Science.gov

Sample records for marbled salamander populations

  1. Efficacy of land-cover models in predicting isolation of marbled salamander populations in a fragmented landscape.

    PubMed

    Greenwald, Katherine R; Gibbs, H Lisle; Waite, Thomas A

    2009-10-01

    Amphibians worldwide are facing rapid declines due to habitat loss and fragmentation, disease, and other causes. Where habitat alteration is implicated, there is a need for spatially explicit conservation plans. Models built with geographic information systems (GIS) are frequently used to inform such planning. We explored the potential for using GIS models of functional landscape connectivity as a reliable proxy for genetically derived measures of population isolation. We used genetic assignment tests to characterize isolation of marbled salamander populations and evaluated whether the relative amount of modified habitat around breeding ponds was a reliable indicator of population isolation. Using a resampling analysis, we determined whether certain land-cover variables consistently described population isolation. We randomly drew half the data for model building and tested the performance of the best models on the other half 100 times. Deciduous forest was consistently associated with lower levels of population isolation, whereas salamander populations in regions of agriculture and anthropogenic development were more isolated. Models that included these variables and pond size explained 65-70% of variation in genetically inferred isolation across sites. The resampling analysis confirmed that these habitat variables were consistently good predictors of isolation. Used judiciously, simple GIS models with key land-cover variables can be used to estimate population isolation if field sampling and genetic analysis are not possible.

  2. Temporally adaptive sampling: a case study in rare species survey design with marbled salamanders (Ambystoma opacum).

    PubMed

    Charney, Noah D; Kubel, Jacob E; Eiseman, Charles S

    2015-01-01

    Improving detection rates for elusive species with clumped distributions is often accomplished through adaptive sampling designs. This approach can be extended to include species with temporally variable detection probabilities. By concentrating survey effort in years when the focal species are most abundant or visible, overall detection rates can be improved. This requires either long-term monitoring at a few locations where the species are known to occur or models capable of predicting population trends using climatic and demographic data. For marbled salamanders (Ambystoma opacum) in Massachusetts, we demonstrate that annual variation in detection probability of larvae is regionally correlated. In our data, the difference in survey success between years was far more important than the difference among the three survey methods we employed: diurnal surveys, nocturnal surveys, and dipnet surveys. Based on these data, we simulate future surveys to locate unknown populations under a temporally adaptive sampling framework. In the simulations, when pond dynamics are correlated over the focal region, the temporally adaptive design improved mean survey success by as much as 26% over a non-adaptive sampling design. Employing a temporally adaptive strategy costs very little, is simple, and has the potential to substantially improve the efficient use of scarce conservation funds.

  3. A New Species of Eimeria (Apicomplexa: Eimeriidae) from the marbled salamander, Ambystoma opacum (Caudata: Ambystomatidae), from northern Louisiana.

    PubMed

    McAllister, Chris T; Upton, Steve J

    2008-06-01

    Between December 2002 and June 2004, 10 marbled salamanders, Ambystoma opacum, were examined for coccidian parasites. Salamanders were collected in Bradley (n = 2), Little River (n = 1), Miller (n = 1), and Sevier (n = 1) Counties, Arkansas; Webster Parish, Louisiana (n = 2); and Bowie (n = 1) and Nacogdoches (n = 2) Counties, Texas. Two of 10 (20%) A. opacum from Louisiana harbored an undescribed species of Eimeria. Oocysts of Eimeria trauthi n. sp. were ellipsoidal, 36.6 x 33.1 (33-40 x 29-37) microm, with a thin, single-layered wall; shape index 1.1. Polar granule(s) and micropyle were absent. Oocyst residuum was composed of hundreds of loosely packed homogenous granules of various sizes enclosing a vacuole. Sporocysts were elongate-ellipsoidal, 20.8 x 8.1 (19-22 x 7-9) microm; shape index 2.6. Sporocyst residuum was spherical and composed of a cluster of granules often membrane-bound. This is the first time a coccidium has been reported from an amphibian species in Louisiana and the second time a coccidium has been described from this salamander host. In addition, the following 26 salamanders from various counties in Arkansas, Oklahoma, and Texas were surveyed during the study period and were negative for coccidia: Ambystomatidae, 4 spotted salamanders (Ambystoma maculatum) and 7 mole salamanders (Ambystoma talpoideum); Cryptobranchidae, 4 Ozark hellbenders (Cryptobranchus alleganiensis bishopi); Plethodontidae, 6 spotted dusky salamanders (Desmognathus conanti) and 3 many-ribbed salamanders (Eurycea multiplicata multiplicata); and Salamandridae, 2 central newts (Notophthalmus viridescens louisianensis).

