPC) cells. The virus, provisionally designated Regina ranavirus (RRV), was initially identified as an iridovirus by electron microscopy. Subsequent molecular characterization, including partial sequence analysis of the major capsid protein (MCP) gene, confirmed this assignment and established that RRV was a ranavirus distinct from frog virus 3 (FV3) and other members of the genus Ranavirus. Intraperitoneal inoculation of 5 x 10(6.23) TCID50 of the field isolate caused mortality in inoculated salamanders at 13 days post infection. Field, clinical, and molecular studies jointly suggest that the etiological agent of recent salamander mortalities is a highly infectious novel ranavirus. PMID:10479075

  8. Thermal equilibrium and temperature differences among body regions in European plethodontid salamanders.

    PubMed

    Lunghi, Enrico; Manenti, Raoul; Canciani, Giancarlo; Scarì, Giorgio; Pennati, Roberta; Ficetola, Gentile Francesco

    2016-08-01

    Information on species thermal physiology is extremely important to understand species responses to environmental heterogeneity and changes. Thermography is an emerging technology that allows high resolution and accurate measurement of body temperature, but until now it has not been used to study thermal physiology of amphibians in the wild. Hydromantes terrestrial salamanders are strongly depending on ambient temperature for their activity and gas exchanges, but information on their body temperature is extremely limited. In this study we tested if Hydromantes salamanders are thermoconform, we assessed whether there are temperature differences among body regions, and evaluated the time required to reach the thermal equilibrium. During summers of 2014 and 2015 we analysed 56 salamanders (Hydromantes ambrosii and Hydromantes italicus) using infrared thermocamera. We photographed salamanders at the moment in which we found them and 1, 2, 3, 4, 5 and 15min after having kept them in the hands. Body temperature was equal to air temperature; salamanders attained the equilibrium with air temperature in about 8min, the time required to reach equilibrium was longer in individuals with large body size. We detected small temperature differences between body parts, the head being slightly warmer than the body and the tail (mean difference: 0.05°C). These salamanders quickly reach the equilibrium with the environment, thus microhabitat measurement allows obtaining accurate information on their tolerance limits.

  9. Woodland salamander responses to a shelterwood harvest-prescribed burn silvicultural treatment within Appalachian mixed-oak forests

    USGS Publications Warehouse

    Ford, W. Mark; Mahoney, Kathleen R.; Russell, Kevin R.; Rodrigue, Jane L.; Riddle, Jason D.; Schuler, Thomas M.; Adams, Mary Beth

    2015-01-01

    Forest management practices that mimic natural canopy disturbances, including prescribed fire and timber harvests, may reduce competition and facilitate establishment of favorable vegetative species within various ecosystems. Fire suppression in the central Appalachian region for almost a century has contributed to a transition from oak-dominated to more mesophytic, fire-intolerant forest communities. Prescribed fire coupled with timber removal is currently implemented to aid in oak regeneration and establishment but responses of woodland salamanders to this complex silvicultural system is poorly documented. The purpose of our research was to determine how woodland salamanders respond to shelterwood harvests following successive burns in a central Appalachian mixed-oak forest. Woodland salamanders were surveyed using coverboard arrays in May, July, and August–September 2011 and 2012. Surveys were conducted within fenced shelterwood-burn (prescribed fires, shelterwood harvest, and fencing to prevent white-tailed deer [Odocoileus virginianus] herbivory), shelterwood-burn (prescribed fires and shelterwood harvest), and control plots. Relative abundance was modeled in relation to habitat variables measured within treatments for mountain dusky salamanders (Desmognathus ochrophaeus), slimy salamanders (Plethodon glutinosus), and eastern red-backed salamanders (Plethodon cinereus). Mountain dusky salamander relative abundance was positively associated with canopy cover and there were significantly more individuals within controls than either shelterwood-burn or fenced shelterwood-burn treatments. Conversely, habitat variables associated with slimy salamanders and eastern red-backed salamanders did not differ among treatments. Salamander age-class structure within controls did not differ from shelterwood-burn or fenced shelterwood-burn treatments for any species. Overall, the woodland salamander assemblage remained relatively intact throughout the shelterwoodburn

  10. Light-Driven Transport of a Liquid Marble with and against Surface Flows.

    PubMed

    Kavokine, Nikita; Anyfantakis, Manos; Morel, Mathieu; Rudiuk, Sergii; Bickel, Thomas; Baigl, Damien

    2016-09-01

    Liquid marbles, that is, liquid drops coated by a hydrophobic powder, do not wet any solid or liquid substrate, making their transport and manipulation both highly desirable and challenging. Herein, we describe the light-driven transport of floating liquid marbles and emphasize a surprising motion behavior. Liquid marbles are deposited on a water solution containing photosensitive surfactants. Irradiation of the solution generates photoreversible Marangoni flows that transport the liquid marbles toward UV light and away from blue light when the thickness of the liquid substrate is large enough (Marangoni regime). Below a critical thickness, the liquid marbles move in the opposite direction to that of the surface flow at a speed increasing with decreasing liquid thickness (anti-Marangoni). We demonstrate that the anti-Marangoni motion is driven by the free surface deformation, which propels the non-wetting marble against the surface flow. We call this behavior "slide effect". PMID:27381297

  11. Light-Driven Transport of a Liquid Marble with and against Surface Flows.

    PubMed

    Kavokine, Nikita; Anyfantakis, Manos; Morel, Mathieu; Rudiuk, Sergii; Bickel, Thomas; Baigl, Damien

    2016-09-01

    Liquid marbles, that is, liquid drops coated by a hydrophobic powder, do not wet any solid or liquid substrate, making their transport and manipulation both highly desirable and challenging. Herein, we describe the light-driven transport of floating liquid marbles and emphasize a surprising motion behavior. Liquid marbles are deposited on a water solution containing photosensitive surfactants. Irradiation of the solution generates photoreversible Marangoni flows that transport the liquid marbles toward UV light and away from blue light when the thickness of the liquid substrate is large enough (Marangoni regime). Below a critical thickness, the liquid marbles move in the opposite direction to that of the surface flow at a speed increasing with decreasing liquid thickness (anti-Marangoni). We demonstrate that the anti-Marangoni motion is driven by the free surface deformation, which propels the non-wetting marble against the surface flow. We call this behavior "slide effect".

  12. Innovative techniques for sampling stream-inhabiting salamanders

    SciTech Connect

    T.M. Luhring; C.A. Young

    2006-01-01

    Although salamanders are excellent indicators of environmental health, the ability to catch them efficiently without substantially disrupting their habitat is not always practical or even possible with current techniques. Ripping open logs and raking leaf packs onto shore (Bruce 1972) are examples of such practices that are disruptive but widely used by herpetologists who have no other means of efficient collection. Drift fences with pitfall traps are effective in catching animals moving within or between habitats but are time consuming and require an initial financial investment and constant upkeep to maintain functionality and prevent animal fatalities (Gibbons and Semlitsch 1981). One current alternative to drift fences is the use of coverboards (Grant et al. 1992), which require less maintenance and sampling effort than drift fences. However, coverboards do not integrate captures over a long time period and often result in a lower number of captures per trap (Grant et al. 1992).

  13. Road deicing salt irreversibly disrupts osmoregulation of salamander egg clutches.

    PubMed

    Karraker, Nancy E; Gibbs, James P

    2011-03-01

    It has been postulated that road deicing salts are sufficiently diluted by spring rains to ameliorate any physiological impacts to amphibians breeding in wetlands near roads. We tested this conjecture by exposing clutches of the spotted salamander (Ambystoma maculatum) to three chloride concentrations (1 mg/L, 145 mg/L, 945 mg/L) for nine days, then transferred clutches to control water for nine days, and measured change in mass at three-day intervals. We measured mass change because water uptake by clutches reduces risks to embryos associated with freezing, predation, and disease. Clutches in controls sequestered water asymptotically. Those in the moderate concentrations lost 18% mass initially and regained 14% after transfer to control water. Clutches in high concentration lost 33% mass and then lost an additional 8% after transfer. Our results suggest that spring rains do not ameliorate the effects of deicing salts in wetlands with extremely high chloride concentrations.

  14. Sound production in marbled rockfish (Sebastiscus marmoratus) and implications for fisheries.

    PubMed

    Zhang, Xuguang; Guo, Hongyi; Zhang, Shouyu; Song, Jiakun

    2015-01-01

    Recently, several rockfish species (genus Sebastes) have been reported to be soniferous. To determine whether an additional rockfish species produces sounds, passive acoustic recordings were analyzed from captive marbled rockfish (Sebastiscus marmoratus) during the non-spawning season. Three distinct sounds were identified based on frequency features. The common characteristics among all sounds were low frequency (below 300 Hz) and rapidly dampened pulses consisting of 3-5 acoustic energy cycles. During free-swimming conditions in the canvas tank, the fish produced voluntary sounds with lower frequencies than the disturbance sounds produced by individuals during prodding. Two types of sounds were identified in the disturbance context: one type consists of single or double pulses with two peak frequencies, and another type consists of a series of pulses with a single peak frequency. These results suggest that specific-species and behavior-associated sounds are potentially useful in passive acoustical surveys to monitor rockfish populations and distributions remotely.

  15. Isolation of new polymorphic microsatellite markers from the marbled rockfish Sebastiscus marmoratus.

    PubMed

    Deng, H W; Li, Z B; Dai, G; Yuan, Y; Ning, Y F; Shangguan, J B; Huang, Y S

    2015-01-01

    The marbled rockfish, Sebastiscus marmoratus, is an important commercially near-shore fish that inhabits the beach rocky bottom from Japan to the South China Sea. Eleven polymorphic microsatellite loci were developed from S. marmoratus and were used to identify polymorphisms in 30 samples from a wild population. The allele locus number ranged from 2 to 7. Polymorphism data content ranged from 0.032 to 0.751. The observed and expected heterozygosity levels were 0.0333-0.9667 and 0.0328-0.7675, respectively. Two loci, Smd1-112 and Smd2-80, deviated from Hardy-Weinberg equilibrium. These polymorphic microsatellite markers will facilitate further studies of genetic diversity and genetic differentiation of S. marmoratus.

  16. Immunocytochemical analysis of photoreceptors in the tiger salamander retina

    PubMed Central

    Zhang, Jian; Wu, Samuel M.

    2013-01-01

    In the tiger salamander retina, visual signals are transmitted to the inner retina via six morphologically distinct types of photoreceptors: large/small rods, large/small single cones, and double cones composed of principal and accessory members. The objective of this study was to determine the morphology of these photoreceptors and their synaptic interconnection with bipolar cells and horizontal cells in the outer plexiform layer (OPL). Here we showed that glutamate antibodies labeled all photoreceptors and recoverin antibodies strongly labeled all cones and weakly labeled all rods. Antibodies against calbindin selectively stained accessory members of double cones. Antibodies against S-cone opsin stained small rods, a subpopulation of small single cones, and the outer segments of accessory double cones and a subtype of unidentified single cones. On average, large rods and small S-cone opsin positive rods accounted for 98.6% and 1.4% of all rods, respectively. Large/small cones, principle/accessory double cones, S-cone opsin positive small single cones, and S-cone opsin positive unidentified single cones accounted for about 66.9%, 23%, 4.5%, and 5.6% of the total cones, respectively. Moreover, the differential connection between rods/cones and bipolar/horizontal cells and the wide distribution of AMPA receptor subunits GluR2/3 and GluR4 at the rod/cone synapses were observed. These results provide anatomical evidence for the physiological findings that bipolar/horizontal cells in the salamander retina are driven by rod/cone inputs of different weights, and that AMPA receptors play an important role in glutamatergic neurotransmission at the first visual synapses. The different photoreceptors selectively contacting bipolar and horizontal cells support the idea that visual signals may be conveyed to the inner retina by different functional pathways in the outer retina. PMID:18977238

  17. Reinforcement of natural rubber hybrid composites based on marble sludge/Silica and marble sludge/rice husk derived silica

    PubMed Central

    Ahmed, Khalil; Nizami, Shaikh Sirajuddin; Riza, Nudrat Zahid

    2013-01-01

    A research has been carried out to develop natural rubber (NR) hybrid composites reinforced with marble sludge (MS)/Silica and MS/rice husk derived silica (RHS). The primary aim of this development is to scrutinize the cure characteristics, mechanical and swelling properties of such hybrid composite. The use of both industrial and agricultural waste such as marble sludge and rice husk derived silica has the primary advantage of being eco-friendly, low cost and easily available as compared to other expensive fillers. The results from this study showed that the performance of NR hybrid composites with MS/Silica and MS/RHS as fillers is extremely better in mechanical and swelling properties as compared with the case where MS used as single filler. The study suggests that the use of recently developed silica and marble sludge as industrial and agricultural waste is accomplished to provide a probable cost effective, industrially prospective, and attractive replacement to the in general purpose used fillers like china clay, calcium carbonate, and talc. PMID:25685484

  18. Computer image analysis of intramuscular adipocytes and marbling in the longissimus muscle of cattle.

    PubMed

    Yang, X J; Albrecht, E; Ender, K; Zhao, R Q; Wegner, J

    2006-12-01

    The deposition of fat in muscle, recognized by the consumer as marbling, is an important meat quality trait. The objective of the study was to provide additional insights into the quantitative extent of marbling by means of computer image analysis. Fifty-one F(2) generation German Holstein and Charolais crossbreed cattle, 18 mo of age, were used to determine relationships among marbling traits, adipocyte size, and the amount of adipose tissue in different depots. Differences were recorded among the size of i.m. adipocytes in different groups of marbling flecks, divided according to the location in the muscle cross-section and to the size of the marbling flecks. The results showed positive correlation between i.m. adipocyte size and the weight of s.c. fat, intestinal fat, omental fat, and perirenal fat (r = 0.50, 0.61, 0.70, and 0.63, respectively, P < 0.001). The i.m. adipocyte size was correlated with i.m. fat content, number of marbling flecks, proportion of marbling fleck area, and total length of marbling flecks (r = 0.71, 0.44, 0.62, and 0.55, respectively, P < 0.01). The number of marbling flecks was also correlated with i.m. fat content, proportion of marbling fleck area, and total length of marbling flecks (r = 0.58, 0.62, and 0.91, P < 0.01, respectively). The ventral marbling flecks had a 5-fold larger fleck area, 4-fold more adipocytes, and larger adipocytes (P < 0.001). Larger marbling flecks contained larger adipocytes (P < 0.001). Moreover, compared with the small marbling flecks, there was a 48-fold larger fleck area and 26-fold more adipocytes in the large marbling flecks. The results indicate that i.m. fat deposition increases concurrently with the other fat depots but is still independent. Furthermore, the i.m. fat is preferentially deposited in the ventral area of LM. Although the i.m. adipocyte size has an important effect on the traits of marbling flecks, cell number plays a greater role in i.m. fat deposition than cell size. PMID:17093217

  19. Graphene liquid marbles as photothermal miniature reactors for reaction kinetics modulation.

    PubMed

    Gao, Wei; Lee, Hiang Kwee; Hobley, Jonathan; Liu, Tianxi; Phang, In Yee; Ling, Xing Yi

    2015-03-23

    We demonstrate the fabrication of graphene liquid marbles as photothermal miniature reactors with precise temperature control for reaction kinetics modulation. Graphene liquid marbles show rapid and highly reproducible photothermal behavior while maintaining their excellent mechanical robustness. By tuning the applied laser power, swift regulation of graphene liquid marble's surface temperature between 21-135 °C and its encapsulated water temperature between 21-74 °C are demonstrated. The temperature regulation modulates the reaction kinetics in our graphene liquid marble, achieving a 12-fold superior reaction rate constant for methylene blue degradation than at room temperature.

  20. Estimation of the type locality of Hynobius naevius (Temminck and Schlegel, 1838), a salamander from Japan (Amphibia: Caudata).

    PubMed

    Tominaga, Atsushi; Matsui, Masafumi

    2007-09-01

    A small Japanese salamander, Hynobius naevius, long considered a single species, has recently proven to include two groups (Group A=large type and Group B=small type) that are split at the species level. We compared the type series of H. naevius with specimens of the two groups to clarify which of them corresponds to true H. naevius, and to estimate the type locality of this species, which was not given in detail in its original description. Results of various morphological analyses altogether indicated that the type series belongs to Group A and that the population sample from Mt. Tara-dake, located on northwestern Kyushu, is most similar to the type series. Therefore, the type locality of the species is estimated to be in northwestern Kyushu. These results also indicate that Group B obviously represents a cryptic species whose scientific name remains to be determined. PMID:17961000

  1. Native variant limb skeletal patterns in the red-backed salamander, Plethodon cinereus, are not regenerated.

    PubMed

    Dinsmore, C E; Hanken, J

    1986-11-01

    Species of the salamander genus Plethodon have a characteristically uniform morphology. Morphological conservation at the level of interspecific comparisons, however, is not always reflected within species. Perhaps the most extreme example of intraspecific variation is the recent description of extensive variability in limb-skeletal patterning both within and between populations of the widespread species P. cinereus. We utilized limb regeneration following experimental amputation as a tool to examine whether naturally occurring variant skeletal patterns result from limb loss and regeneration in nature, and to assay the intrinsic (i.e., genetic) component of between-individual variation in mesopodial patterning. We observed the following. First, regenerate patterns are strikingly different from native patterns: interelement fusions in regenerates are typically between proximodistally adjacent cartilages, whereas interelement fusions in native variant limbs occur exclusively between laterally adjacent cartilages. Fusions also are over ten times more frequent in regenerates than in native limbs. Second, there is no strong correlation between native limb pattern (typical vs. variant) and the regenerate pattern. We conclude that variability in field-collected P. cinereus reflects extensive intrapopulation variation in limb-skeletal patterning during original limb development, rather than regeneration in nature, and that limb regeneration analysis provides no evidence of a strong genetic component to between-individual variation. Finally, unusual mesopodial patterns produced during limb regeneration may be related to the mechanical factors impinging on the regenerating limb in this terrestrial species.

  2. Tracking climate change in a dispersal-limited species: reduced spatial and genetic connectivity in a montane salamander.

    PubMed

    Velo-Antón, G; Parra, J L; Parra-Olea, G; Zamudio, K R

    2013-06-01

    Tropical montane taxa are often locally adapted to very specific climatic conditions, contributing to their lower dispersal potential across complex landscapes. Climate and landscape features in montane regions affect population genetic structure in predictable ways, yet few empirical studies quantify the effects of both factors in shaping genetic structure of montane-adapted taxa. Here, we considered temporal and spatial variability in climate to explain contemporary genetic differentiation between populations of the montane salamander, Pseudoeurycea leprosa. Specifically, we used ecological niche modelling (ENM) and measured spatial connectivity and gene flow (using both mtDNA and microsatellite markers) across extant populations of P. leprosa in the Trans-Mexican Volcanic Belt (TVB). Our results indicate significant spatial and genetic isolation among populations, but we cannot distinguish between isolation by distance over time or current landscape barriers as mechanisms shaping population genetic divergences. Combining ecological niche modelling, spatial connectivity analyses, and historical and contemporary genetic signatures from different classes of genetic markers allows for inference of historical evolutionary processes and predictions of the impacts future climate change will have on the genetic diversity of montane taxa with low dispersal rates. Pseudoeurycea leprosa is one montane species among many endemic to this region and thus is a case study for the continued persistence of spatially and genetically isolated populations in the highly biodiverse TVB of central Mexico.

  3. Understanding positional cues in salamander limb regeneration: implications for optimizing cell-based regenerative therapies

    PubMed Central

    McCusker, Catherine D.; Gardiner, David M.

    2014-01-01

    Regenerative medicine has reached the point where we are performing clinical trials with stem-cell-derived cell populations in an effort to treat numerous human pathologies. However, many of these efforts have been challenged by the inability of the engrafted populations to properly integrate into the host environment to make a functional biological unit. It is apparent that we must understand the basic biology of tissue integration in order to apply these principles to the development of regenerative therapies in humans. Studying tissue integration in model organisms, where the process of integration between the newly regenerated tissues and the ‘old’ existing structures can be observed and manipulated, can provide valuable insights. Embryonic and adult cells have a memory of their original position, and this positional information can modify surrounding tissues and drive the formation of new structures. In this Review, we discuss the positional interactions that control the ability of grafted cells to integrate into existing tissues during the process of salamander limb regeneration, and discuss how these insights could explain the integration defects observed in current cell-based regenerative therapies. Additionally, we describe potential molecular tools that can be used to manipulate the positional information in grafted cell populations, and to promote the communication of positional cues in the host environment to facilitate the integration of engrafted cells. Lastly, we explain how studying positional information in current cell-based therapies and in regenerating limbs could provide key insights to improve the integration of cell-based regenerative therapies in the future. PMID:24872456

  4. Association of a single nucleotide polymorphism in titin gene with marbling in Japanese Black beef cattle

    PubMed Central

    Yamada, Takahisa; Sasaki, Seiki; Sukegawa, Shin; Yoshioka, Sachiyo; Takahagi, Youichi; Morita, Mitsuo; Murakami, Hiroshi; Morimatsu, Fumiki; Fujita, Tatsuo; Miyake, Takeshi; Sasaki, Yoshiyuki

    2009-01-01

    Background Marbling defined by the amount and distribution of intramuscular fat is an economically important trait of beef cattle in Japan. We have recently reported that single nucleotide polymorphisms (SNPs) in the endothelial differentiation, sphingolipid G-protein-coupled receptor, 1 (EDG1) gene were associated with marbling in Japanese Black beef cattle. As well as EDG1, the titin (TTN) gene, involved in myofibrillogenesis, has been previously shown to possess expression difference in musculus longissimus muscle between low-marbled and high-marbled steer groups, and to be located within genomic region of a quantitative trait locus for marbling. Thus TTN was considered as a positional functional candidate for the gene responsible for marbling. In this study, we explored SNP in TTN and analyzed association of the SNP with marbling. Findings A SNP in the promoter region of TTN, referred to as g.231054C>T, was the only difference detected between high- and low-marbled steer groups. The SNP was associated with marbling in 3 experiments using 101 sires (P = 0.004), 848 paternal half-sib progeny steers from 5 sires heterozygous for the g.231054C>T (P = 0.046), and 820 paternal half-sib progeny steers from 3 sires homozygous for C allele at the g.231054C>T (P = 0.051), in Japanese Black beef cattle. The effect of genotypes of the SNP on subcutaneous fat thickness was not statistically significant (P > 0.05). Conclusion These findings suggest that in addition to the EDG1 SNPs, the TTN SNP polymorphism is associated with marbling and may be useful for effective marker-assisted selection to increase the levels of marbling in Japanese Black beef cattle. Further replicate studies will be needed to confirm the allelic association observed here, and to expand the results to evaluate all possible genotypic combinations of alleles. PMID:19419586

  5. Transgranular Crack Nucleation in Carrara Marble of Brittle Failure

    NASA Astrophysics Data System (ADS)

    Cheng, Yi; Wong, Louis Ngai Yuen; Maruvanchery, Varun

    2016-08-01

    Understanding the microcrack nucleation is of a fundamental importance in the study of rock fracturing process. Due to variations in texture and mineralogy, different rocks may show different distinctive microcrack nucleation mechanisms. In order to understand the microcrack nucleation mechanisms in Carrara marble comprehensively, localized damage zones are artificially produced by loading specimens containing an array of en-echelon flaws in this study. Then, representative samples were cut from those loaded specimens and prepared for optical observation. Four types of microcrack nucleation mechanisms leading to the formation of transgranular cracks have been identified in Carrara marble. Type I and II mechanisms are favored by the distinctive polygonal shape of the crystal grains in Carrara marble. Local tensile stress concentration in these two mechanisms is attributed to grain sliding and divergent normal contact force, respectively. Type III mechanism is associated with the gliding along twin lamellae. The resultant tensile stress concentration could nucleate microcracks within the grain containing these lamellae or in the grain boundary. No microcracks in the adjoining grains were observed in this study. Our statistical analysis suggests that type III mechanism favors the nucleation of new cracks which are nearly perpendicular to the gently inclined twin lamellae and thus have a small angle with the maximum loading direction (about 15°). Type IV mechanism operates in grains failed mainly due to compressive stress rather than tensile stress concentration. Sets of parallel microcracks of this mechanism seem to be related to the crystallographic planes of calcite. The microcracking results also suggest that most of the grain boundaries in damaged zone have been cracked at the loading about 80 % of the specimen strength, while transgranular cracks begin to occur at that time and flourish after about 90 % loading of the strength.

  6. Marble-type glass based on blast furnace slag

    SciTech Connect

    Sarkisov, P.D.; Smirnov, V.G.; Trifonova, T.E.; Sergeev, Yu.N.

    1987-01-01

    This paper discusses the recovery and use of blast furnace wastes as coloring agents in the manufacture of imitation marble glass. The slags consist of a series of metal oxides each of which is tested for the color it generates when reacted and annealed with the molten glass. Comparative tests were also run against non-waste coloring agents and it was found that the waste-derived colorants were equal or superior both in process behavior and in generating the appropriate optical properties in the finished glass.

  7. 76 FR 44036 - Proposed Low-Effect Habitat Conservation Plan for the California Tiger Salamander, AT&T Portable...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-07-22

    ... Fish and Wildlife Service Proposed Low-Effect Habitat Conservation Plan for the California Tiger... potential for ``take'' of one Federally listed animal, the California tiger salamander. The applicant would... for the California tiger salamander into a new storage facility for portable generators within...

  8. IMPACT OF GUTHION ON SURVIVAL AND GROWTH OF THE FROG PSEUDACRIS REGILLA AND THE SALAMANDERS AMBYSTOMA GRACILE AND AMBYSTOMA MACULATUM

    EPA Science Inventory

    The effects of the insecticides Guthion (technical grade) and Guthion 2S(commercial formulation) on survival and growth of tadpoles of the Pacific treefrog Pseudacris regilla, and larvae of the Northwestern salamander Ambystoma gracile and the spotted salamander Ambystoma macula...

  9. Decoding the mechanisms of gait generation in salamanders by combining neurobiology, modeling and robotics.

    PubMed

    Bicanski, Andrej; Ryczko, Dimitri; Knuesel, Jérémie; Harischandra, Nalin; Charrier, Vanessa; Ekeberg, Örjan; Cabelguen, Jean-Marie; Ijspeert, Auke Jan

    2013-10-01

    Vertebrate animals exhibit impressive locomotor skills. These locomotor skills are due to the complex interactions between the environment, the musculo-skeletal system and the central nervous system, in particular the spinal locomotor circuits. We are interested in decoding these interactions in the salamander, a key animal from an evolutionary point of view. It exhibits both swimming and stepping gaits and is faced with the problem of producing efficient propulsive forces using the same musculo-skeletal system in two environments with significant physical differences in density, viscosity and gravitational load. Yet its nervous system remains comparatively simple. Our approach is based on a combination of neurophysiological experiments, numerical modeling at different levels of abstraction, and robotic validation using an amphibious salamander-like robot. This article reviews the current state of our knowledge on salamander locomotion control, and presents how our approach has allowed us to obtain a first conceptual model of the salamander spinal locomotor networks. The model suggests that the salamander locomotor circuit can be seen as a lamprey-like circuit controlling axial movements of the trunk and tail, extended by specialized oscillatory centers controlling limb movements. The interplay between the two types of circuits determines the mode of locomotion under the influence of sensory feedback and descending drive, with stepping gaits at low drive, and swimming at high drive.

  10. Digits Lost or Gained? Evidence for Pedal Evolution in the Dwarf Salamander Complex (Eurycea, Plethodontidae)

    PubMed Central

    2012-01-01

    Change in digit number, particularly digit loss, has occurred repeatedly over the evolutionary history of tetrapods. Although digit loss has been documented among distantly related species of salamanders, it is relatively uncommon in this amphibian order. For example, reduction from five to four toes appears to have evolved just three times in the morphologically and ecologically diverse family Plethodontidae. Here we report a molecular phylogenetic analysis for one of these four-toed lineages – the Eurycea quadridigitata complex (dwarf salamanders) – emphasizing relationships to other species in the genus. A multilocus phylogeny reveals that dwarf salamanders are paraphyletic with respect to a complex of five-toed, paedomorphic Eurycea from the Edwards Plateau in Texas. We use this phylogeny to examine evolution of digit number within the dwarf−Edwards Plateau clade, testing contrasting hypotheses of digit loss (parallelism among dwarf salamanders) versus digit gain (re-evolution in the Edwards Plateau complex). Bayes factors analysis provides statistical support for a five-toed common ancestor at the dwarf-Edwards node, favoring, slightly, the parallelism hypothesis for digit loss. More importantly, our phylogenetic results pinpoint a rare event in the pedal evolution of plethodontid salamanders. PMID:22649536

  11. Salamanders increase their feeding activity when infected with the pathogenic chytrid fungus Batrachochytrium dendrobatidis.

    PubMed

    Hess, Alexandra; McAllister, Caroline; DeMarchi, Joseph; Zidek, Makenzie; Murone, Julie; Venesky, Matthew D

    2015-10-27

    Immune function is a costly line of defense against parasitism. When infected with a parasite, hosts frequently lose mass due to these costs. However, some infected hosts (e.g. highly resistant individuals) can clear infections with seemingly little fitness losses, but few studies have tested how resistant hosts mitigate these costly immune defenses. We explored this topic using eastern red-backed salamanders Plethodon cinereus and the fungal pathogen Batrachochytrium dendrobatidis (Bd). Bd is generally lethal for amphibians, and stereotypical symptoms of infection include loss in mass and deficits in feeding. However, individuals of P. cinereus can clear their Bd infections with seemingly few fitness costs. We conducted an experiment in which we repeatedly observed the feeding activity of Bd-infected and non-infected salamanders. We found that Bd-infected salamanders generally increased their feeding activity compared to non-infected salamanders. The fact that we did not observe any differences in mass change between the treatments suggests that increased feeding might help Bd-infected salamanders minimize the costs of an effective immune response.

  12. Salamanders increase their feeding activity when infected with the pathogenic chytrid fungus Batrachochytrium dendrobatidis.

    PubMed

    Hess, Alexandra; McAllister, Caroline; DeMarchi, Joseph; Zidek, Makenzie; Murone, Julie; Venesky, Matthew D

    2015-10-27

    Immune function is a costly line of defense against parasitism. When infected with a parasite, hosts frequently lose mass due to these costs. However, some infected hosts (e.g. highly resistant individuals) can clear infections with seemingly little fitness losses, but few studies have tested how resistant hosts mitigate these costly immune defenses. We explored this topic using eastern red-backed salamanders Plethodon cinereus and the fungal pathogen Batrachochytrium dendrobatidis (Bd). Bd is generally lethal for amphibians, and stereotypical symptoms of infection include loss in mass and deficits in feeding. However, individuals of P. cinereus can clear their Bd infections with seemingly few fitness costs. We conducted an experiment in which we repeatedly observed the feeding activity of Bd-infected and non-infected salamanders. We found that Bd-infected salamanders generally increased their feeding activity compared to non-infected salamanders. The fact that we did not observe any differences in mass change between the treatments suggests that increased feeding might help Bd-infected salamanders minimize the costs of an effective immune response. PMID:26503775

  13. Anatomy, function, and evolution of jaw and hyobranchial muscles in cryptobranchoid salamander larvae.

    PubMed

    Kleinteich, Thomas; Herzen, Julia; Beckmann, Felix; Matsui, Masafumi; Haas, Alexander

    2014-02-01

    Larval salamanders (Lissamphibia: Caudata) are known to be effective suction feeders in their aquatic environments, although they will eventually transform into terrestrial tongue feeding adults during metamorphosis. Early tetrapods may have had a similar biphasic life cycle and this makes larval salamanders a particularly interesting model to study the anatomy, function, development, and evolution of the feeding apparatus in terrestrial vertebrates. Here, we provide a description of the muscles that are involved in the feeding strike in salamander larvae of the Hynobiidae and compare them to larvae of the paedomorphic Cryptobranchidae. We provide a functional and evolutionary interpretation for the observed muscle characters. The cranial muscles in larvae from species of the Hynobiidae and Cryptobranchidae are generally very similar. Most notable are the differences in the presence of the m. hyomandibularis, a muscle that connects the hyobranchial apparatus with the lower jaw. We found this muscle only in Onychodactylus japonicus (Hynobiidae) but not in other hynobiid or cryptobranchid salamanders. Interestingly, the m. hyomandibularis in O. japonicus originates from the ceratobranchial I and not the ceratohyal, and thus exhibits what was previously assumed to be the derived condition. Finally, we applied a biomechanical model to simulate suction feeding in larval salamanders. We provide evidence that a flattened shape of the hyobranchial apparatus in its resting position is beneficial for a fast and successful suction feeding strike.

  14. "Right-Throughs, Rings, and Taws": Marbles Pitching Terminology in Trinidad and Tobago.

    ERIC Educational Resources Information Center

    Winer, Lise; Boos, Hans E. A.

    Marble games, or pitch, are among the most widely played of traditional boys' games in Trinidad and Tobago and have declined in the last two decades. Nearly 200 marbles terms found in Trinidad and Tobago English Creole are documented. Although most are British in origin, there are East Indian, French Creole, and possible African influences on this…

  15. 75 FR 64303 - Vermont Marble Power, Division of Omya Inc.; Central Vermont Public Service Corporation; Notice...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-10-19

    ... Relicensing Regulations Under the Federal Power Act (54 FR 23,756 FERC Stats. and Regs., Regs. Preambles 1986... Energy Regulatory Commission Vermont Marble Power, Division of Omya Inc.; Central Vermont Public Service... Soliciting Comments and Motions To Intervene October 12, 2010. On August 31, 2010, Vermont Marble...

  16. Don't Lose Your Marbles!: Game Project Teaches Introductory Manufacturing Skills

    ERIC Educational Resources Information Center

    Kapur, Arjun; Carter, Horlin; Dillon, Dave

    2006-01-01

    This article describes a lab activity conducted in an introductory manufacturing class. In this good, simple, mass-production project, the students designed and produced a small game composed of a piece of plywood and 14 glass marbles. In appearance, the game is something like Chinese checkers, but it involves jumping over marbles, then removing…

  17. Genetic evaluation of Angus cattle for carcass marbling using ultrasound and genomic indicators

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Objectives were to estimate genetic parameters needed to elucidate the relationships of a molecular breeding value for marbling (MBV), intramuscular fat of yearling bulls measured with ultrasound (IMF) and marbling score of harvested steers (MRB), and to assess the utility of MBV and IMF in predicti...

  18. 76 FR 61599 - Endangered and Threatened Wildlife and Plants; Revised Critical Habitat for the Marbled Murrelet

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-10-05

    ... the Federal Register on May 24, 1996 (61 FR 26256), and is available under the ``Supporting Documents..., Distribution, Ecology, and Habitat The marbled murrelet is a small seabird of the Alcidae family. The marbled... Register on October 1, 1992 (57 FR 45328), the final rule designating critical habitat published in...

  19. [Population].

    PubMed

    1979-01-01

    Data on the population of Venezuela between 1975 and 1977 are presented in descriptive tables and graphs. Information is included on the employed population according to category, sex, and type of economic activity, and by sex, age, and area on the employment rate and the total, the economically active, and the unemployed population.

  20. Significance of pre-Quaternary climate change for montane species diversity: insights from Asian salamanders (Salamandridae: Pachytriton).

    PubMed

    Wu, Yunke; Wang, Yuezhao; Jiang, Ke; Hanken, James

    2013-01-01

    Despite extensive focus on the genetic legacy of Pleistocene glaciation, impacts of earlier climatic change on biodiversity are poorly understood. Because amphibians are highly sensitive to variations in precipitation and temperature, we use a genus of Chinese montane salamanders (Salamandridae: Pachytriton) to study paleoclimatic change in East Asia, which experienced intensification of its monsoon circulation in the late Miocene associated with subsequent Pliocene warming. Using both nuclear and mitochondrial DNA sequences, we reconstruct the species tree under a coalescent model and demonstrate that all major lineages originated before the Quaternary. Initial speciation within the genus occurred after the summer monsoon entered a stage of substantial intensification. Heavy summer precipitation established temporary water connectivity through overflows between adjacent stream systems, which may facilitate geographic range expansion by aquatic species such as Pachytriton. Species were formed in allopatry likely through vicariant isolation during or after range expansion. To evaluate the influence of Pliocene warming on these cold-adapted salamanders, we construct a novel temperature buffer-zone model, which suggests widespread physiological stress or even extinction during the warming period. A significant deceleration of species accumulation rate is consistent with Pliocene range contraction, which affected P. granulosus and P. archospotus the most because they lack large temperature buffer zones. In contrast, demographic growth occurred in species for which refugia persist. The buffer-zone model reveals the Huangshan Mountain as a potential climatic refugium, which is similar to that found for other East Asian organisms. Our approach can incorporate future climatic data to evaluate the potential impact of ongoing global warming on montane species (particularly amphibians) and to predict possible population declines.

  1. Identification of intergenomic recombinations in unisexual salamanders of the genus Ambystoma by genomic in situ hybridization (GISH).

    PubMed

    Bi, K; Bogart, J P

    2006-01-01

    Unisexual salamanders in the genus Ambystoma (Amphibia, Caudata) are endemic to eastern North America and are mostly all-female polyploids. Two to four of the bisexual species, A. laterale, A. jeffersonianum, A. texanum and A. tigrinum, contribute to the nuclear genome of unisexuals and more than 20 combinations that range from diploid to pentaploid have been identified in this complex. Because the karyotypes of the four bisexual species are similar, homologous and homoeologous chromosomes in the unisexuals can not be distinguished by conventional or banded karyotypes. We chose two widespread unisexual genomic combinations (A.laterale-2 jeffersonianum [or LJJ] and A. 2 laterale-jeffersonianum [or LLJ]) and employed genomic in situ hybridization (GISH) to identify the genomes in these unisexuals. Under optimum conditions, GISH reliably distinguishes the respective chromosomes attributed to both A.laterale and A. jeffersonianum. Of four populations examined, two were found to have independently evolved homoeologous recombinants that persist in both LJJ and LLJ individuals. Our results refute the previous hypothesis of clonal integrity and independent evolution of the genome combinations in these unisexuals. Our data provide evidence for intergenomic interactions between maternal chromosomes during meiosis in unisexuals and help to explain previously observed non-homologous bivalents and/or quadrivalents among lampbrush chromosomes that were possibly initiated by partial homosequential pairing among the homo(eo)logues. To explore the utility of GISH in other members of the complex, probes developed from A. laterale were also applied to unisexuals that contained A. tigrinum and A. texanum genomes. GISH is an effective tool that can be used to identify and to quantify genomic constituents and to investigate intergenomic interactions in unisexual salamanders. GISH also has potential application to examine possible genomic evolution in other unisexuals. PMID:16484787

  2. Characterization And Provenance Of Marble Chancel Screens, Νorthern Jordan

    NASA Astrophysics Data System (ADS)

    Al-Naddaf, M.; Al-Bashaireh, K.; Al-Waked, F.