  4. Shifty salamanders: transient trophic polymorphism and cannibalism within natural populations of larval ambystomatid salamanders.

    PubMed

    Jefferson, Dale M; Ferrari, Maud Co; Mathis, Alicia; Hobson, Keith A; Britzke, Eric R; Crane, Adam L; Blaustein, Andrew R; Chivers, Douglas P

    2014-01-01

    Many species of ambystomatid salamanders are dependent upon highly variable temporary wetlands for larval development. High larval densities may prompt the expression of a distinct head morphology that may facilitate cannibalism. However, few studies have characterized structural cannibalism within natural populations of larval salamanders. In this study we used two species of larval salamanders, long-toed (Ambystoma macrodactylum) and ringed salamanders (A. annulatum). Head morphometrics and stable isotopic values of carbon (δ(13)C) and nitrogen (δ(15)N) were used to identify the presence or absence of structural cannibalism. Weather conditions were also analyzed as a potential factor associated with the expression of cannibalistic morphology. Populations of salamander larvae did not consistently exhibit cannibalistic morphologies throughout collection periods. Larval long-toed salamanders exhibited trophic polymorphisms when relatively lower precipitation amounts were observed. Larval ringed salamanders were observed to be cannibalistic but did not exhibit polymorphisms in this study. Structural cannibalism may be transient in both species; however in long-toed salamanders this morphology is necessary for cannibalism. Ringed salamanders can be cannibalistic without morphological adaptations; however the cannibal morph may prolong the viable time period for cannibalism. Additionally, weather conditions may alter pond hydroperiod, subsequently influencing head morphology and cannibalism.

  5. Comparing population size estimators for plethodontid salamanders

    USGS Publications Warehouse

    Bailey, L.L.; Simons, T.R.; Pollock, K.H.

    2004-01-01

    Despite concern over amphibian declines, few studies estimate absolute abundances because of logistic and economic constraints and previously poor estimator performance. Two estimation approaches recommended for amphibian studies are mark-recapture and depletion (or removal) sampling. We compared abundance estimation via various mark-recapture and depletion methods, using data from a three-year study of terrestrial salamanders in Great Smoky Mountains National Park. Our results indicate that short-term closed-population, robust design, and depletion methods estimate surface population of salamanders (i.e., those near the surface and available for capture during a given sampling occasion). In longer duration studies, temporary emigration violates assumptions of both open- and closed-population mark-recapture estimation models. However, if the temporary emigration is completely random, these models should yield unbiased estimates of the total population (superpopulation) of salamanders in the sampled area. We recommend using Pollock's robust design in mark-recapture studies because of its flexibility to incorporate variation in capture probabilities and to estimate temporary emigration probabilities.

  6. Chapter 33: Offshore Population Estimates of Marbled Murrelets in California

    Treesearch

    C. John Ralph; Sherri L. Miller

    1995-01-01

    We devised a method of estimating population size of Marbled Murrelets (Brachyramphus marmoratus) found in California’s offshore waters. The method involves determining the distribution of birds from the shore outward to 6,000 m offshore. Applying this distribution to data from boat surveys, we derived population estimates and estimates of sampling...

  7. The secret life of marbled murrelets: monitoring populations and habitats.

    Treesearch

    Jonathan. Thompson

    2007-01-01

    The marbled murrelet is a small diving seabird that occupies coastal waters from Alaska to central California. Murrelets have a unique nesting strategy that requires them to commute tens of miles inland, where they use large mossy branches on older conifers as platforms to balance their solitary egg. Populations have been declining for decades as the amount of nesting...