    This research characterizes marble chancel screens and their supporting columns, confiscated from treasure thieves, probably from northern Jordan in order to manage the most fruitful conservation and restoration interventions for them. It provides new archaeometric data and determines the probable source of the marbles. The results of mineropetrographic, X-ray diffraction and carbon and oxygen stable isotope analyses show that the marbles most probably are Proconnesian-1. The results agree with the historical records supported by archaeometric analyses that Proconnesos marble was widely used during the Roman and Byzantine periods for architectural purposes. The results suggest that color style of Proconnesian marble astonished the Byzantine stonemasons and architects thus have been widely used.

  3. Effect of grain size and heavy metals on As immobilization by marble particles.

    PubMed

    Simón, M; García, I; González, V; Romero, A; Martín, F

    2015-05-01

    The effect of grain size and the interaction of heavy metals on As sorption by marble waste with different particle sizes was investigated. Acidic solutions containing only arsenic and a mixture of arsenic, lead, zinc, and cadmium were put in contact with the marble waste. The amount of metal(loid)s that were immobilized was calculated using the difference between the concentration in the acidic solution and in the liquid phase of the suspensions. Approximately 420 μg As m(-2) was sorbed onto the marble grains, both nonspecifically and specifically, where ≥ 80 % of the total arsenic in the acidic solution remained soluble, which suggests that this amendment is not effective to immobilize arsenic. However, in mixed contamination, relatively stable Pb-Ca arsenates were formed on the surface of the marble particles, and the soluble arsenic was reduced by 95 %, which indicates that marble particles can effectively immobilize arsenic and lead when both appear together.

  4. Changes in the chemical composition of an acidic soil treated with marble quarry and marble cutting wastes.

    PubMed

    Tozsin, Gulsen; Oztas, Taskin; Arol, Ali Ihsan; Kalkan, Ekrem

    2015-11-01

    Soil acidity greatly affects the availability of plant nutrients. The level of soil acidity can be adjusted by treating the soil with certain additives. The objective of this study was to determine the effect of marble quarry waste (MQW) and marble cutting waste (MCW) on the chemical composition and the acidity of a soil. Marble wastes at different rates were applied to an acid soil. Their effectiveness in neutralizing the soil pH was compared with that of agricultural lime. The changes in the chemical composition of the soil were also evaluated with column test at the end of a 75-day incubation period. The results indicated that the MQW and MCW applications significantly increased the soil pH (from 4.71 up to 6.54), the CaCO3 content (from 0.33% up to 0.75%), and the exchangeable Ca (from 14.79 cmol kg(-1) up to 21.18 cmol kg(-1)) and Na (from 0.57 cmol kg(-1) up to 1.07 cmol kg(-1)) contents, but decreased the exchangeable K (from 0.46 cmol kg(-1) down to 0.28 cmol kg(-1)), the plant-available P (from 25.56 mg L(-1) down to 16.62 mg L(-1)), and the extractable Fe (from 259.43 mg L(-1) down to 55.4 mg L(-1)), Cu (from 1.97 mg L(-1) down to 1.42 mg L(-1)), Mn (from 17.89 mg L(-1) down to 4.61 mg L(-1)) and Zn (from 7.88 mg L(-1) down to 1.56 mg L(-1)) contents. In addition, the Cd (from 0.060 mg L(-1) down to 0.046 mg L(-1)), Ni (from 0.337 mg L(-1) down to 0.092 mg L(-1)) and Pb (from 28.00 mg L(-1) down to 20.08 mg L(-1)) concentrations decreased upon the treatment of the soil with marble wastes.

  5. Changes in the chemical composition of an acidic soil treated with marble quarry and marble cutting wastes.

    PubMed

    Tozsin, Gulsen; Oztas, Taskin; Arol, Ali Ihsan; Kalkan, Ekrem

    2015-11-01

    Soil acidity greatly affects the availability of plant nutrients. The level of soil acidity can be adjusted by treating the soil with certain additives. The objective of this study was to determine the effect of marble quarry waste (MQW) and marble cutting waste (MCW) on the chemical composition and the acidity of a soil. Marble wastes at different rates were applied to an acid soil. Their effectiveness in neutralizing the soil pH was compared with that of agricultural lime. The changes in the chemical composition of the soil were also evaluated with column test at the end of a 75-day incubation period. The results indicated that the MQW and MCW applications significantly increased the soil pH (from 4.71 up to 6.54), the CaCO3 content (from 0.33% up to 0.75%), and the exchangeable Ca (from 14.79 cmol kg(-1) up to 21.18 cmol kg(-1)) and Na (from 0.57 cmol kg(-1) up to 1.07 cmol kg(-1)) contents, but decreased the exchangeable K (from 0.46 cmol kg(-1) down to 0.28 cmol kg(-1)), the plant-available P (from 25.56 mg L(-1) down to 16.62 mg L(-1)), and the extractable Fe (from 259.43 mg L(-1) down to 55.4 mg L(-1)), Cu (from 1.97 mg L(-1) down to 1.42 mg L(-1)), Mn (from 17.89 mg L(-1) down to 4.61 mg L(-1)) and Zn (from 7.88 mg L(-1) down to 1.56 mg L(-1)) contents. In addition, the Cd (from 0.060 mg L(-1) down to 0.046 mg L(-1)), Ni (from 0.337 mg L(-1) down to 0.092 mg L(-1)) and Pb (from 28.00 mg L(-1) down to 20.08 mg L(-1)) concentrations decreased upon the treatment of the soil with marble wastes. PMID:26246275

  6. 76 FR 26280 - Vermont Marble Power Division of Omya Inc.; Notice of Application Accepted for Filing, Soliciting...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-05-06

    ... Energy Regulatory Commission Vermont Marble Power Division of Omya Inc.; Notice of Application Accepted.... Date filed: March 31, 2010. d. Applicant: Vermont Marble Power Division of Omya Inc. e. Name of Project... Marble Power Division of Omya Inc., 9987 Carver Road, Suite 300, Cincinnati, OH 45242; Telephone...

  7. 75 FR 18192 - Vermont Marble Power Division of Omya Inc.; Notice of Application Tendered for Filing with the...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-04-09

    ... Energy Regulatory Commission Vermont Marble Power Division of Omya Inc.; Notice of Application Tendered... Major License. b. Project No.: 2558-029. c. Date Filed: March 31, 2010. d. Applicant: Vermont Marble... Contact: Todd Allard, Operations Engineer, Vermont Marble Power Division of Omya Inc., 9987 Carver...

  8. Unisexual salamanders (genus Ambystoma) present a new reproductive mode for eukaryotes.

    PubMed

    Bogart, James P; Bi, Ke; Fu, Jinzong; Noble, Daniel W A; Niedzwiecki, John

    2007-02-01

    To persist, unisexual and asexual eukaryotes must have reproductive modes that circumvent normal bisexual reproduction. Parthenogenesis, gynogenesis, and hybridogenesis are the modes that have generally been ascribed to various unisexuals. Unisexual Ambystoma are abundant around the Great Lakes region of North America, and have variously been described as having all 3 reproductive modes. Diploid and polyploid unisexuals have nuclear genomes that combine the haploid genomes of 2 to 4 distinct sexual species, but the mtDNA is unlike any of those 4 species and is similar to another species, Ambystoma barbouri. To obtain better resolution of the reproductive mode used by unisexual Ambystoma and to explore the relationship of A. barbouri to the unisexuals, we sequenced the mitochondrial control and highly variable intergenic spacer region of 48 ambystomatids, which included 28 unisexuals, representatives of the 4 sexual species and A. barbouri. The unisexuals have similar sequences over most of their range, and form a close sister group to A. barbouri, with an estimated time of divergence of 2.4-3.9 million years ago. Individuals from the Lake Erie Islands (Kelleys, Pelee, North Bass) have a haplotype that demonstrates an isolation event. We examined highly variable microsatellite loci, and found that the genetic makeup of the unisexuals is highly variable and that unisexual individuals share microsatellite alleles with sexual individuals within populations. Although many progeny from the same female had the same genotype for 5 microsatellite DNA loci, there was no indication that any particular genome is consistently inherited in a clonal fashion in a population. The reproductive mode used by unisexual Ambystoma appears to be unique; we suggest kleptogenesis as a new unisexual reproductive mode that is used by these salamanders. PMID:17546077

  9. Metamorphism of the Murphy belt, Marble Hill, GA

    SciTech Connect

    La Tour, T.E.; Gray, J. . Geology Dept.)

    1993-03-01

    Rocks of the Murphy belt consist of marble and metamorphosed mafic and highly aluminous pelitic rocks. The aluminous rocks contain sillimanite + kyanite + staurolite + garnet (gt) + muscovite + biotite + plagioclase + quartz [+-] tourmaline. Staurolite and kyanite are relict and closely intergrown. Garnet occurs as two generations, gt 1 and gt 2. Gt 1 and the biotite schistosity are coeval. Sillimanite needles and large porphyroblasts of muscovite (0.5--2.0 cm), formed from kyanite-staurolite aggregates coevally with gt 2, and both contain inclusions of relict kyanite and staurolite. Both are younger than the primary biotite schistosity and grew at sillimanite-muscovite grade. Muscovite porphyroblasts are partially recrystallized, leaving mica fish with thin trails of fine-grained muscovite. Kyanite [+-] staurolite are partially to completely recrystallized to spindle shaped aggregates and fine-grained muscovite. Some fine muscovite mantles the earlier phases and defined the new foliation. No sillimanite occurs in the recrystallized muscovite. This extreme grain size reduction occurred during medium-T retrograde metamorphism and converted many rocks into button schists or phyllonites. The above indicate extreme internal deformation following the metamorphic peak, during which primary sedimentary structures were destroyed. Also, competent mafic lithologies were dismembered into pods and discontinuous layers. Lithologic boundaries are no longer sedimentary, but tectonic. The association of aluminous schists and mafic rocks suggests deep-marine deposition, probably along a convergent margin. Conversely, the association is inconsistent with shallow deposition along a stable passive margin. The marble probably represents discontinuous reefs associated with the volcanic arc.

  10. NDT and E for the surface roughness of marble

    NASA Astrophysics Data System (ADS)

    Avdelidis, Nicolas P.; Moropoulou, Antonia; Delegou, Ekaterini T.; Almond, Darryl P.

    2004-04-01

    Two non-contact NDT and E (non-destructive testing and evaluation) techniques were employed in the inspection of quarry Pentelic marble samples; surface profilometry and infrared thermography. The samples were processed with different roughness treatments (i.e. 60, 80, 100, 220, 400 and 600 mesh) and were evaluated in the laboratory. Furthermore, different surface cleaning treatments were applied to a Pentelic marble surface in situ and then representative samples were collected and evaluated in the laboratory by the means of these two non-destructive techniques. Quantitative analysis of all samples was performed. In particular, the surface roughness parameter Rq at a specific length scale and 3-D micro-topography plots were attained by the use of the laser profilometry scanning approach, whilst temperature - time plots displaying the intensity of pixels as a function of time on the obtained thermal images were also obtained with the intention of distinguishing the influence of the applied roughness treatments. Results indicate that these two non-destructive techniques can be used for the assessment of surface roughness.

  11. Maternal effects and larval survival of marbled sole Pseudopleuronectes yokohamae

    NASA Astrophysics Data System (ADS)

    Higashitani, Tomomi; Takatsu, Tetsuya; Nakaya, Mitsuhiro; Joh, Mikimasa; Takahashi, Toyomi

    2007-07-01

    Maternal effects of animals are the phenotypic influences of age, size, and condition of spawners on the survival and phenotypic traits of offspring. To clarify the maternal effects for marbled sole Pseudopleuronectes yokohamae, we investigated the effects of body size, nutrient condition, and growth history of adult females on egg size, larval size, and starvation tolerance, growth, and feeding ability of offspring. The fecundity of adult females was strongly dependent on body size. Path analysis revealed that the mother's total length positively affected mean egg diameter, meaning that large females spawned large eggs. In contrast, the relative growth rate of adult females negatively affected egg diameter. Egg diameters positively affected both notochord length and yolk sac volume of the larvae at hatching. Under starvation conditions, notochord length at hatching strongly and positively affected days of survival at 14 °C but not at 9 °C. Under adequate food conditions (1000 rotifers L - 1 ), the notochord length of larvae 5 days after hatching positively affected feeding rate, implying that large larvae have high feeding ability. In addition, the mean growth rate of larvae between 0 and 15 days increased with increasing egg diameter under homogenous food conditions, suggesting that larvae hatched from large eggs might have a growth advantage for at least to 15 days after hatching. In marbled sole, these relationships (i.e., mother's body size-egg size-larval size-larval resistance to starvation-larval feeding ability) may help explain recruitment variability.

  12. Rare earths in the Leadville Limestone and its marble derivates

    USGS Publications Warehouse

    Jarvis, J.C.; Wildeman, T.R.; Banks, N.G.

    1975-01-01

    Samples of unaltered and metamorphosed Leadville Limestone (Mississippian, Colorado) were analyzed by neutron activation for ten rare-earth elements (REE). The total abundance of the REE in the least-altered limestone is 4-12 ppm, and their distribution patterns are believed to be dominated by the carbonate minerals. The abundances of the REE in the marbles and their sedimentary precursors are comparable, but the distribution patterns are not. Eu is enriched over the other REE in the marbles, and stratigraphically upward in the formation (samples located progressively further from the heat source), the light REE become less enriched relative to the heavy REE. The Eu anomaly is attributed to its ability, unique among the REE, to change from the 3+ to 2+ oxidation state. Whether this results in preferential mobilization of the other REE or whether this reflects the composition of the pore fluid during metamorphism is unknown. Stratigraphically selective depletion of the heavy REE may be attributed to more competition for the REE between fluid and carbonate minerals in the lower strata relative to the upper strata. This competition could have been caused by changes in the temperature of the pore fluid or to the greater resistance to solution of the dolomite in the lower parts of the formation than the calcite in the upper parts. ?? 1975.

  13. Cell birth and survival following seasonal periods of cell proliferation in the chemosensory epithelia of red-backed salamanders, Plethodon cinereus.

    PubMed

    Dawley, Ellen M; Nelsen, Meaghan; Lopata, Adrianne; Schwartz, Jessica; Bierly, Alison

    2006-01-01

    In addition to the continuous low levels of neurogenesis typical of adult vertebrates to replace damaged chemoreceptor cells, red-backed salamanders (Plethodon cinereus) experience an up-regulation of chemoreceptor epithelial cell proliferation on a seasonal basis. Significantly more cell division occurs in late spring than at any other time of the year, and we investigated the fate and life span of these newly generated cells. We used 5-bromo-2'-deoxyuridine (BrdU) immunocytochemical cell birth dating to examine cell proliferation and cell migration in the main olfactory and vomeronasal epithelia of red-backed salamanders collected in late spring who were allowed to survive for one hour or three, four, 25, 28, 42, 49 and 100 days post-injection. We examined new neuron growth in the vomeronasal and olfactory epithelia using antibodies against Growth Associated Protein-43 (GAP-43), a protein whose synthesis is up-regulated during axon growth. We also tracked apoptosis within both types of chemosensory epithelia using terminal deoxynucleotidyl transferase-mediated nick-end labeling (TUNEL). BrdU-immunoreactive cells were located extensively throughout the vomeronasal epithelia, particularly in the area posterior to the entrance of the nasolacrimal duct, not only after three days of survival, but also all of the longer experimental survival periods as well; BrdU-ir cells within the olfactory epithelia were rarely located after longer survival periods. Salamanders collected in late spring displayed extensive GAP-43 labeling in the vomeronasal epithelia posterior to the entrance of the nasolacrimal duct, indicating a large population of young vomeronasal receptor neurons. Finally, apoptotic cells were evident in this same post-nasolacrimal-duct-area of the vomeronasal organ and in the olfactory epithelium. We suggest that vomeronasal receptor neurons born in late spring function throughout the summer and may be associated with the animals' extensive territoriality

  14. Testicular structure and germ cells morphology in salamanders

    PubMed Central

    Uribe, Mari Carmen; Mejía-Roa, Víctor

    2014-01-01

    Testes of salamanders or urodeles are paired elongated organs that are attached to the dorsal wall of the body by a mesorchium. The testes are composed of one or several lobes. Each lobe is morphologically and functionally a similar testicular unit. The lobes of the testis are joined by cords covered by a single peritoneal epithelium and subjacent connective tissue. The cords contain spermatogonia. Spermatogonia associate with Sertoli cells to form spermatocysts or cysts. The spermatogenic cells in a cyst undergo their development through spermatogenesis synchronously. The distribution of cysts displays the cephalo-caudal gradient in respect to the stage of spermatogenesis. The formation of cysts at cephalic end of the testis causes their migration along the lobules to the caudal end. Consequently, the disposition in cephalo-caudal regions of spermatogenesis can be observed in longitudinal sections of the testis. The germ cells are spermatogonia, diploid cells with mitotic activity; primary and second spermatocytes characterized by meiotic divisions that develop haploid spermatids; during spermiogenesis the spermatids differentiate to spermatozoa. During spermiation the cysts open and spermatozoa leave the testicular lobules. After spermiation occurs the development of Leydig cells into glandular tissue. This glandular tissue regressed at the end of the reproductive cycle. PMID:26413406

  15. Phylogenetic history underlies elevational biodiversity patterns in tropical salamanders

    PubMed Central

    Wiens, John J; Parra-Olea, Gabriela; García-París, Mario; Wake, David B

    2007-01-01

    Elevational variation in species richness is ubiquitous and important for conservation, but remains poorly explained. Numerous studies have documented higher species richness at mid-elevations, but none have addressed the underlying evolutionary and biogeographic processes that ultimately explain this pattern (i.e. speciation, extinction and dispersal). Here, we address the evolutionary causes of the mid-elevational diversity hump in the most species-rich clade of salamanders, the tropical bolitoglossine plethodontids. We present a new phylogeny for the group based on DNA sequences from all 13 genera and 137 species. Using this phylogeny, we find no relationship between rates of diversification of clades and their elevational distribution, and no evidence for a rapid ‘species pump’ in tropical montane regions. Instead, we find a strong relationship between the number of species in each elevational zone and the estimated time when each elevational band was first colonized. Mid-elevation habitats were colonized early in the phylogenetic history of bolitoglossines, and given similar rates of diversification across elevations, more species have accumulated in the elevational zones that were inhabited the longest. This pattern may be widespread and suggests that mid-elevation habitats may not only harbour more species, but may also contain more phylogenetic diversity than other habitats within a region. PMID:17284409

  16. Where are we in understanding salamander locomotion: biological and robotic perspectives on kinematics.

    PubMed

    Karakasiliotis, Konstantinos; Schilling, Nadja; Cabelguen, Jean-Marie; Ijspeert, Auke Jan

    2013-10-01

    Salamanders have captured the interest of biologists and roboticists for decades because of their ability to locomote in different environments and their resemblance to early representatives of tetrapods. In this article, we review biological and robotic studies on the kinematics (i.e., angular profiles of joints) of salamander locomotion aiming at three main goals: (i) to give a clear view of the kinematics, currently available, for each body part of the salamander while moving in different environments (i.e., terrestrial stepping, aquatic stepping, and swimming), (ii) to examine what is the status of our current knowledge and what remains unclear, and (iii) to discuss how much robotics and modeling have already contributed and will potentially contribute in the future to such studies.

  17. An orphan gene is necessary for preaxial digit formation during salamander limb development

    PubMed Central

    Kumar, Anoop; Gates, Phillip B.; Czarkwiani, Anna; Brockes, Jeremy P.

    2015-01-01

    Limb development in salamanders differs from other tetrapods in that the first digits to form are the two most anterior (preaxial dominance). This has been proposed as a salamander novelty and its mechanistic basis is unknown. Salamanders are the only adult tetrapods able to regenerate the limb, and the contribution of preaxial dominance to limb regeneration is unclear. Here we show that during early outgrowth of the limb bud, a small cohort of cells express the orphan gene Prod1 together with Bmp2, a critical player in digit condensation in amniotes. Disruption of Prod1 with a gene-editing nuclease abrogates these cells, and blocks formation of the radius and ulna, and outgrowth of the anterior digits. Preaxial dominance is a notable feature of limb regeneration in the larval newt, but this changes abruptly after metamorphosis so that the formation of anterior and posterior digits occurs together within the autopodium resembling an amniote-like pattern. PMID:26498026

  18. Effects of warming conditions in eastern North American forests on red-backed salamander morphology.

    PubMed

    Gibbs, James P; Karraker, Nancy E

    2006-06-01

    Several studies have reported climate-associated changes in phenotypically plastic traits of amphibians, yet it remains unknown whether amphibians can manifest an evolutionary response to global climate change at the rate and magnitude that it is occurring. To assess this issue, we examined temporal change in the morphology of the red-backed salamander (Plethodon cinereus), a small, abundant woodland salamander distributed widely in eastern North America with two distinct morphotypes: striped individuals associated with cooler microclimates and unstriped individuals associated with warmer microclimates. We compiled morph frequencies for 50,960 individual salamanders from 558 sites as recorded in the published literature and in unpublished field notes of herpetologists between 1908 and 2004. We observed that striping probability increased with increasing latitude, longitude, and elevation and decreased (from 80% to 74% range wide) with time. The combined forces of regional climate warming and, particularly, forest disturbance have evidently been sufficient to cause morphological evolution in this amphibian over the last century.

  19. An orphan gene is necessary for preaxial digit formation during salamander limb development.

    PubMed

    Kumar, Anoop; Gates, Phillip B; Czarkwiani, Anna; Brockes, Jeremy P

    2015-10-26

    Limb development in salamanders differs from other tetrapods in that the first digits to form are the two most anterior (preaxial dominance). This has been proposed as a salamander novelty and its mechanistic basis is unknown. Salamanders are the only adult tetrapods able to regenerate the limb, and the contribution of preaxial dominance to limb regeneration is unclear. Here we show that during early outgrowth of the limb bud, a small cohort of cells express the orphan gene Prod1 together with Bmp2, a critical player in digit condensation in amniotes. Disruption of Prod1 with a gene-editing nuclease abrogates these cells, and blocks formation of the radius and ulna, and outgrowth of the anterior digits. Preaxial dominance is a notable feature of limb regeneration in the larval newt, but this changes abruptly after metamorphosis so that the formation of anterior and posterior digits occurs together within the autopodium resembling an amniote-like pattern.

  20. Heterogeneous vesicles in mucous epithelial cells of posterior esophagus of Chinese giant salamander (Andrias davidianus).

    PubMed

    Zhang, H; Guo, X; Zhong, S; Ge, T; Peng, S; Yu, P; Zhou, Z

    2015-08-25

    The Chinese giant salamander belongs to an old lineage of salamanders and endangered species. Many studies of breeding and disease regarding this amphibian had been implemented. However, the studies on the ultrastructure of this amphibian are rare. In this work, we provide a histological and ultrastructural investigation on posterior esophagus of Chinese giant salamander. The sections of amphibian esophagus were stained by hematoxylin & eosin (H&E). Moreover, the esophageal epithelium was observed by transmission electron microscopy (TEM). The results showed that esophageal epithelium was a single layer epithelium, which consisted of mucous cells and columnar cells. The esophageal glands were present in submucosa. The columnar cells were ciliated. According to the diverging ultrastructure of mucous vesicles, three types of mucous cells could be identified in the esophageal mucosa: i) electron-lucent vesicles mucous cell (ELV-MC); ii) electron-dense vesicles mucous cell (EDV-MC); and iii) mixed vesicles mucous cell (MV-MC).

  1. Fundamental differences in dedifferentiation and stem cell recruitment during skeletal muscle regeneration in two salamander species.

    PubMed

    Sandoval-Guzmán, Tatiana; Wang, Heng; Khattak, Shahryar; Schuez, Maritta; Roensch, Kathleen; Nacu, Eugeniu; Tazaki, Akira; Joven, Alberto; Tanaka, Elly M; Simon, András

    2014-02-01

    Salamanders regenerate appendages via a progenitor pool called the blastema. The cellular mechanisms underlying regeneration of muscle have been much debated but have remained unclear. Here we applied Cre-loxP genetic fate mapping to skeletal muscle during limb regeneration in two salamander species, Notophthalmus viridescens (newt) and Ambystoma mexicanum (axolotl). Remarkably, we found that myofiber dedifferentiation is an integral part of limb regeneration in the newt, but not in axolotl. In the newt, myofiber fragmentation results in proliferating, PAX7(-) mononuclear cells in the blastema that give rise to the skeletal muscle in the new limb. In contrast, myofibers in axolotl do not generate proliferating cells, and do not contribute to newly regenerated muscle; instead, resident PAX7(+) cells provide the regeneration activity. Our results therefore show significant diversity in limb muscle regeneration mechanisms among salamanders and suggest that multiple strategies may be feasible for inducing regeneration in other species, including mammals. PMID:24268695

  2. An orphan gene is necessary for preaxial digit formation during salamander limb development.

    PubMed

    Kumar, Anoop; Gates, Phillip B; Czarkwiani, Anna; Brockes, Jeremy P

    2015-01-01

    Limb development in salamanders differs from other tetrapods in that the first digits to form are the two most anterior (preaxial dominance). This has been proposed as a salamander novelty and its mechanistic basis is unknown. Salamanders are the only adult tetrapods able to regenerate the limb, and the contribution of preaxial dominance to limb regeneration is unclear. Here we show that during early outgrowth of the limb bud, a small cohort of cells express the orphan gene Prod1 together with Bmp2, a critical player in digit condensation in amniotes. Disruption of Prod1 with a gene-editing nuclease abrogates these cells, and blocks formation of the radius and ulna, and outgrowth of the anterior digits. Preaxial dominance is a notable feature of limb regeneration in the larval newt, but this changes abruptly after metamorphosis so that the formation of anterior and posterior digits occurs together within the autopodium resembling an amniote-like pattern. PMID:26498026

  3. Fundamental differences in dedifferentiation and stem cell recruitment during skeletal muscle regeneration in two salamander species.

    PubMed

    Sandoval-Guzmán, Tatiana; Wang, Heng; Khattak, Shahryar; Schuez, Maritta; Roensch, Kathleen; Nacu, Eugeniu; Tazaki, Akira; Joven, Alberto; Tanaka, Elly M; Simon, András

    2014-02-01

    Salamanders regenerate appendages via a progenitor pool called the blastema. The cellular mechanisms underlying regeneration of muscle have been much debated but have remained unclear. Here we applied Cre-loxP genetic fate mapping to skeletal muscle during limb regeneration in two salamander species, Notophthalmus viridescens (newt) and Ambystoma mexicanum (axolotl). Remarkably, we found that myofiber dedifferentiation is an integral part of limb regeneration in the newt, but not in axolotl. In the newt, myofiber fragmentation results in proliferating, PAX7(-) mononuclear cells in the blastema that give rise to the skeletal muscle in the new limb. In contrast, myofibers in axolotl do not generate proliferating cells, and do not contribute to newly regenerated muscle; instead, resident PAX7(+) cells provide the regeneration activity. Our results therefore show significant diversity in limb muscle regeneration mechanisms among salamanders and suggest that multiple strategies may be feasible for inducing regeneration in other species, including mammals.

  4. Heterogeneous Vesicles in Mucous Epithelial Cells of Posterior Esophagus of Chinese Giant Salamander (Andrias Davidianus)

    PubMed Central

    Zhang, H.; Zhong, S.; Ge, T.; Peng, S.; Yu, P.; Zhou, Z.; Guo, X.

    2015-01-01

    The Chinese giant salamander belongs to an old lineage of salamanders and endangered species. Many studies of breeding and disease regarding this amphibian had been implemented. However, the studies on the ultrastructure of this amphibian are rare. In this work, we provide a histological and ultra-structural investigation on posterior esophagus of Chinese giant salamander. The sections of amphibian esophagus were stained by hematoxylin & eosin (H&E). Moreover, the esophageal epithelium was observed by transmission electron microscopy (TEM). The results showed that esophageal epithelium was a single layer epithelium, which consisted of mucous cells and columnar cells. The esophageal glands were present in submucosa. The columnar cells were ciliated. According to the diverging ultrastructure of mucous vesicles, three types of mucous cells could be identified in the esophageal mucosa: i) electron-lucent vesicles mucous cell (ELV-MC); ii) electron-dense vesicles mucous cell (EDV-MC); and iii) mixed vesicles mucous cell (MV-MC). PMID:26428885

  5. Resource partitioning in two stream salamanders, Dicamptodon tenebrosus and Rhyacotriton cascadae, from the Oregon Cascade Mountains

    USGS Publications Warehouse

    Cudmore, Wynn W.; Bury, R. Bruce

    2014-01-01

    We investigated the potential for resource partitioning between the Coastal giant salamander (Dicamptodon tenebrosus) and the Cascade torrent salamander (Rhyacotriton cascadae) by examining their diet and microhabitats in forest streams. Larval D. tenebrosus and R. cascadae fed primarily upon aquatic insect larvae. We found similar foods in larval and adult R. cascadae and combined these results. Dicamptodon larvae consumed ephemeropteran, plecopteran, and trichopteran larvae in about equal amounts whereas R. cascadae ate more trichopteran and less ephemeropteran larvae than D. tenebrosus. Diet of all R. cascadae overlapped more with smaller than larger sized D. tenebrosus larvae. Comparisons of diets with available foods indicated R. cascadae is more selective or more gape-limited in its feeding habits than D. tenebrosus larvae. The two salamanders differed in use of microhabitats in creeks, which may contribute to their diet differences.

  6. Different season, different strategies: Feeding ecology of two syntopic forest-dwelling salamanders

    NASA Astrophysics Data System (ADS)

    Sebastiano, Salvidio; Antonio, Romano; Fabrizio, Oneto; Dario, Ottonello; Roberta, Michelon

    2012-08-01

    Trophic niche may be the most important ecological dimension for some vertebrate groups and in particular for terrestrial amphibians, that are important predators of soil invertebrates. In general, resource partitioning occurs between syntopic species with similar ecological niches, and coexistence patterns seem to be regulated by temporal resource variability. However most of the generalization on foraging strategies of terrestrial salamanders are extrapolated from studies on New World temperate species, thus we investigated the seasonal effect of resource variation in an European forest ecosystem, in which two ecologically similar but phylogenetically distinct salamander species are found. The diet of adult and juvenile cave salamanders (Speleomantes strinati), and of adult spectacled salamander (Salamandrina perspicillata) was obtained by stomach flushing, and results showed large seasonal changes both in prey availability and in salamander realised trophic niche. Values of trophic diversity were similar and niche overlaps were large among all salamander groups in spring, during high prey availability. Conversely in autumn, when a two-fold reduction in prey biomass was observed, there was a clear niche partitioning as the smaller S. perspicillata shifted from a generalist to a specialized trophic strategy. Juvenile Speleomantes strinatii, that largely overlapped in size with S. perspicillata, did not show any change in diet, suggesting that the feeding strategies were species-specific and not size-mediated. The observed patterns of variation in feeding ecology indicate that similar predators may react differently to changing prey availability to enhance niche partitioning. We also observed an increased energy intake during autumn for S perspicillata and S. strinatii juveniles, possibly related to differences in microhabitat use and activity patterns.

  7. Fictive rhythmic motor patterns produced by the tail spinal cord in salamanders.

    PubMed

    Charrier, V; Cabelguen, J-M

    2013-01-01

    Most investigations into the role of the body axis in vertebrate locomotion have focused on the trunk, although in most tetrapods, the tail also plays an active role. In salamanders, the tail contributes to propulsion during swimming and to dynamic balance and maneuverability during terrestrial locomotion. The aim of the present study was to obtain information concerning the neural mechanisms that produce tail muscle contractions during locomotion in the salamander Pleurodeles waltlii. We recorded the ventral root activities in in vitro spinal cord preparations in which locomotor-like activity was induced via bath application of N-methyl-d-aspartate (20μM) and d-serine (10μM). Recordings showed that the tail spinal cord is capable of producing propagated waves of motor activity that alternate between the left and right sides. Lesion experiments further revealed that the tail rhythmogenic network is composed of a double chain of identical hemisegmental oscillators. Finally, using spinal cord preparations bathed in a chamber partitioned into two pools, we revealed efficient short-distance coupling between the trunk and tail networks. Together, our results demonstrate the existence of a pattern generator for rhythmic tail movements in the salamander and show that the global architecture of the tail network is similar to that previously proposed for the mid-trunk locomotor network in the salamander. Our findings further support the view that salamanders can control their trunk and tail independently during stepping movements. The relevance of our results in relation to the generation of tail muscle contractions in freely moving salamanders is discussed.

  8. Kittlitz's and Marbled Murrelets in Kenai Fjords National Park, South-Central Alaska: At-Sea Distribution, Abundance, and Foraging Habitat, 2006-08

    USGS Publications Warehouse

    Arimitsu, M.L.; Piatt, J.F.; Romano, Marc D.; Madison, E.N.; Conaway, J.S.

    2010-01-01

    Kittlitz's murrelets (Brachyramphus brevirostris) and marbled murrelets (B. marmoratus) are small diving seabirds and are of management concern because of population declines in coastal Alaska. In 2006-08, we conducted a study in Kenai Fjords National Park, south-central Alaska, to estimate the recent population size of Brachyramphus murrelets, to evaluate productivity based on juvenile to adult ratios during the fledgling season, and to describe and compare their use of marine habitat. We also attempted a telemetry study to examine Kittlitz's murrelet nesting habitat requirements and at-sea movements. We estimated that the Kittlitz's murrelet population was 671 ? 144 birds, and the marbled murrelet population was 5,855 ? 1,163 birds. Kittlitz's murrelets were limited to the heads of three fjords with tidewater glaciers, whereas marbled murrelets were more widely distributed. Population estimates for both species were lower in 2007 than in 2006 and 2008, possibly because of anomalous oceanographic conditions that may have delayed breeding phenology. During late season surveys, we observed few hatch-year marbled murrelets and only a single hatch-year Kittlitz's murrelet over the course of the study. Using radio telemetry, we found a likely Kittlitz's murrelet breeding site on a mountainside bordering one of the fjords. We never observed radio-tagged Kittlitz's murrelets greater than 10 kilometer from their capture sites, suggesting that their foraging range during breeding is narrow. We observed differences in oceanography between fjords, reflecting differences in sill characteristics and orientation relative to oceanic influence. Acoustic biomass, a proxy for zooplankton and small schooling fish, generally decreased with distance from glaciers in Northwestern Lagoon, but was more variable in Aialik Bay where dense forage fish schools moved into glacial areas late in the summer. Pacific herring (Clupea pallasii), capelin (Mallotus villosus) and Pacific sand lance

  9. Salamanders ( Plethodon cinereus) go for more: rudiments of number in an amphibian.

    PubMed

    Uller, Claudia; Jaeger, Robert; Guidry, Gena; Martin, Carolyn

    2003-06-01

    Techniques traditionally used in developmental research with infants have been widely used with nonhuman primates in the investigation of comparative cognitive abilities. Recently, researchers have shown that human infants and monkeys select the larger of two numerosities in a spontaneous forced-choice discrimination task. Here we adopt the same method to assess in a series of experiments spontaneous choice of the larger of two numerosities in a species of amphibian, red-backed salamanders ( Plethodon cinereus). The findings indicate that salamanders "go for more," just like human babies and monkeys. This rudimentary capacity is a type of numerical discrimination that is spontaneously present in this amphibian.

  10. Heat shock protein induction and induced thermal tolerance are independent in adult salamanders.

    PubMed

    Easton, D P; Rutledge, P S; Spotila, J R

    1987-02-01

    Ectothermic vertebrates become thermally tolerant (heat hardened) after exposure to heat shock. Eukaryotic cells show a similar response. Cellular thermal tolerance is correlated with the induction of heat shock proteins (hsps). We have investigated the relationship between heat hardening in salamanders and the induction of hsps in the tissues of these organisms. Although the synthesis of hsps can be induced in these animals by sublethal heat shocks, conditions required for hsp induction and heat hardening often do not coincide. We conclude that induced thermal tolerance in adult salamanders is independent of hsp induction in their tissues. PMID:3559509

  11. The effect of waist twisting on walking speed of an amphibious salamander like robot

    NASA Astrophysics Data System (ADS)

    Yin, Xin-Yan; Jia, Li-Chao; Wang, Chen; Xie, Guang-Ming

    2016-06-01

    Amphibious salamanders often swing their waist to coordinate quadruped walking in order to improve their crawling speed. A robot with a swing waist joint, like an amphibious salamander, is used to mimic this locomotion. A control method is designed to allow the robot to maintain the rotational speed of its legs continuous and avoid impact between its legs and the ground. An analytical expression is established between the amplitude of the waist joint and the step length. Further, an optimization amplitude is obtained corresponding to the maximum stride. The simulation results based on automatic dynamic analysis of mechanical systems (ADAMS) and physical experiments verify the rationality and validity of this expression.

  12. Population.

    ERIC Educational Resources Information Center

    International Planned Parenthood Federation, London (England).