  8. Effects of copper exposure on hatching success and early larval survival in marbled salamanders, Ambystoma opacum.

    PubMed

    Soteropoulos, Diana L; Lance, Stacey L; Flynn, R Wesley; Scott, David E

    2014-07-01

    The creation of wetlands, such as urban and industrial ponds, has increased in recent decades, and these wetlands often become enriched in pollutants over time. One metal contaminant trapped in created wetlands is copper (Cu(2+)). Copper concentrations in sediments and overlying water may affect amphibian species that breed in created wetlands. The authors analyzed the Cu concentration in dried sediments from a contaminated wetland and the levels of aqueous Cu released after flooding the sediments with different volumes of water, mimicking low, medium, and high pond-filling events. Eggs and larvae of Ambystoma opacum Gravenhorst, a salamander that lays eggs on the sediments in dry pond beds that hatch on pond-filling, were exposed to a range of Cu concentrations that bracketed potential aqueous Cu levels in created wetlands. Embryo survival varied among clutches, but increased Cu levels did not affect embryo survival. At Cu concentrations of 500 µg/L or greater, however, embryos hatched earlier, and the aquatic larvae died shortly after hatching. Because Cu concentrations in sediments increase over time in created wetlands, even relatively tolerant species such as A. opacum may be affected by Cu levels in the posthatching environment.

  9. Maximizing Sampling Efficiency and Minimizing Uncertainty in Presence/Absence Classification of Rare Salamander Populations

    DTIC Science & Technology

    2008-10-31

    25 Fig. 11. Parallel logging skidder tracks along the periphery of a Fort Stewart pond. ................. 26 Fig... tracks [t]), five ponds at St Marks NMR, three ponds at Apalachicola NF, and one pond at Eglin AFB. Number of larvae captured by individual netters...under sphagnum moss, leaf litter , or dead grass) (Anderson and Williamson 1976). Ambystoma opacum Gravenhorst (marbled salamander), also a fall

  10. Abundance, distribution and population status of Marbled Murrelets in Alaska

    USGS Publications Warehouse

    Piatt, John F.; Naslund, Nancy L.; Ralph, C. John; Hunt, George L.; Raphael, Martin G.; Piatt, John F.

    1995-01-01

    Ship-based surveys conducted throughout Alaska during the 1970's and 1980's, and more recent small boat surveys conducted in the northern Gulf of Alaska, suggest that about 280,000 murrelets reside in Alaska during summer. Most Marbled Murrelets are concentrated offshore of large tracts of coastal coniferous forests in southeast Alaska, Prince William Sound, and the Kodiak Archipelago. About 1-3 percent of murrelets breed wholly outside of forested areas in Alaska, and these presumably all nest on the ground. At sea, murrelets tend to occupy sheltered waters of bays, fiords, and island straits, and often aggregate near large river outflows or tide rips. Small boat surveys of Prince William Sound and Christmas Bird Count trends suggest that Marbled Murrelet populations in Alaska declined by about 50 percent between 1972 and 1992. Population declines may have resulted from cumulative effects of oil pollution, gill netting, logging of old-growth breeding habitat, and natural changes in the marine environment. The Exxon Valdez oil spill killed an estimated 8,400 murrelets in 1989, or about 3 percent of the Alaska population. The toll from chronic pollution is unknown. About 3300 murrelets (89 percent adult) die annually in fishing nets in Alaska - a sustained adult mortality rate of 1.5 percent per annum. The extent or effect on murrelets of logging in Alaska are unknown. While only 7 percent of the old-growth has been harvested in the Tongass National Forest, about 40 percent of the highly productive old-growth in the forest has already been logged. A decline in forage fish populations in the Gulf of Alaska during the last 20 years may account for reduced breeding success and population size of several seabird species, including murrelets. Murrelet populations should be sensitive to small increases in adult mortality from the above factors because production by murrects is low and must therefore be balanced by a low annual adult mortality rate.