    In an effort to help meet the growing interest and concern about the problems created by the rapid growth of population, The International Planned Parenthood Federation has prepared this booklet with the aim of assisting the study of the history and future trends of population growth and its impact on individual and family welfare, national,…

  13. Deformation of ferrofluid marbles in the presence of a permanent magnet.

    PubMed

    Nguyen, Nam-Trung

    2013-11-12

    This paper investigates the deformation of ferrofluid marbles in the presence of a permanent magnet. Ferrofluid marbles are formed using a water-based ferrofluid and 1 μm hydrophobic polytetrafluoride particles. A marble placed on a Teflon coated glass plate deforms under gravity. In the presence of a permanent magnet, the marble is further deformed with a larger contact area. The geometric parameters are normalized by the radius of an undistorted spherical marble. The paper first discusses a scaling relationship between the dimensionless radius of the contact area as well as the dimensionless height and the magnetic Bond number. The dimensionless contact radius is proportional to the fourth root of the magnetic bond number. The dimensionless height scales with the inverse square root of the magnetic Bond number. In the case of a moving marble dragged by a permanent magnet, the deformation is evaluated as the difference between advancing and receding curvatures of the top view. The dimensionless height and the contact diameter of the marble do not significantly depend on the speed or the capillary number. The scaling analysis and experimental data show that the deformation is proportional to the capillary number. PMID:24164113

  14. Characterization of Genes for Beef Marbling Based on Applying Gene Coexpression Network

    PubMed Central

    Lim, Dajeong; Kim, Nam-Kuk; Lee, Seung-Hwan; Park, Hye-Sun; Cho, Yong-Min; Chai, Han-Ha; Kim, Heebal

    2014-01-01

    Marbling is an important trait in characterization beef quality and a major factor for determining the price of beef in the Korean beef market. In particular, marbling is a complex trait and needs a system-level approach for identifying candidate genes related to the trait. To find the candidate gene associated with marbling, we used a weighted gene coexpression network analysis from the expression value of bovine genes. Hub genes were identified; they were topologically centered with large degree and BC values in the global network. We performed gene expression analysis to detect candidate genes in M. longissimus with divergent marbling phenotype (marbling scores 2 to 7) using qRT-PCR. The results demonstrate that transmembrane protein 60 (TMEM60) and dihydropyrimidine dehydrogenase (DPYD) are associated with increasing marbling fat. We suggest that the network-based approach in livestock may be an important method for analyzing the complex effects of candidate genes associated with complex traits like marbling or tenderness. PMID:24624372

  15. Phylogeography of the Brownback Salamander reveals patterns of local endemism in Southern Appalachian springs.

    PubMed

    Timpe, Elizabeth K; Graham, Sean P; Bonett, Ronald M

    2009-08-01

    The Appalachian Mountains of eastern North America are characterized by high faunal diversity and many endemic species, especially in the unglaciated southern latitudes where lineages have been accumulating for tens of millions of years. The Brownback Salamander, Eurycea aquatica, is an enigmatic species that dwells in isolated springs in southeastern North America. Eurycea aquatica have often been dismissed as simply robust spring-adapted ecomorphs of the widespread and more gracile species Eurycea cirrigera. We sequenced the mitochondrial gene encoding NADH dehydrogenase subunit-2 (ND2; 753 bp) and the nuclear recombination activating gene-1 (Rag1; 1201 bp) for E. aquatica (ND2 n = 72; Rag1 n = 17) from across their presumed distribution and compared them to E. cirrigera (ND2 n = 23; Rag1 n = 10) from nearby populations. Using phylogenetic and morphological analyses we explicitly test if E. aquatica in the Southern Appalachians is simply a local spring-adapted ecomorph of E. cirrigera or a single lineage that resulted from fragmentation of (or dispersal to) spring habitats. We found that E. aquatica from isolated springs form a well-supported monophyletic group that is nested among E. cirrigera, E. wilderae, and E. junaluska. Furthermore, we uncovered three very divergent lineages of E. aquatica that we estimate have been isolated from each another since the early Pliocene to late Miocene (2.5-6.1 Myr) and may each represent distinct species. The distribution of these lineages is coincident with the distribution of other endemic spring-dwelling vertebrates, and suggests that this region may be a relictual habitat for an unexpected diversity of unrecognized endemics. PMID:19345271

  16. Effects of Photoperiod and Temperature on Growth and Development in Clouded Salamander (Hynobius nebulosus) Larvae.

    PubMed

    Kukita, Sayuri; Gouda, Mika; Ikeda, Sakiko; Ishibashi, Sakiko; Furuya, Tatsunori; Nakamura, Keiji

    2015-06-01

    Day length is one of the most important factors that organisms use to predict seasonal changes in their environment. Several amphibians regulate their growth and development in response to photoperiod. However, many studies have not focused on the ecological effects of the photoperiodic response on growth and development because they use tropical animals, animals from a commercial source or from unknown localities, or extreme light regimens for experiments. In the present study, we examined the effects of photoperiod on growth and development in the clouded salamander (Hynobius nebulosus) by raising larvae under different photoperiods and at different temperatures in the laboratory. The average larval period under a long-day photoperiod of L16:D8 was longer than that under L12:D12 at 15°C or 20°C, although the difference between the photoperiods was only significant for 15°C. Juveniles weighed more at metamorphosis under L16:D8 than those under L12:D12, irrespective of temperature, suggesting that a longer developmental period results in a heavier body weight. The head width of juveniles did not differ for different photoperiods at either temperature. However, the growth rate of the head width under L12:D12 was faster than that under L16:D8 at 15°C. Long day length appears to produce larger H. nebulosus juveniles in a relatively stable aquatic environment with a low population density. Thus, development may be accelerated when the day length becomes shorter as winter approaches, and larvae may have increased the growth rate of their head widths to compensate for the shorter growing period under shorter day lengths.

  17. Effect of arsenic on p53 mutation and occurrence of teratogenic salamanders: their potential as ecological indicators for arsenic contamination.

    PubMed

    Chang, Jin-Soo; Gu, Man Bock; Kim, Kyoung-Woong

    2009-05-01

    The p53 mutation in salamanders can be used as an indicator of arsenic contamination. The influence of arsenic exposure was studied on mutation of tumor suppressor gene in salamanders collected from several As-contaminated mine areas in Korea. Salamander eggs and larvae were exposed to arsenic in a toxicity test, and teratogenic salamanders found in heavy metal- and As-contaminated water from As-Bi mines were evaluated using PCR-SSCP to determine if they would be useful as an ecological indicator species. Changes in amino acids were shown to have occurred as a result of an arsenic-accumulating event that occurred after the DNA damage. In addition, both of the Hynobius leechii exposed groups were primarily affected by forms of skin damage, changes in the lateral tail/dorsal flexure and/or abnormality teratogenesis. Single-base sense mutation in codons 346 (AAG: Lys to ATG: Met), 224 (TTT: Phe to TTA: Leu), 211 (ATG: Met to AAG: Lys), 244 (TTT: Phe to TTTG: insertion), 245 (Glu GAG to Gln CAG) and 249 (TGT Cys to TGA stop) of the p53 gene were simultaneously found in mutated salamanders. Based on the results of our data illustrating the effect of arsenic exposure on the p53 mutation of salamanders in arsenic-contaminated mine areas, these mutated salamanders can be used as potential ecological indicators in the arsenic-contaminated ecosystems.

  18. Long bone histology of the stem salamander Kokartus honorarius (Amphibia: Caudata) from the Middle Jurassic of Kyrgyzstan.

    PubMed

    Skutschas, Pavel; Stein, Koen

    2015-04-01

    Kokartus honorarius from the Middle Jurassic (Bathonian) of Kyrgyzstan is one of the oldest salamanders in the fossil record, characterized by a mixture of plesiomorphic morphological features and characters shared with crown-group salamanders. Here we present a detailed histological analysis of its long bones. The analysis of a growth series demonstrates a significant histological maturation during ontogeny, expressed by the progressive appearance of longitudinally oriented primary vascular canals, primary osteons, growth marks, remodelling features in primary bone tissues, as well as progressive resorption of the calcified cartilage, formation of endochondral bone and development of cartilaginous to bony trabeculae in the epiphyses. Apart from the presence of secondary osteons, the long bone histology of Kokartus is very similar to that of miniaturized temnospondyls, other Jurassic stem salamanders, miniaturized seymouriamorphs and modern crown-group salamanders. We propose that the presence of secondary osteons in Kokartus honorarius is a plesiomorphic feature, and the loss of secondary osteons in the long bones of crown-group salamanders as well as in those of miniaturized temnospondyls is the result of miniaturization processes. Hitherto, all stem salamander long bong histology (Kokartus, Marmorerpeton and 'salamander A') has been generally described as having paedomorphic features (i.e. the presence of Katschenko's Line and a layer of calcified cartilage), these taxa were thus most likely neotenic forms. The absence of clear lines of arrested growth and annuli in long bones of Kokartus honorarius suggests that the animals lived in an environment with stable local conditions.

  19. Large scale Hugoniot material properties for Danby Marble

    SciTech Connect

    Rinehart, E.J.

    1993-11-01

    This paper presents the results of simulation experiments of nuclear underground testing carried out using the HYDROPLUS methodology for yield verifications of non-standard tests. The objective of this test series was to demonstrate the accuracy of stress and velocity measurements in hard, low porosity rock, to obtain comparisons of large-scale material properties with those obtained from laboratory testing of the same material, and to address the problems posed by a material having a clear precursor wave preceding the main shock wave. The test series consisted of three individual experimental tests. The first established material properties of the Danby marble selected for use in the experiments. The second and third tests looked at stress and velocity gage errors obtained when gages were placed in boreholes and grouted into place.

  20. National uranium resource evaluation, Marble Canyon Quadrangle, Arizona and Utah

    SciTech Connect

    Field, M T; Blauvelt, R P

    1982-05-01

    The Marble Canyon Quadrangle (2/sup 0/), northeast Arizona, was evaluated to a depth of 1500 m for uranium favorability using National Uranium Resource Evaluation criteria. Known mines and prospects were examined; field reconnaissance was done in selected areas of the quadrangle; and a ground-water geochemical survey was made in the southeast third of the quadrangle. The Shinarump and Petrified Forest Members of the Triassic Chinle Formation, which is exposed in the western and northeastern parts of the quadrangle and is present beneath the surface of much of the quadrangle, were found favorable for channel-sandstone uranium deposits. A portion of the Cretaceous Toreva Formation in the southeast part of the quadrangle was found favorable for peneconcordant-sandstone uranium deposits. The western part of the quadrangle was found favorable for uranium concentrations in breccia pipes.

  1. [Pilot study: Apricena Marble District quarry workers and COPD].

    PubMed

    Zefferino, R; Arsa, A; Masullo, M; Nigri, A G; Fanelli, A; Carella, F; Ambrosi, L

    2012-01-01

    The aim of the present article was to verify the Chronic Obstructive Pulmonary Disease (COPD) prevalence in a cohort of quarry workers who belong to the Apricena Marble District. We studied 70 workers. They received a questionnaire about the disease and confounding factors. The spirometry showed that the FEV1 was normal in 95% of workers, instead 5% showed values lower than former (Average: 73%). TNF alpha and IL-1 Beta in Exhaled breath condensate (EBC) were lower than the method limit in all workers. Our cohort is limited, but we could retain that the lung disease is not present in workers taken into consideration. Our results are in according to Rushton who demonstrated that only a prolonged occupation, higher than thirty years, is able to induce lung disease.

  2. Novel microsatellite marker development from the unassembled genome sequence data of the marbled flounder Pseudopleuronectes yokohamae.

    PubMed

    Minegishi, Yuki; Ikeda, Minoru; Kijima, Akihiro

    2015-12-01

    Various genome-scale data have been increasingly published in diverged species, but they can be reused for other purposes by re-analyzing in other ways. As a case study to utilize the published genome data, we developed microsatellite markers from the genome sequence data (assembled contigs and unassembled reads) of the marbled flounder Pseudopleuronectes yokohamae. No microsatellites were identified in the contig sequences, whereas the computer software found 781,773 sequences containing microsatellites with di- to hexa-nucleotide motif in the unassembled reads. For 86,732 unique sequences among them, a total of 331,368 primer pairs were designed. Screening based on PCR amplification, polymorphisms and accurate genotyping resulted in sixteen primer sets, which were later characterized using 45 samples collected in Onagawa Bay, Miyagi, Japan. The presence of null alleles was suggested at four loci in the studied population but no evidence of allelic dropout was found. The observed number of alleles and heterozygosity was 2-20 and 0-0.88889, respectively, indicating polymorphisms and usefulness for population genetic analyses of this species. In addition, a large number of the microsatellite primers developed in this study are potentially applicable also for kinship estimation, individual fingerprint and linkage map construction.

  3. Glycinergic synaptic inputs to bipolar cells in the salamander retina

    PubMed Central

    Maple, Bruce R; Wu, Samuel M

    1998-01-01

    Glycine activated strychnine-sensitive chloride conductances at both the dendrites and the axonal telodendria of most bipolar cells in the salamander retina. The chloride equilibrium potential of bipolar cells was found to be negative to -50 mV, indicating that glycinergic synapses on bipolar cells are inhibitory. Some bipolar cells exhibited discrete, strychnine-sensitive, chloride-mediated inhibitory postsynaptic currents (IPSCs). These were elicited by focal application of glutamate at the inner plexiform layer (IPL). Glycinergic synapses were localized using simultaneous focal application of calcium to retinal slices bathed in calcium-free media. Both dendritic and telodendritic glycinergic IPSCs were observed. The decay of the telodendritic IPSCs was well fitted by a single exponential with a time constant of 17.7 ± 8.7 ms. Similar kinetics were observed for dendritic IPSCs in some cells, but in one class of on-centre bipolar cell the decay of the dendritic IPSCs was better fitted by a sum of two exponentials with time constants 9.9 ± 4.3 and 51.3 ± 24.3 ms. The dendritic IPSCs were best driven by application of glutamate at the distal IPL (the off sublamina), while the telodendritic IPSCs were driven best by application near the telodendria. These results suggest that bipolar cell dendrites receive inhibitory glycinergic inputs from interplexiform cells that are excited by off-centre bipolar cells, whereas bipolar cell telodendria receive glycinergic amacrine cell inputs that are antagonistic to the photoreceptor inputs. Both inputs could be elicited in the presence of tetrodotoxin (TTX), but the dendritic IPSCs were sometimes abolished by TTX, suggesting that sodium-dependent spikes play an important role in the transmission of interplexiform cell signals to the outer plexiform layer. PMID:9503334

  4. Molecular mechanisms of extensive mitochondrial gene rearrangementin plethodontid salamanders

    SciTech Connect

    Mueller, Rachel Lockridge; Boore, Jeffrey L.

    2005-06-01

    Extensive gene rearrangement is reported in the mitochondrial genomes of lungless salamanders (Plethodontidae). In each genome with a novel gene order, there is evidence that the rearrangement was mediated by duplication of part of the mitochondrial genome, including the presence of both pseudogenes and additional, presumably functional, copies of duplicated genes. All rearrangement-mediating duplications include either the origin of light strand replication and the nearby tRNA genes or the regions flanking the origin of heavy strand replication. The latter regions comprise nad6, trnE, cob, trnT, an intergenic spacer between trnT and trnP and, in some genomes, trnP, the control region, trnF, rrnS, trnV, rrnL, trnL1, and nad1. In some cases, two copies of duplicated genes, presumptive regulatory regions, and/or sequences with no assignable function have been retained in the genome following the initial duplication; in other genomes, only one of the duplicated copies has been retained. Both tandem and non-tandem duplications are present in these genomes, suggesting different duplication mechanisms. In some of these mtDNAs, up to 25 percent of the total length is composed of tandem duplications of non-coding sequence that includes putative regulatory regions and/or pseudogenes of tRNAs and protein-coding genes along with otherwise unassignable sequences. These data indicate that imprecise initiation and termination of replication, slipped-strand mispairing, and intra-molecular recombination may all have played a role in generating repeats during the evolutionary history of plethodontid mitochondrial genomes.

  5. A tadpole-induced polyphenism in the salamander Hynobius retardatus.

    PubMed

    Michimae, Hirofumi; Wakahara, Masami

    2002-10-01

    Larvae of the salamander Hynobius retardatus have two distinct morphs: normal and broad-headed, cannibal morphs. We performed three experiments to differentiate among the following hypotheses: The broad-headed morph is induced to allow: (1) feeding on nutritious conspecifics; (2) exclusion of strong competitors for food or space; or (3) feeding on large, tough prey when smaller prey items are unavailable. When newly hatched larvae were reared with a heterospecific, Rana pirica (an anuran amphibian) tadpoles, the broad-headed morph was induced more frequently compared with those reared with conspecifics. The phenotype expressed depended on the size of the tadpoles: The broad-headed morph occurred more frequently with small and the normal morph with large tadpoles. Metamorphosis occurred sooner in larvae fed conspecifics compared with those fed heterospecific tadpoles, and the mean growth rate of larvae fed conspecifics was significantly faster than that of those fed tadpoles, suggesting that the heterospecific tadpoles were less nutritive than the conspecifics. These results do not support the hypotheses that the broad-headed morph evolved for consuming conspecifics because of their better balance of nutrients or for excluding strong competitors for food or space. We tentatively conclude that the morph evolved to eat large, tough prey, including both conspecifics and heterospecific tadpoles. Because H. retardatus usually spawns very early in the spring in small ponds partially covered with ice and snow, newly hatched larvae may starve from the lack of proper food owing to extremely low water temperatures. Thus, the broad-headed morph of H. retardatus may represent a cold-habitat adaptation to overcome the severe circumstance when the only food items available are relatively large conspecifics or heterospecific tadpoles. PMID:12449490

  6. Effect of acute low body temperature on predatory behavior and prey-capture efficiency in a plethodontid salamander.

    PubMed

    Marvin, Glenn A; Davis, Kayla; Dawson, Jacob

    2016-05-01

    The low-temperature limit for feeding in some salamander species (Desmognathus, Plethodontidae) has been inferred from field studies of seasonal variation in salamander activity and gut contents, which could not determine whether feeding is more dependent on environmental conditions influencing salamander foraging behavior or prey availability and movement. We performed two controlled laboratory experiments to examine the effect of short-term (acute) low body temperature on predatory behavior and prey-capture efficiency in a semiaquatic plethodontid salamander (Desmognathus conanti). In the first experiment, we quantified variation in the feeding responses of cold salamanders (at 1, 3, 5 and 7°C) to a video recording of a walking, warm (15°C) cricket to determine the lower thermal limit for predatory behavior, independent of any temperature effect on movement of prey. Experimental-group salamanders exhibited vigorous feeding responses at 5 and 7°C, large variation in feeding responses both among and within individuals (over time) at 3°C, and little to no feeding response at 1°C. Feeding responses at both 1 and 3°C were significantly less than at each higher temperature, whereas responses of control-group individuals at 15°C did not vary over time. In the second experiment, we quantified feeding by cold salamanders (at 3, 5, 7 and 11°C) on live, warm crickets to examine thermal effects on prey-capture ability. The mean feeding response to live crickets was significantly less at 3°C than at higher temperatures; however, 50% of salamanders captured and ingested prey with high efficiency at this temperature. We conclude that many individuals stalk and capture prey at very low temperatures (down to 3°C). Our results support a growing body of data that indicate many plethodontid salamanders feed at temperatures only a few degrees above freezing.

  7. Responses of Eastern red-backed salamanders (Plethodon cinereus) to chemical cues of prey presented in soluble and volatile forms.

    PubMed

    Telfer, A C; Laberge, F

    2013-04-10

    Terrestrial salamanders are able to detect prey items using chemical cues, but the nature of the cues involved is uncertain. This study aimed to tease apart the roles of the soluble and volatile components of prey cues detected by Eastern red-backed salamanders (Plethodon cinereus), assuming the likelihood that these different components are respectively detected by the vomeronasal (accessory) and main olfactory organs. Wild-caught salamanders were exposed to control or soluble and volatile cricket cues in two different behavioural assays conducted in the laboratory. The first series of assays focused on localized presentation of soluble cues on the substrate, and the second on point sources of volatile cues delivered through plastic tubes. Room temperature was varied across experiments. Salamanders increased chemoinvestigation of the substrate via nosetapping when soluble prey cues were distributed non-uniformly on the substrate. In the warmer of two temperatures tested, salamanders additionally showed a spatial preference for location of soluble cue deposition. Attraction to a point source of volatile cues was not evident when examining the responses of salamanders grouped together; however, investigation of the volatile point source was significantly correlated with side preference only when both soluble cues and a volatile point source were present. The latter suggests that a subset of salamanders were attracted to the point source of volatile cues in the presence of soluble cues on the substrate. This study indicates that soluble prey cues alone are sufficient to trigger salamander foraging behaviour, and that temperature influences this foraging response. It supports the notion that the vomeronasal system plays an important role in prey detection, but suggests that volatile cues are also investigated by some salamanders when soluble prey cues have been detected.

  8. Effect of acute low body temperature on predatory behavior and prey-capture efficiency in a plethodontid salamander.

    PubMed

    Marvin, Glenn A; Davis, Kayla; Dawson, Jacob

    2016-05-01

    The low-temperature limit for feeding in some salamander species (Desmognathus, Plethodontidae) has been inferred from field studies of seasonal variation in salamander activity and gut contents, which could not determine whether feeding is more dependent on environmental conditions influencing salamander foraging behavior or prey availability and movement. We performed two controlled laboratory experiments to examine the effect of short-term (acute) low body temperature on predatory behavior and prey-capture efficiency in a semiaquatic plethodontid salamander (Desmognathus conanti). In the first experiment, we quantified variation in the feeding responses of cold salamanders (at 1, 3, 5 and 7°C) to a video recording of a walking, warm (15°C) cricket to determine the lower thermal limit for predatory behavior, independent of any temperature effect on movement of prey. Experimental-group salamanders exhibited vigorous feeding responses at 5 and 7°C, large variation in feeding responses both among and within individuals (over time) at 3°C, and little to no feeding response at 1°C. Feeding responses at both 1 and 3°C were significantly less than at each higher temperature, whereas responses of control-group individuals at 15°C did not vary over time. In the second experiment, we quantified feeding by cold salamanders (at 3, 5, 7 and 11°C) on live, warm crickets to examine thermal effects on prey-capture ability. The mean feeding response to live crickets was significantly less at 3°C than at higher temperatures; however, 50% of salamanders captured and ingested prey with high efficiency at this temperature. We conclude that many individuals stalk and capture prey at very low temperatures (down to 3°C). Our results support a growing body of data that indicate many plethodontid salamanders feed at temperatures only a few degrees above freezing. PMID:26939728

  9. A meta-analytic assessment of a Thyroglobulin marker for marbling in beef cattle

    PubMed Central

    Wood, Ian A; Moser, Gerhard; Burrell, Daniel L; Mengersen, Kerrie L; Hetzel, D Jay S

    2006-01-01

    A meta-analysis was undertaken reporting on the association between a polymorphism in the Thyroglobulin gene (TG5) and marbling in beef cattle. A Bayesian hierarchical model was adopted, with alternative representations assessed through sensitivity analysis. Based on the overall posterior means and posterior probabilities, there is substantial support for an additive association between the TG5 marker and marbling. The marker effect was also assessed across various breed groups, with each group displaying a high probability of positive association between the T allele and marbling. The WinBUGS program code used to simulate the model is included as an Appendix available online at . PMID:16954041

  10. Movement, demographics, and occupancy dynamics of a federally-threatened salamander: evaluating the adequacy of critical habitat.

    PubMed

    Bendik, Nathan F; McEntire, Kira D; Sissel, Blake N

    2016-01-01

    Critical habitat for many species is often limited to occupied localities. For rare and cryptic species, or those lacking sufficient data, occupied habitats may go unrecognized, potentially hindering species recovery. Proposed critical habitat for the aquatic Jollyville Plateau salamander (Eurycea tonkawae) and two sister species were delineated based on the assumption that surface habitat is restricted to springs and excludes intervening stream reaches. To test this assumption, we performed two studies to understand aspects of individual, population, and metapopulation ecology of E. tonkawae. First, we examined movement and population demographics using capture-recapture along a spring-influenced stream reach. We then extended our investigation of stream habitat use with a study of occupancy and habitat dynamics in multiple headwater streams. Indications of extensive stream channel use based on capture-recapture results included frequent movements of >15 m, and high juvenile abundance downstream of the spring. Initial occupancy of E. tonkawae was associated with shallow depths, maidenhair fern presence and low temperature variation (indicative of groundwater influence), although many occupied sites were far from known springs. Additionally, previously dry sites were three times more likely to be colonized than wet sites. Our results indicate extensive use of stream habitats, including intermittent ones, by E. tonkawae. These areas may be important for maintaining population connectivity or even as primary habitat patches. Restricting critical habitat to occupied sites will result in a mismatch with actual habitat use, particularly when assumptions of habitat use are untested, thus limiting the potential for recovery.

  11. Movement, demographics, and occupancy dynamics of a federally-threatened salamander: evaluating the adequacy of critical habitat

    PubMed Central

    McEntire, Kira D.; Sissel, Blake N.

    2016-01-01

    Critical habitat for many species is often limited to occupied localities. For rare and cryptic species, or those lacking sufficient data, occupied habitats may go unrecognized, potentially hindering species recovery. Proposed critical habitat for the aquatic Jollyville Plateau salamander (Eurycea tonkawae) and two sister species were delineated based on the assumption that surface habitat is restricted to springs and excludes intervening stream reaches. To test this assumption, we performed two studies to understand aspects of individual, population, and metapopulation ecology of E. tonkawae. First, we examined movement and population demographics using capture-recapture along a spring-influenced stream reach. We then extended our investigation of stream habitat use with a study of occupancy and habitat dynamics in multiple headwater streams. Indications of extensive stream channel use based on capture-recapture results included frequent movements of >15 m, and high juvenile abundance downstream of the spring. Initial occupancy of E. tonkawae was associated with shallow depths, maidenhair fern presence and low temperature variation (indicative of groundwater influence), although many occupied sites were far from known springs. Additionally, previously dry sites were three times more likely to be colonized than wet sites. Our results indicate extensive use of stream habitats, including intermittent ones, by E. tonkawae. These areas may be important for maintaining population connectivity or even as primary habitat patches. Restricting critical habitat to occupied sites will result in a mismatch with actual habitat use, particularly when assumptions of habitat use are untested, thus limiting the potential for recovery. PMID:26998413

  12. Movement, demographics, and occupancy dynamics of a federally-threatened salamander: evaluating the adequacy of critical habitat.

    PubMed

    Bendik, Nathan F; McEntire, Kira D; Sissel, Blake N

    2016-01-01

    Critical habitat for many species is often limited to occupied localities. For rare and cryptic species, or those lacking sufficient data, occupied habitats may go unrecognized, potentially hindering species recovery. Proposed critical habitat for the aquatic Jollyville Plateau salamander (Eurycea tonkawae) and two sister species were delineated based on the assumption that surface habitat is restricted to springs and excludes intervening stream reaches. To test this assumption, we performed two studies to understand aspects of individual, population, and metapopulation ecology of E. tonkawae. First, we examined movement and population demographics using capture-recapture along a spring-influenced stream reach. We then extended our investigation of stream habitat use with a study of occupancy and habitat dynamics in multiple headwater streams. Indications of extensive stream channel use based on capture-recapture results included frequent movements of >15 m, and high juvenile abundance downstream of the spring. Initial occupancy of E. tonkawae was associated with shallow depths, maidenhair fern presence and low temperature variation (indicative of groundwater influence), although many occupied sites were far from known springs. Additionally, previously dry sites were three times more likely to be colonized than wet sites. Our results indicate extensive use of stream habitats, including intermittent ones, by E. tonkawae. These areas may be important for maintaining population connectivity or even as primary habitat patches. Restricting critical habitat to occupied sites will result in a mismatch with actual habitat use, particularly when assumptions of habitat use are untested, thus limiting the potential for recovery. PMID:26998413

  13. Elimination kinetics of acetylene and Freon 22 in resting and active lungless salamanders.

    PubMed

    Feder, M E; Full, R J; Piiper, J

    1988-05-01

    To quantify diffusion limitation in cutaneous gas exchange, the elimination of two inert gases of different diffusivity, Freon 22 (CHC1F2) and acetylene (C2H2), was measured simultaneously in exclusively skin-breathing lungless salamanders, Desmognathus quadramaculatus. In resting salamanders, elimination of both gases could be described as the sum of three exponential terms. For both the medium and the slow exponential component, the ratio of the respective rate constants (k) for acetylene and Freon averaged 1.77. This value is between the values expected for perfusion limitation (1.00) and diffusion limitation (1.94), indicating combined diffusion and perfusion limitation. In salamanders stimulated to run on a treadmill, the elimination rates and the rate constants increased more for Freon than for acetylene. During spontaneous activity, the increase in elimination of Freon was larger than that of acetylene. These findings suggest an increase in the diffusing capacity of the skin during exercise. Thus the diffusing capacity of salamander skin for gases appears to be variable and to be adjusted to meet the increased O2 requirement during exercise.

  14. Bimodal locomotion elicited by electrical stimulation of the midbrain in the salamander Notophthalmus viridescens.

    PubMed

    Cabelguen, Jean-Marie; Bourcier-Lucas, Céline; Dubuc, Réjean

    2003-03-15

    The present experiments were designed to identify the mesencephalic locomotor region (MLR) in the salamander. An in vitro semi-intact preparation from a decerebrate adult salamander (Notophthalmus viridescens) was developed in which the locomotor activities were monitored from electromyographic and video recordings. The results show that the two locomotor modes exhibited by salamanders (i.e., stepping and swimming) were evoked by electrical microstimulation (5-15 Hz; 0.1-10 microA; 2 msec pulses) of a circumscribed region in the caudal mesencephalon. At threshold current strength (0.5-3.5 microA at 15 Hz), rhythmic limb movements and intersegmental coordination, such as during stepping, were induced. As the stimulation strength was subsequently increased, the frequency of stepping became more rapid, and, at 2.0-5.5 microA, the limbs were held back against the body wall and swimming movements of the trunk were induced. An additional increase of the stimulation strength induced an increase of the frequency and amplitude of the swimming movements. Anatomical studies conducted in parallel revealed the presence of choline acetyltransferase immunoreactive cells in the functionally identified MLR region. Together, the present results indicate that the MLR is present in salamanders and that its level of activation determines the mode of locomotion. Walking is induced at low activation levels, and swimming, which constitutes a faster mode of locomotion, requires stronger stimulation of the MLR. Furthermore, as in other vertebrates, the MLR contains cholinergic cells.

  15. A stem batrachian from the Early Permian of Texas and the origin of frogs and salamanders.

    PubMed

    Anderson, Jason S; Reisz, Robert R; Scott, Diane; Fröbisch, Nadia B; Sumida, Stuart S

    2008-05-22

    The origin of extant amphibians (Lissamphibia: frogs, salamanders and caecilians) is one of the most controversial questions in vertebrate evolution, owing to large morphological and temporal gaps in the fossil record. Current discussions focus on three competing hypotheses: a monophyletic origin within either Temnospondyli or Lepospondyli, or a polyphyletic origin with frogs and salamanders arising among temnospondyls and caecilians among the lepospondyls. Recent molecular analyses are also controversial, with estimations for the batrachian (frog-salamander) divergence significantly older than the palaeontological evidence supports. Here we report the discovery of an amphibamid temnospondyl from the Early Permian of Texas that bridges the gap between other Palaeozoic amphibians and the earliest known salientians and caudatans from the Mesozoic. The presence of a mosaic of salientian and caudatan characters in this small fossil makes it a key taxon close to the batrachian (frog and salamander) divergence. Phylogenetic analysis suggests that the batrachian divergence occurred in the Middle Permian, rather than the late Carboniferous as recently estimated using molecular clocks, but the divergence with caecilians corresponds to the deep split between temnospondyls and lepospondyls, which is congruent with the molecular estimates.

  16. Vertebral development of modern salamanders provides insights into a unique event of their evolutionary history.

    PubMed

    Boisvert, Catherine Anne

    2009-01-15

    The origin of salamanders and their interrelationships to the two other modern amphibian orders (frogs and caecilians) are problematic owing to an 80-100 million year gap in the fossil record between the Carboniferous to the Lower Jurassic. This is compounded by a scarcity of adult skeletal characters linking the early representatives of the modern orders to their stem-group in the Paleozoic. The use of ontogenetic characters can be of great use in the resolution of these questions. Growth series of all ten modern salamander families (a 120 cleared and stained larvae) were examined for pattern and timing of vertebral elements chondrification and ossification. The primitive pattern is that of the neural arches developing before the centra, while the reverse represents the derived condition. Both the primitive and derived conditions are observed within the family Hynobiidae, whereas only the derived condition is observed in all other salamanders. This provides support to the claims that Hynobiidae is both the most basal of modern families and potentially polyphyletic (with Ranodon and Hybobius forming the most basal clade and Salamandrella being a part of the most derived clade). This provides insight into a unique event in salamander evolutionary history and suggests that the developmental pattern switch occurred between the Triassic and the mid-Jurassic before the last major radiation.

  17. Embryonic staging table for a direct-developing salamander, Plethodon cinereus (Plethodontidae).

    PubMed

    Kerney, Ryan

    2011-11-01

    This work presents a refined staging table for the direct-developing red-backed salamander Plethodon cinereus, which is based on the incomplete staging system of James Norman Dent (J Morphol 1942; 71:577-601). This common species from eastern North America is a member of the species-rich lungless salamander family Plethodontidae. The staging table presented here covers several stages omitted by Dent and reveals novel developmental features of P. cinereus embryos. These include putative Leydig cells and open gill clefts, which are found in larvae of metamorphosing species but were previously reported as absent in direct-developing Plethodon. Other features found in larvae of metamorphosing salamander species, such as the palatopterygoid bone and lateral line neuromasts, were not observed in this material. The occurrence of larval and metamorphic features in these embryos has direct bearing on the patterns of life history evolution within the plethodontidae family. This study emphasizes the degree to which typically larval structures are retained in this direct-developing species and provides a staging table for further investigations into the development and evolution of plethodontid salamanders.

  18. Pathological and microbiological findings from mortality of the Chinese giant salamander (Andrias davidianus).

    PubMed

    Meng, Yan; Ma, Jie; Jiang, Nan; Zeng, Ling-Bing; Xiao, Han-Bing

    2014-06-01

    The Chinese giant salamander, Andrias davidianus, is a nationally protected and cultured species in China. Recently, a severe epizootic occurred in cultured Chinese giant salamanders in Hubei, Hunan, Sichuan, Shaanxi, and Zhejiang provinces of China, causing substantial economic losses. The typical clinical signs of diseased larval animals were jaw and abdominal swelling and subcutaneous hemorrhaging. Diseased adult animals exhibited skin hemorrhages, ulceration of the hind limbs, and multiple hemorrhagic spots in the visceral organs. Histopathological observation indicated tissue necrosis and cytoplasmic inclusions in the spleen, liver and kidney, suggestive of viral disease. A viral agent was isolated from affected tissues in cell culture. The virus was determined to be pathogenic after experimental infection. Electron microscopy revealed iridovirus-like virions with a size of 140-180 nm in diameter inside the kidney of naturally infected animals and in cell culture. The major capsid protein (MCP) of the virus exhibited 98-99 % sequence identity to ranaviruses. Additionally, phylogenetic analysis indicated that the virus belonged to the genus Ranavirus. Comparative analysis of the MCP gene sequence with those of other viruses previously isolated from Chinese giant salamanders revealed that these isolates were highly similar, although a few variations were observed. The virus was preliminarily named Chinese giant salamander iridovirus (GSIV). PMID:24385158

  19. Complete Genome Sequence of a Ranavirus Isolated from Chinese Giant Salamander (Andrias davidianus).

    PubMed

    Wang, Na; Zhang, Min; Zhang, Lifeng; Jing, Hongli; Jiang, Yulin; Wu, Shaoqiang; Lin, Xiangmei

    2014-01-09

    A ranavirus (RV) was isolated from Chinese giant salamanders (Andrias davidianus) in China in 2010 and provisionally designated Andrias davidianus ranavirus (ADRV). The complete genome sequence is 106,719 nucleotides long. Genomic sequence and phylogenetic analyses showed that ADRV has a high degree of conservation with other RVs.

  20. Near infrared reflectance spectroscopy studies of Chinese giant salamanders in aquaculture production

    Technology Transfer Automated Retrieval System (TEKTRAN)

    NIR spectra were collected at three surface locations for Chinese giant salamanders to ascertain whether spectral signatures could be separated by anatomical, presumably physiologically-based, locations. The first location was the smooth area immediately above the cloaca on the animal’s abdomen, whi...

  1. Pathological and microbiological findings from mortality of the Chinese giant salamander (Andrias davidianus).

    PubMed

    Meng, Yan; Ma, Jie; Jiang, Nan; Zeng, Ling-Bing; Xiao, Han-Bing

    2014-06-01

    The Chinese giant salamander, Andrias davidianus, is a nationally protected and cultured species in China. Recently, a severe epizootic occurred in cultured Chinese giant salamanders in Hubei, Hunan, Sichuan, Shaanxi, and Zhejiang provinces of China, causing substantial economic losses. The typical clinical signs of diseased larval animals were jaw and abdominal swelling and subcutaneous hemorrhaging. Diseased adult animals exhibited skin hemorrhages, ulceration of the hind limbs, and multiple hemorrhagic spots in the visceral organs. Histopathological observation indicated tissue necrosis and cytoplasmic inclusions in the spleen, liver and kidney, suggestive of viral disease. A viral agent was isolated from affected tissues in cell culture. The virus was determined to be pathogenic after experimental infection. Electron microscopy revealed iridovirus-like virions with a size of 140-180 nm in diameter inside the kidney of naturally infected animals and in cell culture. The major capsid protein (MCP) of the virus exhibited 98-99 % sequence identity to ranaviruses. Additionally, phylogenetic analysis indicated that the virus belonged to the genus Ranavirus. Comparative analysis of the MCP gene sequence with those of other viruses previously isolated from Chinese giant salamanders revealed that these isolates were highly similar, although a few variations were observed. The virus was preliminarily named Chinese giant salamander iridovirus (GSIV).

  2. Transcriptomic analysis of the host response to an iridovirus infection in Chinese giant salamander, Andrias davidianus.

    PubMed

    Fan, Yuding; Chang, Ming Xian; Ma, Jie; LaPatra, Scott E; Hu, Yi Wei; Huang, Lili; Nie, Pin; Zeng, Lingbing

    2015-11-20

    The emergence of an infectious viral disease caused by the Chinese giant salamander iridovirus (GSIV) has led to substantial economic losses. However, no more molecular information is available for the understanding of the mechanisms associated with virus-host interaction. In this study, de novo sequencing was used to obtain abundant high-quality ESTs and investigate differentially-expressed genes in the spleen of Chinese giant salamanders that were either infected or mock infected with GSIV. Comparative expression analysis indicated that 293 genes were down-regulated and 220 genes were up-regulated. Further enrichment analysis showed that the most enriched pathway is "complement and coagulation cascades", and significantly enriched diseases include "inherited thrombophilia", "immune system diseases", "primary immunodeficiency", "complement regulatory protein defects", and "disorders of nucleotide excision repair". Additionally, 30 678 simple sequence repeats (SSRs) from all spleen samples, 26 355 single nucleotide polymorphisms (SNPs) from the spleens of uninfected animals and 36 070 SNPs from the spleens of infected animals were detected. The large amount of variation was specific for the Chinese giant salamanders that were infected with GSIV. The results reported herein provided significant and new EST information that could contribute greatly in investigations into the molecular functions of immune genes in the Chinese giant salamander.