  11. Population dynamics and regulation in the cave salamander Speleomantes strinatii.

    PubMed

    Salvidio, Sebastiano

    2007-05-01

    Time series analysis has been used to evaluate the mechanisms regulating population dynamics of mammals and insects, but has been rarely applied to amphibian populations. In this study, the influence of endogenous (density-dependent) and exogenous (density-independent) factors regulating population dynamics of the terrestrial plethodontid salamander Speleomantes strinatii was analysed by means of time series and multiple regression analyses. During the period 1993-2005, S. strinatii population abundance, estimated by a standardised temporary removal method, displayed relatively low fluctuations, and the autocorrelation function (ACF) analysis showed that the time series had a noncyclic structure. The partial rate correlation function (PRCF) indicated that a strong first-order negative feedback dominated the endogenous dynamics. Stepwise multiple regression analysis showed that the only climatic factor influencing population growth rate was the minimum winter temperature. Thus, at least during the study period, endogenous, density-dependent negative feedback was the main factor affecting the growth rate of the salamander population, whereas stochastic environmental variables, such as temperature and rainfall, seemed to play a minor role in regulation. These results stress the importance of considering both exogenous and endogenous factors when analysing amphibian long-term population dynamics.

  12. Population dynamics and regulation in the cave salamander Speleomantes strinatii

    NASA Astrophysics Data System (ADS)

    Salvidio, Sebastiano

    2007-05-01

    Time series analysis has been used to evaluate the mechanisms regulating population dynamics of mammals and insects, but has been rarely applied to amphibian populations. In this study, the influence of endogenous (density-dependent) and exogenous (density-independent) factors regulating population dynamics of the terrestrial plethodontid salamander Speleomantes strinatii was analysed by means of time series and multiple regression analyses. During the period 1993 2005, S. strinatii population abundance, estimated by a standardised temporary removal method, displayed relatively low fluctuations, and the autocorrelation function (ACF) analysis showed that the time series had a noncyclic structure. The partial rate correlation function (PRCF) indicated that a strong first-order negative feedback dominated the endogenous dynamics. Stepwise multiple regression analysis showed that the only climatic factor influencing population growth rate was the minimum winter temperature. Thus, at least during the study period, endogenous, density-dependent negative feedback was the main factor affecting the growth rate of the salamander population, whereas stochastic environmental variables, such as temperature and rainfall, seemed to play a minor role in regulation. These results stress the importance of considering both exogenous and endogenous factors when analysing amphibian long-term population dynamics.

  13. Population genetic structure and conservation of marbled murrelets (Brachyramphus marmoratus)

    USGS Publications Warehouse

    Friesen, Vicki L.; Birt, T.P.; Piatt, J.F.; Golightly, R.T.; Newman, S.H.; Hebert, P.N.; Congdon, B.C.; Gissing, G.

    2005-01-01

    Marbled murrelets (Brachyramphus marmoratus) are coastal seabirds that nest from California to the Aleutian Islands. They are declining and considered threatened in several regions. We compared variation in the mitochondrial control region, four nuclear introns and three microsatellite loci among 194 murrelets from throughout their range except Washington and Oregon. Significant population genetic structure was found: nine private control region haplotypes and three private intron alleles occurred at high frequency in the Aleutians and California; global estimates of FST or ??ST and most pairwise estimates involving the Aleutians and/or California were significant; and marked isolation-by-distance was found. Given the available samples, murrelets appear to comprise five genetic management units: (1) western Aleutian Islands, (2) central Aleutian Islands, (3) mainland Alaska and British Columbia, (4) northern California, and (5) central California.

  14. Estimation of stream salamander (Plethodontidae, Desmognathinae and Plethodontinae) populations in Shenandoah National Park, Virginia, USA

    USGS Publications Warehouse

    Jung, R.E.; Royle, J. Andrew; Sauer, J.R.; Addison, C.; Rau, R.D.; Shirk, J.L.; Whissel, J.C.

    2005-01-01

    Stream salamanders in the family Plethodontidae constitute a large biomass in and near headwater streams in the eastern United States and are promising indicators of stream ecosystem health. Many studies of stream salamanders have relied on population indices based on counts rather than population estimates based on techniques such as capture-recapture and removal. Application of estimation procedures allows the calculation of detection probabilities (the proportion of total animals present that are detected during a survey) and their associated sampling error, and may be essential for determining salamander population sizes and trends. In 1999, we conducted capture-recapture and removal population estimation methods for Desmognathus salamanders at six streams in Shenandoah National Park, Virginia, USA. Removal sampling appeared more efficient and detection probabilities from removal data were higher than those from capture-recapture. During 2001-2004, we used removal estimation at eight streams in the park to assess the usefulness of this technique for long-term monitoring of stream salamanders. Removal detection probabilities ranged from 0.39 to 0.96 for Desmognathus, 0.27 to 0.89 for Eurycea and 0.27 to 0.75 for northern spring (Gyrinophilus porphyriticus) and northern red (Pseudotriton ruber) salamanders across stream transects. Detection probabilities did not differ across years for Desmognathus and Eurycea, but did differ among streams for Desmognathus. Population estimates of Desmognathus decreased between 2001-2002 and 2003-2004 which may be related to changes in stream flow conditions. Removal-based procedures may be a feasible approach for population estimation of salamanders, but field methods should be designed to meet the assumptions of the sampling procedures. New approaches to estimating stream salamander populations are discussed.

  15. Leaf litter bags as an index to populations of northern two-lined salamanders (Eurycea bislineata)

    USGS Publications Warehouse

    Chalmers, R.J.; Droege, S.

    2002-01-01

    Concern about recent amphibian declines has led to research on amphibian populations, but few statistically tested, standardized methods of counting amphibians exist. We tested whether counts of northern two-lined salamander larvae (Eurycea bislineata) sheltered in leaf litter bags--a relatively new, easily replicable survey technique--had a linear correlation to total number of larvae. Using experimental enclosures placed in streams, we compared number of salamanders found in artificial habitat (leaf litter bags) with total number of salamanders in each enclosure. Low numbers of the animals were found in leaf litter bags, and the relative amount of variation in the index (number of animals in leaf litter bags compared to total number of animals in stream enclosures) was high. The index of salamanders in leaf litter bags was not significantly related to total number of salamanders in enclosures for two-thirds of the replicates or with pooled replicates (P= 0.066). Consequently, we cannot recommend using leaf litter bags to index populations of northern two-lined salamanders.

  16. Three decades of urbanization: Estimating the impact of land-cover change on stream salamander populations

    USGS Publications Warehouse

    Price, S.J.; Dorcas, M.E.; Gallant, A.L.; Klaver, R.W.; Willson, J.D.

    2006-01-01

    Urbanization has become the dominant form of landscape disturbance in parts of the United States. Small streams in the Piedmont region of the eastern United States support high densities of salamanders and are often the first habitats to be affected by landscape-altering factors such as urbanization. We used US Geological Survey land cover data from 1972 to 2000 and a relation between stream salamanders and land cover, established from recent research, to estimate the impact of contemporary land-cover change on the abundance of stream salamanders near Davidson, North Carolina, a Piedmont locale that has experienced rapid urbanization during this time. Our analysis indicates that southern two-lined salamander (Eurycea cirrigera) populations have decreased from 32% to 44% while northern dusky salamanders (Desmognathus fuscus) have decreased from 21% to 30% over the last three decades. Our results suggest that the widespread conversion of forest to urban land in small catchments has likely resulted in a substantial decline of populations of stream salamanders and could have serious effects on stream ecosystems. ?? 2006 Elsevier Ltd. All rights reserved.