  3. Using the Eastern Hellbender Salamander in a High School Genetics & Ecological Conservation Activity

    ERIC Educational Resources Information Center

    Chudyk, Sarah; McMillan, Amy; Lange, Catherine

    2014-01-01

    This article contains an original 5E lesson plan developed from conservation genetics research on the giant North American hellbender salamander, Cryptobranchus alleganiensis alleganiensis. The lesson plan provides background information on the hellbender, reviews basic genetics, and exposes students to the scientific process that is used during…

  4. Molecular cloning of estrogen receptor alpha (ERalpha; ESR1) of the Japanese giant salamander, Andrias japonicus.

    PubMed

    Katsu, Yoshinao; Kohno, Satomi; Oka, Tomohiro; Mitsui, Naoko; Tooi, Osamu; Santo, Noriaki; Urushitani, Hiroshi; Fukumoto, Yukio; Kuwabara, Kazushi; Ashikaga, Kazuhide; Minami, Shinji; Kato, Shigeaki; Ohta, Yasuhiko; Guillette, Louis J; Iguchi, Taisen

    2006-09-26

    Estrogens are essential for normal reproductive activity in females and males and for ovarian differentiation during a critical developmental stage in many vertebrates. To understand the molecular mechanisms of estrogen action and to evaluate estrogen receptor ligand interactions in the Japanese giant salamander (Andrias japonicus), we isolated cDNA encoding the estrogen receptor (ER) from the liver. A full-length Japanese giant salamander ER cDNA (jgsER) was obtained using 5' and 3' rapid amplification cDNA ends (RACE). The deduced amino acid sequence of the jgsER showed high identity to the Xenopus ERalpha (ESR1) (77.7%). We have applied both the conventional ERE-luciferase reporter assay system and the GAL4-transactivation system to characterize this receptor. In two different transient transfection assay systems using mammalian cells, the jgsER protein displayed estrogen-dependent activation of transcription. The GAL4-transactivation system showed about 10-fold greater activity of the estrogen receptor by hormone when compared to the conventional ERE-luciferase reporter assay system. Tissue distribution of ERalpha mRNA was examined and kidney, ovary and liver exhibited expression. This is the first isolation of an estrogen receptor from a salamander and also is the first functional cDNA obtained from the Japanese giant salamander, an endangered species considered a special natural monument of Japan.

  5. A stem batrachian from the Early Permian of Texas and the origin of frogs and salamanders.

    PubMed

    Anderson, Jason S; Reisz, Robert R; Scott, Diane; Fröbisch, Nadia B; Sumida, Stuart S

    2008-05-22

    The origin of extant amphibians (Lissamphibia: frogs, salamanders and caecilians) is one of the most controversial questions in vertebrate evolution, owing to large morphological and temporal gaps in the fossil record. Current discussions focus on three competing hypotheses: a monophyletic origin within either Temnospondyli or Lepospondyli, or a polyphyletic origin with frogs and salamanders arising among temnospondyls and caecilians among the lepospondyls. Recent molecular analyses are also controversial, with estimations for the batrachian (frog-salamander) divergence significantly older than the palaeontological evidence supports. Here we report the discovery of an amphibamid temnospondyl from the Early Permian of Texas that bridges the gap between other Palaeozoic amphibians and the earliest known salientians and caudatans from the Mesozoic. The presence of a mosaic of salientian and caudatan characters in this small fossil makes it a key taxon close to the batrachian (frog and salamander) divergence. Phylogenetic analysis suggests that the batrachian divergence occurred in the Middle Permian, rather than the late Carboniferous as recently estimated using molecular clocks, but the divergence with caecilians corresponds to the deep split between temnospondyls and lepospondyls, which is congruent with the molecular estimates. PMID:18497824

  6. Vertebral development of modern salamanders provides insights into a unique event of their evolutionary history.

    PubMed

    Boisvert, Catherine Anne

    2009-01-15

    The origin of salamanders and their interrelationships to the two other modern amphibian orders (frogs and caecilians) are problematic owing to an 80-100 million year gap in the fossil record between the Carboniferous to the Lower Jurassic. This is compounded by a scarcity of adult skeletal characters linking the early representatives of the modern orders to their stem-group in the Paleozoic. The use of ontogenetic characters can be of great use in the resolution of these questions. Growth series of all ten modern salamander families (a 120 cleared and stained larvae) were examined for pattern and timing of vertebral elements chondrification and ossification. The primitive pattern is that of the neural arches developing before the centra, while the reverse represents the derived condition. Both the primitive and derived conditions are observed within the family Hynobiidae, whereas only the derived condition is observed in all other salamanders. This provides support to the claims that Hynobiidae is both the most basal of modern families and potentially polyphyletic (with Ranodon and Hybobius forming the most basal clade and Salamandrella being a part of the most derived clade). This provides insight into a unique event in salamander evolutionary history and suggests that the developmental pattern switch occurred between the Triassic and the mid-Jurassic before the last major radiation. PMID:19025964

  7. Transcriptomic analysis of the host response to an iridovirus infection in Chinese giant salamander, Andrias davidianus.

    PubMed

    Fan, Yuding; Chang, Ming Xian; Ma, Jie; LaPatra, Scott E; Hu, Yi Wei; Huang, Lili; Nie, Pin; Zeng, Lingbing

    2015-01-01

    The emergence of an infectious viral disease caused by the Chinese giant salamander iridovirus (GSIV) has led to substantial economic losses. However, no more molecular information is available for the understanding of the mechanisms associated with virus-host interaction. In this study, de novo sequencing was used to obtain abundant high-quality ESTs and investigate differentially-expressed genes in the spleen of Chinese giant salamanders that were either infected or mock infected with GSIV. Comparative expression analysis indicated that 293 genes were down-regulated and 220 genes were up-regulated. Further enrichment analysis showed that the most enriched pathway is "complement and coagulation cascades", and significantly enriched diseases include "inherited thrombophilia", "immune system diseases", "primary immunodeficiency", "complement regulatory protein defects", and "disorders of nucleotide excision repair". Additionally, 30 678 simple sequence repeats (SSRs) from all spleen samples, 26 355 single nucleotide polymorphisms (SNPs) from the spleens of uninfected animals and 36 070 SNPs from the spleens of infected animals were detected. The large amount of variation was specific for the Chinese giant salamanders that were infected with GSIV. The results reported herein provided significant and new EST information that could contribute greatly in investigations into the molecular functions of immune genes in the Chinese giant salamander. PMID:26589400

  8. Weight losses of marble and limestone briquettes exposed to outdoor environments in the eastern United States

    SciTech Connect

    Youngdahl, C.A.

    1987-08-01

    Weight losses of marble and limestone samples exposed to outdoor environments at field sites in the eastern United States have been monitored in studies initiated in 1984. The prodcedures are described, and the results are tabulated and discussed. A rate of marble loss approximately equivalent to 16 ..mu..m of surface recession per year was found in North Carolina, and losses of this order were also observed in New Jersey, New York, and Washington, DC. Limestone weight losses were much higher than for marble in the first year; loss of extraneous materials from the porous limestone appeared to be a likely contributor to the overall loss. The rate of limestone loss diminished in the second year, though it continued to be higher than for marble. Exposures are continuing in a planned 10-yr program of tests. 8 refs., 3 figs., 5 tabs.

  9. Marble tombstone in national cemeteries as indicators of stone damage: general methods

    SciTech Connect

    Baer, N.S.; Berman, S.M.

    1983-01-01

    The role of acid deposition in damage to materials exposed to the environment is a matter of national concern. Marble tombstones are an example of widely distributed materials of uniform composition which have known times of exposure. A study of marble tombstones in 23 national cemeteries and soldiers lots in private cemeteries identified the marble source, the method of cutting, historical data, and physical measurements. The results show that fine-grained Vermont marble should be used as a standard in short-term exposure studies because it weathers more rapidly. A comparison of the weathering rates for rural, suburban, and urban cemeteries with comparable climates with high annual precipitation levels indicates that the urban environment causes significant damage beyond that observed in rural environments and that local sources dominate the deposition of damaging pollutants. 16 references, 6 figures, 4 tables.

  10. Determination of geochemical and natural radioactivity characteristics in Bilecik Marble, Turkey

    NASA Astrophysics Data System (ADS)

    Yerel Kandemir, Suheyla; Ozbay, Nurgul

    2014-05-01

    Natural stones are one of the oldest known building materials. There are more than 400 natural stone in Turkey. Recently, the demand for the natural stone types in markets has been increasing rapidly. For this reason, the geochemical and natural radioactivity characteristics of natural stone are very important. Bilecik province is located at the northwest part of Turkey and it is surrounded by Sakarya, Bursa, Eskisehir and Kutahya city. Bilecik is one of the important marble industry regions of Turkey. Thus, the geochemical and natural radioactivity characteristics of Bilecik marble are very important. In this study, Bilecik marble was collected to determine the geochemistry and natural radioactivity. Then, analyses of geochemical and natural radioactivity in the marble samples are interpreted. ACKNOWLEDGMENT This study is supported by Bilecik Seyh Edebali University scientific project (Project Number =2011-02-BIL.03-04).

  11. Utah Marbles and Mars Blueberries: Comparitive Terrestrial Analogs for Hematite Concretions on Mars

    NASA Astrophysics Data System (ADS)

    Chan, M. A.; Beitler, B.; Parry, W. T.; Ormö, J.; Komatsu, G.

    2005-03-01

    Compelling comparisons show why Utah iron oxide-cemented "marbles" are a good analog for Mars hematite "blueberries". Terrestrial examples offer valuable models for interpreting the diagenetic history and importance of water on Mars.

  12. Methods for tracing the origin of white marbles used in antiquity

    NASA Astrophysics Data System (ADS)

    Prochaska, Walter; Grillo, Silvana Maria

    2013-04-01

    The topic of this paper is to given an overview of the methods to pinpoint the origin of white marbles and to discuss the progress made in this field during the last years. To pinpoint the place of origin of the marble to an area or even to a special quarry may be of appreciable importance in investigating ancient trading routes and trade relations. A material-specific classification can be conducive to understand if the workshops of an area used marbles of acceptable quality from a local quarry or quarrying areas or if they used imported marbles in or without combination with local ones. Furthermore during restoration activities the knowledge of the origin of the marbles used in architecture may be of importance for supplying more or less original types of marbles. It may also be of interest for evaluating the authenticity of artifact information on the provenance of the used material. The first attempt to discriminate between different marbles used petrographic methods followed by instrumental chemical analyses, especially the analysis of trace elements. In the last decades multi-element neutron activation analysis (NAA) of various trace elements was attempted to pinpoint the origins of marbles. A few decades ago stable isotope analysis seemed to be the solution of this problem and became the standard methods for investigation the origin of white marbles. However, with the rapidly increasing number of historical marble quarrying sites and with the increasing number of analyzed samples in general, the compositional fields in the isotope diagram became larger and many classical marbles show large ranges of overlap. Therefore special attention is drawn to a new method to characterize the chemical properties of microinclusiones of the marbles additional to the conventionally used methods to ascribe their origin to a special quarry or at least to a defined geological formation of a given area. Several case studies will be presented: Different types of marbles were

  13. Three ferritin subunit analogs in Chinese giant salamander (Andrias davidianus) and their response to microbial stimulation.

    PubMed

    You, Xiuling; Sheng, Jianghong; Liu, Liu; Nie, Dongsong; Liao, Zhiyong

    2015-10-01

    Ferritin, an evolutionarily conserved iron-binding protein, plays important roles in iron storage and detoxification and in host immune response to invading stimulus as well. In the present study, we identified three ferritin subunit analog cDNAs from Chinese giant salamander (Andrias davidianus). All the three ferritin subunit cDNAs had a putative iron responsive element in the 5'-untranslated region. Two deduced ferritin subunits (designated as cgsFerH and cgsFerM) had the highest identity of 90% to H type subunit of vertebrate ferritins, while another deduced ferritin subunit (designated as cgsFerL) had the highest identity of 84% to L type subunit of vertebrate ferritins. The Chinese giant salamander ferritin (cgsFer) was widely expressed in various tissues, with highest expression for cgsFerH and cgsFerL in liver and highest expression for cgsFerM in spleen. Infection of Chinese giant salamander with A. davidianus ranavirus showed significant induction of cgsFer expression. Both lipopolysaccharide and iron challenge drastically augmented cgsFer expression in the splenocytes and hepatocytes from Chinese giant salamander. In addition, recombinant cgsFers bound to ferrous iron in a dose-dependent manner, with significant ferroxidase activity. Furthermore, the recombinant cgsFer inhibited the growth of the pathogen Vibrio anguillarum. These results indicated that cgsFer was potential candidate of immune molecules involved in acute phase response to invading microbial pathogens in Chinese giant salamander possibly through its regulatory roles in iron homeostasis. PMID:26319314

  14. The hyal and ventral branchial muscles in caecilian and salamander larvae: homologies and evolution.

    PubMed

    Kleinteich, Thomas; Haas, Alexander

    2011-05-01

    Amphibians (Lissamphibia) are characterized by a bi-phasic life-cycle that comprises an aquatic larval stage and metamorphosis to the adult. The ancestral aquatic feeding behavior of amphibian larvae is suction feeding. The negative pressure that is needed for ingestion of prey is created by depression of the hyobranchial apparatus as a result of hyobranchial muscle action. Understanding the homologies of hyobranchial muscles in amphibian larvae is a crucial step in understanding the evolution of this important character complex. However, the literature mostly focuses on the adult musculature and terms used for hyal and ventral branchial muscles in different amphibians often do not reflect homologies across lissamphibian orders. Here we describe the hyal and ventral branchial musculature in larvae of caecilians (Gymnophiona) and salamanders (Caudata), including juveniles of two permanently aquatic salamander species. Based on previous alternative terminology schemes, we propose a terminology for the hyal and ventral branchial muscles that reflects the homologies of muscles and that is suited for studies on hyobranchial muscle evolution in amphibians. We present a discussion of the hyal and ventral branchial muscles in larvae of the most recent common ancestor of amphibians (i.e. the ground plan of Lissamphibia). Based on our terminology, the hyal and ventral branchial musculature of caecilians and salamanders comprises the following muscles: m. depressor mandibulae, m. depressor mandibulae posterior, m. hyomandibularis, m. branchiohyoideus externus, m. interhyoideus, m. interhyoideus posterior, m. subarcualis rectus I, m. subarcualis obliquus II, m. subarcualis obliquus III, m. subarcualis rectus II-IV, and m. transversus ventralis IV. Except for the m. branchiohyoideus externus, all muscles considered herein can be assigned to the ground plan of the Lissamphibia with certainty. The m. branchiohyoideus externus is either apomorphic for the Batrachia (frogs

  15. Three ferritin subunit analogs in Chinese giant salamander (Andrias davidianus) and their response to microbial stimulation.

    PubMed

    You, Xiuling; Sheng, Jianghong; Liu, Liu; Nie, Dongsong; Liao, Zhiyong

    2015-10-01

    Ferritin, an evolutionarily conserved iron-binding protein, plays important roles in iron storage and detoxification and in host immune response to invading stimulus as well. In the present study, we identified three ferritin subunit analog cDNAs from Chinese giant salamander (Andrias davidianus). All the three ferritin subunit cDNAs had a putative iron responsive element in the 5'-untranslated region. Two deduced ferritin subunits (designated as cgsFerH and cgsFerM) had the highest identity of 90% to H type subunit of vertebrate ferritins, while another deduced ferritin subunit (designated as cgsFerL) had the highest identity of 84% to L type subunit of vertebrate ferritins. The Chinese giant salamander ferritin (cgsFer) was widely expressed in various tissues, with highest expression for cgsFerH and cgsFerL in liver and highest expression for cgsFerM in spleen. Infection of Chinese giant salamander with A. davidianus ranavirus showed significant induction of cgsFer expression. Both lipopolysaccharide and iron challenge drastically augmented cgsFer expression in the splenocytes and hepatocytes from Chinese giant salamander. In addition, recombinant cgsFers bound to ferrous iron in a dose-dependent manner, with significant ferroxidase activity. Furthermore, the recombinant cgsFer inhibited the growth of the pathogen Vibrio anguillarum. These results indicated that cgsFer was potential candidate of immune molecules involved in acute phase response to invading microbial pathogens in Chinese giant salamander possibly through its regulatory roles in iron homeostasis.

  16. Mercury Speciation and Trophic Magnification Slopes in Giant Salamander Larvae from the Pacific Northwest, USA

    NASA Astrophysics Data System (ADS)

    Bank, M. S.; Crocker, J.; Wachtl, J.; Kleeman, P.; Fellers, G.; Currens, C.; Hothem, R.; Madej, M. A.

    2014-12-01

    Mercury (Hg) contamination of stream salamanders in the Pacific Northwest region of the United States has received little attention. Here we report total Hg (HgT) and methyl mercury (MeHg) concentrations in larval giant salamanders (Dicamptodon spp.) and surface water from forested and chaparral lotic ecosystems distributed along a latitudinal gradient throughout Northern California and Washington. To test hypotheses related to potential effects from mining land-use activities, salamander larvae were also sampled from a reference site at Whiskeytown National Recreation Area, California, and at a nearby, upstream site (Shasta county) on Bureau of Land Management land where Hg contamination from gold mining activities has been documented. HgT concentrations in whole body larvae ranged from 4.6 to 74.5 ng/g wet wt. and percent MeHg ranged from 67% to 86%. Both HgT and MeHg larval tissue concentrations were significantly higher at the mining site in comparison to measured background levels (P < 0.001). We conclude that salamander larvae in remote stream ecosystems, where Hg sources were dominated by atmospheric deposition, were generally low in HgT and MeHg and, in comparison, watersheds with a legacy of land-use practices (i.e., mining operations) had approximately 4.5 - 5.5 times the level of HgT bioaccumulation. Moreover, trophic magnification slopes were highest in the Shasta county region where mining was present. These findings suggest that mining activities increase HgT and MeHg exposure to salamander larvae in the region and may present a threat to other higher trophically positioned organisms, and their associated food webs.

  17. Ecological resistance surfaces predict fine-scale genetic differentiation in a terrestrial woodland salamander.

    PubMed

    Peterman, William E; Connette, Grant M; Semlitsch, Raymond D; Eggert, Lori S

    2014-05-01

    Landscape genetics has seen tremendous advances since its introduction, but parameterization and optimization of resistance surfaces still poses significant challenges. Despite increased availability and resolution of spatial data, few studies have integrated empirical data to directly represent ecological processes as genetic resistance surfaces. In our study, we determine the landscape and ecological factors affecting gene flow in the western slimy salamander (Plethodon albagula). We used field data to derive resistance surfaces representing salamander abundance and rate of water loss through combinations of canopy cover, topographic wetness, topographic position, solar exposure and distance from ravine. These ecologically explicit composite surfaces directly represent an ecological process or physiological limitation of our organism. Using generalized linear mixed-effects models, we optimized resistance surfaces using a nonlinear optimization algorithm to minimize model AIC. We found clear support for the resistance surface representing the rate of water loss experienced by adult salamanders in the summer. Resistance was lowest at intermediate levels of water loss and higher when the rate of water loss was predicted to be low or high. This pattern may arise from the compensatory movement behaviour of salamanders through suboptimal habitat, but also reflects the physiological limitations of salamanders and their sensitivity to extreme environmental conditions. Our study demonstrates that composite representations of ecologically explicit processes can provide novel insight and can better explain genetic differentiation than ecologically implicit landscape resistance surfaces. Additionally, our study underscores the fact that spatial estimates of habitat suitability or abundance may not serve as adequate proxies for describing gene flow, as predicted abundance was a poor predictor of genetic differentiation.

  18. Immunological responses and protection in Chinese giant salamander Andrias davidianus immunized with inactivated iridovirus.