  17. Spatial variation in water loss predicts terrestrial salamander distribution and population dynamics.

    PubMed

    Peterman, W E; Semlitsch, R D

    2014-10-01

    Many patterns observed in ecology, such as species richness, life history variation, habitat use, and distribution, have physiological underpinnings. For many ectothermic organisms, temperature relationships shape these patterns, but for terrestrial amphibians, water balance may supersede temperature as the most critical physiologically limiting factor. Many amphibian species have little resistance to water loss, which restricts them to moist microhabitats, and may significantly affect foraging, dispersal, and courtship. Using plaster models as surrogates for terrestrial plethodontid salamanders (Plethodon albagula), we measured water loss under ecologically relevant field conditions to estimate the duration of surface activity time across the landscape. Surface activity time was significantly affected by topography, solar exposure, canopy cover, maximum air temperature, and time since rain. Spatially, surface activity times were highest in ravine habitats and lowest on ridges. Surface activity time was a significant predictor of salamander abundance, as well as a predictor of successful recruitment; the probability of a juvenile salamander occupying an area with high surface activity time was two times greater than an area with limited predicted surface activity. Our results suggest that survival, recruitment, or both are demographic processes that are affected by water loss and the ability of salamanders to be surface-active. Results from our study extend our understanding of plethodontid salamander ecology, emphasize the limitations imposed by their unique physiology, and highlight the importance of water loss to spatial population dynamics. These findings are timely for understanding the effects that fluctuating temperature and moisture conditions predicted for future climates will have on plethodontid salamanders.

  18. Recent population decline of the Marbled Murrelet in the Pacific Northwest

    Treesearch

    Sherri L. Miller; Martin G. Raphael; Gary A. Falxa; Craig Strong; Jim Baldwin; Thomas Bloxton; Beth M. Galleher; Monique Lance; Deanna Lynch; Scott F. Pearson; C. John Ralph; Richard D. Young

    2012-01-01

    We document here a decline of nearly 30% in the Marbled Murrelet (Brachyramphus marmoratus) population of Washington, Oregon, and northern California between 2000 and 2010. The Northwest Forest Plan is an ecosystem-management plan for federal forest lands in the Pacific Northwest of the United States that incorporates monitoring to determine if...

  19. Chapter 37: Population Trends of the Marbled Murrelet Projected From Demographic Analyses

    Treesearch

    Steven B. Beissinger

    1995-01-01

    A demographic model of the Marbled Murrelet is developed to explore likely population trends and factors influencing them. The model was structured to use field data on juvenile ratios, collected near the end of the breeding season and corrected for date of census, to estimate fecundity. Survivorship was estimated for the murrelet based on comparative analyses of...

  20. Salamander limb regeneration involves the activation of a multipotent skeletal muscle satellite cell population.

    PubMed

    Morrison, Jamie I; Lööf, Sara; He, Pingping; Simon, András

    2006-01-30

    In contrast to mammals, salamanders can regenerate complex structures after injury, including entire limbs. A central question is whether the generation of progenitor cells during limb regeneration and mammalian tissue repair occur via separate or overlapping mechanisms. Limb regeneration depends on the formation of a blastema, from which the new appendage develops. Dedifferentiation of stump tissues, such as skeletal muscle, precedes blastema formation, but it was not known whether dedifferentiation involves stem cell activation. We describe a multipotent Pax7+ satellite cell population located within the skeletal muscle of the salamander limb. We demonstrate that skeletal muscle dedifferentiation involves satellite cell activation and that these cells can contribute to new limb tissues. Activation of salamander satellite cells occurs in an analogous manner to how the mammalian myofiber mobilizes stem cells during skeletal muscle tissue repair. Thus, limb regeneration and mammalian tissue repair share common cellular and molecular programs. Our findings also identify satellite cells as potential targets in promoting mammalian blastema formation.

  1. Lagged influence of North Atlantic Oscillation on population dynamics of a Mediterranean terrestrial salamander

    NASA Astrophysics Data System (ADS)

    Salvidio, Sebastiano; Oneto, Fabrizio; Ottonello, Dario; Pastorino, Mauro V.

    2016-04-01

    The North Atlantic Oscillation (NAO) is a large-scale climatic pattern that strongly influences the atmospheric circulation in the northern Hemisphere and by consequence the long-term variability of marine and terrestrial ecosystem over great part of northern Europe and western Mediterranean. In the Mediterranean, the effects of the NAO on vertebrates has been studied mainly on bird populations but was rarely analysed in ectothermic animals, and in particular in amphibians. In this study, we investigated the relationships between winter, spring and summer NAO indexes and the long-term population dynamics of the plethodontid salamander Speleomantes strinatii. This terrestrial salamander was monitored inside an artificial cave in NW Italy for 24 consecutive years. The relationships between seasonal NAO indexes and the salamander dynamics were assessed by cross-correlation function (CCF) analysis, after prewhitening the time series by autoregressive moving average statistical modelling. Results of CCF analyses indicated that the salamander abundance varied in relation to the one-year ahead winter NAO ( P = 0.018), while no relationships were found with spring and summer indexes. These results strengthen some previous findings that suggested a high sensitivity of temperate terrestrial amphibians to wintertime climatic conditions.

  2. Lagged influence of North Atlantic Oscillation on population dynamics of a Mediterranean terrestrial salamander.

    PubMed

    Salvidio, Sebastiano; Oneto, Fabrizio; Ottonello, Dario; Pastorino, Mauro V

    2016-04-01

    The North Atlantic Oscillation (NAO) is a large-scale climatic pattern that strongly influences the atmospheric circulation in the northern Hemisphere and by consequence the long-term variability of marine and terrestrial ecosystem over great part of northern Europe and western Mediterranean. In the Mediterranean, the effects of the NAO on vertebrates has been studied mainly on bird populations but was rarely analysed in ectothermic animals, and in particular in amphibians. In this study, we investigated the relationships between winter, spring and summer NAO indexes and the long-term population dynamics of the plethodontid salamander Speleomantes strinatii. This terrestrial salamander was monitored inside an artificial cave in NW Italy for 24 consecutive years. The relationships between seasonal NAO indexes and the salamander dynamics were assessed by cross-correlation function (CCF) analysis, after prewhitening the time series by autoregressive moving average statistical modelling. Results of CCF analyses indicated that the salamander abundance varied in relation to the one-year ahead winter NAO (P = 0.018), while no relationships were found with spring and summer indexes. These results strengthen some previous findings that suggested a high sensitivity of temperate terrestrial amphibians to wintertime climatic conditions.

  3. Decline of disjunct green salamander (Aneides aeneus) populations in the southern appalachians

    USGS Publications Warehouse

    Corser, J.D.

    2001-01-01

    Coincident with other amphibians around the world Aneides aeneus, a terrestrial plethodontid salamander, suffered a population collapse in a disjunct portion of its range in the mid-late 1970s. Long-term monitoring of seven historical green salamander populations throughout the 1990s showed a 98% decline in relative abundance since 1970. Three out of six populations first discovered in 1991 also crashed in 1996-1997. The synchronized suddenness of the declines, their region-wide impact, and effects on both small and larger populations, suggest the role of a novel agent of mortality beginning in the mid-late 1970s. Acting alone, but more likely in concert, habitat loss, overcollecting, epidemic disease and climate change could account for this region-wide decline.

  4. Fine-scale spatial genetic structure and dispersal among spotted salamander (Ambystoma maculatum) breeding populations.

    PubMed

    Zamudio, Kelly R; Wieczorek, Ania M

    2007-01-01

    We examined fine-scale genetic variation among breeding aggregations of the spotted salamander (Ambystoma maculatum) to quantify dispersal, interpopulation connectivity and population genetic structure. Spotted salamanders rely on temporary ponds or wetlands for aggregate breeding. Adequate breeding sites are relatively isolated from one another and field studies suggest considerable adult site fidelity; therefore, we expected to find population structure and differentiation at small spatial scales. We used microsatellites to estimate population structure and dispersal among 29 breeding aggregations in Tompkins County, New York, USA, an area encompassing 1272 km(2). Bayesian and frequency-based analyses revealed fine-scale genetic structure with two genetically defined demes: the North deme included seven breeding ponds, and the South deme included 13 ponds. Nine ponds showed evidence of admixture between these two genetic pools. Bayesian assignment tests for detection of interpopulation dispersal indicate that immigration among ponds is common within demes, and that certain populations serve as sources of immigrants to neighbouring ponds. Likewise, spatial genetic correlation analyses showed that populations < or = 4.8 km distant from each other show significant genetic correlation that is not evident at higher scales. Within-population levels of relatedness are consistently larger than expected if mating were completely random across ponds, and in the case of a few ponds, within-population processes such as inbreeding or reproductive skew contribute significantly to differentiation from neighbouring ponds. Our data underscore the importance of these within-population processes as a source of genetic diversity across the landscape, despite considerable population connectivity. Our data further suggest that spotted salamander breeding groups behave as metapopulations, with population clusters as functional units, but sufficient migration among demes to allow for

  5. Survey for the pathogenic chytrid fungus Batrachochytrium dendrobatidis in southwestern North Carolina salamander populations.