    PubMed

    Liu, Wenzhi; Xu, Jin; Ma, Jie; LaPatra, Scott E; Meng, Yan; Fan, Yuding; Zhou, Yong; Yang, Xin; Zeng, Lingbing

    2014-12-01

    Chinese giant salamander hemorrhage is a newly emerged infectious disease in China and has caused huge economic losses. The causative pathogen has been identified as the giant salamander iridovirus (GSIV). In this study, the immunological responses and protection in Chinese giant salamander immunized with β-propiolactone inactivated GSIV are reported. Red and white blood cell counting and classification, phagocytic activity, neutralizing antibody titration, immune-related gene expression and determination of the relative percent survival were evaluated after vaccination. The red and white blood cell counts showed that the numbers of erythrocytes and leukocytes in the peripheral blood of immunized Chinese giant salamanders increased significantly on days 4 and 7 post-injection (P<0.01). Additionally, the differential leukocyte count of monocytes and neutrophils were significantly different compared to the control group (P<0.01); the percentage of lymphocytes was 70.45±7.52% at day 21. The phagocytic percentage and phagocytic index was 38.78±4.33% and 3.75±0.52, respectively, at day 4 post-immunization which were both significantly different compared to the control group (P<0.01). The serum neutralizing antibody titer increased at day 14 post-immunization and reached the highest titer (341±9.52) at day 21. The quantitative PCR analysis revealed that the immunization significantly up-regulated the expression of immune related genes TLR-9 and MyD88 the first two weeks after immunization. The challenge test conducted at day 30 post-injection demonstrated that the immunized group produced a relative survival of 72%. These results indicate that the inactivated GSIV could elicit significant non-specific and specific immunological responses in Chinese giant salamander that resulted in significant protection against GSIV induced disease.

  19. The hyal and ventral branchial muscles in caecilian and salamander larvae: homologies and evolution.

    PubMed

    Kleinteich, Thomas; Haas, Alexander

    2011-05-01

    Amphibians (Lissamphibia) are characterized by a bi-phasic life-cycle that comprises an aquatic larval stage and metamorphosis to the adult. The ancestral aquatic feeding behavior of amphibian larvae is suction feeding. The negative pressure that is needed for ingestion of prey is created by depression of the hyobranchial apparatus as a result of hyobranchial muscle action. Understanding the homologies of hyobranchial muscles in amphibian larvae is a crucial step in understanding the evolution of this important character complex. However, the literature mostly focuses on the adult musculature and terms used for hyal and ventral branchial muscles in different amphibians often do not reflect homologies across lissamphibian orders. Here we describe the hyal and ventral branchial musculature in larvae of caecilians (Gymnophiona) and salamanders (Caudata), including juveniles of two permanently aquatic salamander species. Based on previous alternative terminology schemes, we propose a terminology for the hyal and ventral branchial muscles that reflects the homologies of muscles and that is suited for studies on hyobranchial muscle evolution in amphibians. We present a discussion of the hyal and ventral branchial muscles in larvae of the most recent common ancestor of amphibians (i.e. the ground plan of Lissamphibia). Based on our terminology, the hyal and ventral branchial musculature of caecilians and salamanders comprises the following muscles: m. depressor mandibulae, m. depressor mandibulae posterior, m. hyomandibularis, m. branchiohyoideus externus, m. interhyoideus, m. interhyoideus posterior, m. subarcualis rectus I, m. subarcualis obliquus II, m. subarcualis obliquus III, m. subarcualis rectus II-IV, and m. transversus ventralis IV. Except for the m. branchiohyoideus externus, all muscles considered herein can be assigned to the ground plan of the Lissamphibia with certainty. The m. branchiohyoideus externus is either apomorphic for the Batrachia (frogs

  20. Marbling classification of lambs carcasses with the artificial neural image analysis

    NASA Astrophysics Data System (ADS)

    Przybylak, A.; Ślósarz, P.; Boniecki, P.; Koszela, K.; Przybył, K.; Wojcieszak, D.; Szulc, R.; Ludwiczak, A.; Górna, K.

    2015-07-01

    This paper describes a part of research, whose goal was to develop an effective method to determine marbling classes of lamb carcasses, with the neural image analysis techniques. Current methods for identifying the degree of intramuscular fat level content are time consuming, require specialized expertise and often rely on subjective assessment based on predefined patterns. In this paper, authors proposes the use of neural model developed as a tool to assist evaluation of marbling.

  1. New Data On The Cathodoluminescence Of White Marbles: Interpretation Of Peaks And Relationships To Weathering

    NASA Astrophysics Data System (ADS)

    Garcia-Guinea, J.; Crespo-Feo, E.; Correcher, V.; Iordanidis, A.; Charalampides, G.; Karamitrou-Mentessidi, G.

    This work focus on the Thermoluminescence (TL), the Spatially Resolved Spectral Cathodoluminescence (CL) and Raman spectroscopy (Raman) of white marble specimens collected from the archaeological park of Aiani (Greece) and from patterns of Iceland calcite and Macael marble for comparison purposes. The spectra CL were measured with a high sensitivity cathodoluminescence spectrometer MonoCL3 of Gatan (UK) attached to an FEI-ESEM microscope (CL-ESEM). The experimental set of spectra CL curves of Aiani white marbles suggest that the blue band is more resistant to weathering in comparison with the red band which drops down easily under weathering. The comparison among CL spectra of CaCO3 patterns give a slight difference between the small 330 nm peak, detected in marble and not observed in the monocrystal pattern of Iceland calcite. The Backscattering Electron Dispersed (BSED) images of the white marble are similar to the CL monochromatic plots at 330 nm which highlight the surfaces with remarkable clarity, suggesting a CL emission-defect associated to the marble crystal interfaces, such as protons or hydroxyls. Conversely, the 395 nm monochromatic mapping depicts a CL image emitting from bulk and not from interfaces attributable to point defects or cationic activators in Ca2+ positions. The blue band of the spectra luminescence of marble is composed by several peaks associated to very different types of luminescent defects. This statement is not inconsequential since in archaeological TL dating of marbles the regenerated luminescence in the blue region of the spectrum is a serious difficulty and further research on this topic is necessary.

  2. Lineage divergence and speciation in the Web-toed Salamanders (Plethodontidae: Hydromantes) of the Sierra Nevada, California.

    PubMed

    Rovito, Sean M

    2010-10-01

    Peripatric speciation and the importance of founder effects have long been controversial, and multilocus sequence data and coalescent methods now allow hypotheses of peripatric speciation to be tested in a rigorous manner. Using a multilocus phylogeographical data set for two species of salamanders (genus Hydromantes) from the Sierra Nevada of California, hypotheses of recent divergence by peripatric speciation and older, allopatric divergence were tested. Phylogeographical analysis revealed two divergent lineages within Hydromantes platycephalus, which were estimated to have diverged in the Pliocene. By contrast, a low-elevation species, Hydromantes brunus, diverged from within the northern lineage of H. platycephalus much more recently (mid-Pleistocene), during a time of major climatic change in the Sierra Nevada. Multilocus species tree estimation and coalescent estimates of divergence time, migration rate, and growth rate reject a scenario of ancient speciation of H. brunus with subsequent gene flow and introgression from H. platycephalus, instead supporting a more recent divergence with population expansion. Although the small, peripheral distribution of H. brunus suggests the possibility of peripatric speciation, the estimated founding population size of the species was too large to have allowed founder effects to be important in its divergence. These results provide evidence for both recent speciation, most likely tied to the climatic changes of the Pleistocene, and older lineage divergence, possibly due to geological events, and add to evidence that Pleistocene glacial cycles were an important driver of diversification in the Sierra Nevada.

  3. Development of tailored ceramic microstructures using recycled marble processing residue as pore-former

    NASA Astrophysics Data System (ADS)

    Domopoulou, A.; Spiliotis, X.; Charalampides, G.; Baklavaridis, A.; Papapolymerou, G.; Karayannis, V.

    2016-06-01

    Recycling of marble processing residue is significant since marble processing constitutes an important industrial sector. Therefore, the sustainable management and the valorisation, in an economically profitable manner, of this industrial by-product should be considered. In this work, the potential use of marble residue as pore-former into clayey mixtures for the production of lightweight, porous and thermal insulating ceramics is investigated. Four samples consisting of clayey ceramic body incorporating up to 50 wt.% fine marble residue powder were produced. The final ceramic products were produced upon firing (sintering) at 950oC. Porosity and thermal conductivity measurements were carried out in order to assess the thermal insulating behavior of the produced sintered ceramics. The porosity of the sintered ceramics increases substantially by increasing the marble residue admixture loading. This, in turn, leads to a decrease in thermal conductivity. Consequently, the marble residue can be successfully employed as pore-forming agent, in order to improve the insulating behavior of the ceramic materials.

  4. Proteome Analysis of Bovine Longissimus dorsi Muscle Associated with the Marbling Score

    PubMed Central

    Shen, Y. N.; Kim, S. H.; Yoon, D. H.; Lee, H. G.; Kang, H. S.; Seo, K. S.

    2012-01-01

    The breeding value of marbling score in skeletal muscle is an important factor for evaluating beef quality. In the present study, we investigated proteins associated with the breeding value of the marbling score for bovine sirloin to select potential biomarkers to improve meat quality through comparative proteomic analysis. Proteins isolated from muscle were separated by two-dimensional gel electrophoresis. After analyzing images of the stained gel, seven protein spots for the high marbling score group were identified corresponding to changes in expression that were at least two-fold compared to the low marbling score group. Four spots with increased intensities in the high marbling score group were identified as phosphoglycerate kinase 1, triosephophate isomerase, acidic ribosomal phosphoprotein PO, and capping protein (actin filament) Z-line alpha 2. Spots with decreased intensities in the high marbling score group compared to the low score group were identified as 14-3-3 epsilon, carbonic anhydrase II, and myosin light chain 1. Expression of myosin light chain 1 and carbonic anhydrase 2 was confirmed by Western blotting. Taken together, these data could help improve the economic performance of cattle and provide useful information about the underlying the function of bovine skeletal muscle. PMID:25049666

  5. Switchable Opening and Closing of a Liquid Marble via Ultrasonic Levitation.

    PubMed

    Zang, Duyang; Li, Jun; Chen, Zhen; Zhai, Zhicong; Geng, Xingguo; Binks, Bernard P

    2015-10-27

    Liquid marbles have promising applications in the field of microreactors, where the opening and closing of their surfaces plays a central role. We have levitated liquid water marbles using an acoustic levitator and, thereby, achieved the manipulation of the particle shell in a controlled manner. Upon increasing the sound intensity, the stable levitated liquid marble changes from a quasi-sphere to a flattened ellipsoid. Interestingly, a cavity on the particle shell can be produced on the polar areas, which can be completely healed when decreasing the sound intensity, allowing it to serve as a microreactor. The integral of the acoustic radiation pressure on the part of the particle surface protruding into air is responsible for particle migration from the center of the liquid marble to the edge. Our results demonstrate that the opening and closing of the liquid marble particle shell can be conveniently achieved via acoustic levitation, opening up a new possibility to manipulate liquid marbles coated with non-ferromagnetic particles. PMID:26439701

  6. Simulation and robotics studies of salamander locomotion: applying neurobiological principles to the control of locomotion in robots.

    PubMed

    Ijspeert, Auke Jan; Crespi, Alessandro; Cabelguen, Jean-Marie

    2005-01-01

    This article presents a project that aims at understanding the neural circuitry controlling salamander locomotion, and developing an amphibious salamander-like robot capable of replicating its bimodal locomotion, namely swimming and terrestrial walking. The controllers of the robot are central pattern generator models inspired by the salamander's locomotion control network. The goal of the project is twofold: (1) to use robots as tools for gaining a better understanding of locomotion control in vertebrates and (2) to develop new robot and control technologies for developing agile and adaptive outdoor robots. The article has four parts. We first describe the motivations behind the project. We then present neuromechanical simulation studies of locomotion control in salamanders. This is followed by a description of the current stage of the robotic developments. We conclude the article with a discussion on the usefulness of robots in neuroscience research with a special focus on locomotion control.

  7. Stability relations of Ti-bearing assemblages in UHP marbles from the Kokchetav Massif

    NASA Astrophysics Data System (ADS)

    Kikuchi, M.; Ogasawara, Y.

    2003-12-01

    Stability relations of Ti-bearing phases (rutile, titanite, Ti-clinohumite) in UHP marbles from the Kokchetav Massif, northern Kazakhstan were well analyzed by the phase relations in the model system CaO-MgO-SiO2-TiO2-CO2-H2O. Three types of UHP marbles have been described in the Kumdy-kol area: diamond-bearing dolomite marble (type-A), diamond-free Ti-clinohumite-bearing dolomitic marble (type-B), and diamond-free calcite marble (type-C) (Ogasawara et al., 2000; 2002), and they contain a distinct Ti-bearing phase, rutile, Ti-clinohumite, and titanite, respectively. The characteristics of these three marbles are as in the followings. Type-A: Dominant carbonate is dolomite. Abundant microdiamonds are included in garnet and diopside. Diopside-dolomite tie-line was stable. Diopside contains K-bearing silicate lamellar. The peak assemblage was dolomite + diopside + aragonite + garnet + rutile + diamond. Type-B: High MgCO3-calcite (originally aragonite + dolomite) is distinct. No diamond occurs. Diopside lacks lamellar texture. The peak assemblage was aragonite + dolomite + garnet + Ti-clinohumite or forsterite. Type-C: Only carbonate phase is calcite (originally aragonite). No diamond occurs. Titanite contains coesite exsolution lamellae and indicated supersilicic compositions stable at UHP conditions (P > 6GPa). Diopside contains phengite and K-feldspar lamellae. The peak assemblage was aragonite + diopside + K-feldspar + garnet + titanite. The solid-solid reaction, CaTiSiO5 (titanite) + CaMg(CO3)2 (dolomite) = CaCO3 (aragonite) + CaMgSi2O6 (diopside) + TiO2 (rutile), controlled the stability of Ti-bearing phases in calcite marble and dolomite marble. At UHP conditions, aragonite + diopside + rutile assemblage is stable compared with titanite + dolomite, and divides the compositional space into dolomite-free and dolomite-bearing tetrahedrons in the model system CaO-MgO-SiO2-TiO2. The presence of titanite in calcite marble indicates that the P-T condition was located

  8. Marine Habitat Selection by Marbled Murrelets (Brachyramphus marmoratus) during the Breeding Season

    PubMed Central

    Lorenz, Teresa J.; Raphael, Martin G.; Bloxton, Thomas D.

    2016-01-01

    The marbled murrelet (Brachyramphus marmoratus) is a declining seabird that is well-known for nesting in coastal old-growth forests in the Pacific Northwest. Most studies of habitat selection have focused on modeling terrestrial nesting habitat even though marine habitat is believed to be a major contributor to population declines in some regions. To address this information gap, we conducted a 5-year study of marine resource selection by murrelets in Washington, which contains a population experiencing the steepest documented declines and where marine habitat is believed to be compromised. Across five years we tracked 157 radio-tagged murrelets during the breeding season (May to August), and used discrete choice models to examine habitat selection. Using an information theoretic approach, our global model had the most support, suggesting that murrelet resource selection at-sea is affected by many factors, both terrestrial and marine. Locations with higher amounts of nesting habitat (β = 21.49, P < 0.001) that were closer to shore (β = -0.0007, P < 0.001) and in cool waters (β = -0.2026, P < 0.001) with low footprint (β = -0.0087, P < 0.001) had higher probabilities of use. While past conservation efforts have focused on protecting terrestrial nesting habitat, we echo many past studies calling for future efforts to protect marine habitat for murrelets, as the current emphasis on terrestrial habitat alone may be insufficient for conserving populations. In particular, marine areas in close proximity to old-growth nesting habitat appear important for murrelets during the breeding season and should be priorities for protection. PMID:27681655

  9. First report of a ranavirus associated with morbidity and mortality in farmed Chinese giant salamanders (Andrias davidianus).

    PubMed

    Geng, Y; Wang, K Y; Zhou, Z Y; Li, C W; Wang, J; He, M; Yin, Z Q; Lai, W M

    2011-07-01

    From February to May 2010, an outbreak of disease occurred amongst farmed Chinese giant salamanders (Andrias davidianus) in Hanzhong County, Shanxi Province, China. Clinical signs included anorexia, lethargy, ecchymoses and swollen areas on the head and limbs, and skin ulceration. The aim of this study was to determine the cause of this disease. Necropsy examination revealed subcutaneous and intramuscular oedema, swollen and pale livers with multifocal haemorrhage, swollen kidneys with multifocal haemorrhage and distended fluid-filled intestines with areas of haemorrhage. Light microscopy revealed intracytoplasmic inclusions suggestive of a viral infection in a variety of organs, as well as degeneration and necrosis of these organs. Electron microscopy of ultrathin sections of the same tissues revealed iridovirus-like particles within the inclusions. Of the six specimens tested, all were positive for ranavirus major capsid protein (MCP) gene. Sequence alignments of the ranavirus MCP gene from these specimens showed 95-98% similarity with published ranavirus data. The virus, provisionally designated as Chinese giant salamander virus (CGSV), was isolated from tissue homogenates of diseased salamanders following inoculation of epithelioma papilloma cyprini cells. Sequence analysis of the MCP genes showed that the isolated virus was a ranavirus with marked sequence identity to other members of the genus Ranavirus. Koch's postulates were fulfilled by infecting healthy Chinese giant salamanders with the CGSV. These salamanders all died within 6-8 days. This is the first report of ranavirus infection associated with mass mortality in Chinese giant salamanders.

  10. Abundances of northwestern salamander larvae in montane lakes with and without fish, Mount Rainier National Park, Washington

    USGS Publications Warehouse

    Larson, Gary L.; Hoffman, Robert L.

    2002-01-01

    In Mount Rainier National Park, the northwestern salamander usually inhabits relatively large and deep lakes and ponds (average size = 0.3 ha; average depth > 2 m) that contain flocculent, organic bottom sediments and abundant coarse wood. Prior to 1970, salmonids were introduced into many of the park's lakes and ponds that were typical habitat of the northwestern salamander. The objective of this study was to compare, in lakes and ponds with suitable habitat characteristics for northwestern salamanders, the observed abundances of larvae in takes and ponds with and without these introduced salmonids. Day surveys of 61 lakes were conducted between 1993 and 1999. Fish were limited to takes and ponds deeper than 2 in. For the 48 lakes and ponds deeper than 2 in (i.e., 25 fishless lakes and 23 fish lakes), the mean and median observed abundances of northwestern salamander larvae in fishless lakes and ponds was significantly greater than the mean and median observed abundances of larvae in lakes and ponds with fish. Northwestern salamander larvae were not observed in 11 fish lakes. These lakes were similar in median elevation, surface area, and maximum depth to the fishless lakes. The 12 fish lakes with observed larvae were significantly lower in median elevation, larger in median surface area, and deeper in median maximum depth than the fishless lakes. Low to null observed abundances of northwestern salamander larvae in lakes and ponds with fish were attributed to a combination of fish predation of larvae and changes in larval behavior.

  11. Mineralogical characterization of the Shelburne Marble and the Salem limestone: Test stones used to study the effects of acid rain

    SciTech Connect

    McGee, E.S.

    1989-01-01

    The Salem Limestone and the Shelburne Marble are representative of limestones and marbles commonly used in buildings and monuments. Both stones are composed predominantly of calcite. The Salem Limestone is homogeneous in composition and mineralogic characteristics throughout the test block. The Shelburne Marble has compositionally homogeneous mineral phases, but the distribution of those phases within the test block is random. The mineralogy and physical characteristics of the Shelburne Marble and Salem Limestone test blocks described in the study provide a baseline for future studies of the weathering behavior of these stones. Because the Shelburne M