    PubMed

    Keitzer, S Conor; Goforth, Reuben; Pessier, Allan P; Johnson, April J

    2011-04-01

    Batrachochytrium dendrobatidis is a fungal pathogen responsible for a potentially fatal disease of amphibians. We conducted a survey for B. dendrobatidis in the Appalachian Mountains of southwestern North Carolina, USA, from 10 June to 23 July 23 2009. Ventral skin swabs were collected from plethodontid salamanders (n=278) and real-time PCR was performed to test for the presence of B. dendrobatidis. We found no evidence of B. dendrobatidis, suggesting that B. dendrobatidis is absent or present in such low levels that it was undetected. If B. dendrobatidis was present at the time of our sampling, this survey supports evidence of low prevalence of B. dendrobatidis in North American headwater stream salamander populations.

  6. Comparing population patterns to processes: abundance and survival of a forest salamander following habitat degradation.

    PubMed

    Otto, Clint R V; Roloff, Gary J; Thames, Rachael E

    2014-01-01

    Habitat degradation resulting from anthropogenic activities poses immediate and prolonged threats to biodiversity, particularly among declining amphibians. Many studies infer amphibian response to habitat degradation by correlating patterns in species occupancy or abundance with environmental effects, often without regard to the demographic processes underlying these patterns. We evaluated how retention of vertical green trees (CANOPY) and coarse woody debris (CWD) influenced terrestrial salamander abundance and apparent survival in recently clearcut forests. Estimated abundance of unmarked salamanders was positively related to CANOPY (β Canopy  = 0.21 (0.02-1.19; 95% CI), but not CWD (β CWD  = 0.11 (-0.13-0.35) within 3,600 m2 sites, whereas estimated abundance of unmarked salamanders was not related to CANOPY (β Canopy  = -0.01 (-0.21-0.18) or CWD (β CWD  = -0.02 (-0.23-0.19) for 9 m2 enclosures. In contrast, apparent survival of marked salamanders within our enclosures over 1 month was positively influenced by both CANOPY and CWD retention (β Canopy  = 0.73 (0.27-1.19; 95% CI) and β CWD  = 1.01 (0.53-1.50). Our results indicate that environmental correlates to abundance are scale dependent reflecting habitat selection processes and organism movements after a habitat disturbance event. Our study also provides a cautionary example of how scientific inference is conditional on the response variable(s), and scale(s) of measure chosen by the investigator, which can have important implications for species conservation and management. Our research highlights the need for joint evaluation of population state variables, such as abundance, and population-level process, such as survival, when assessing anthropogenic impacts on forest biodiversity.

  7. Mechanisms of population differentiation in marbled murrelets: historical versus contemporary processes

    USGS Publications Warehouse

    Congdon, B.C.; Piatt, J.F.; Martin, K.; Friesen, V.L.

    2000-01-01

    Mechanisms of population differentiation in highly vagile species such as seabirds are poorly understood. Previous studies of marbled murrelets (Brachyramphus marmoratus; Charadriiformes: Alcidae) found significant population genetic structure, but could not determine whether this structure is due to historical vicariance (e.g., due to Pleistocene glaciers), isolation by distance, drift or selection in peripheral populations, or nesting habitat selection. To discriminate among these possibilities, we analyzed sequence variation in nine nuclear introns from 120 marbled murrelets sampled from British Columbia to the western Aleutian Islands. Mismatch distributions indicated that murrelets underwent at least one population expansion during the Pleistocene and probably are not in genetic equilibrium. Maximum-likelihood analysis of allele frequencies suggested that murrelets from 'mainland' sites (from the Alaskan Peninsula east) are genetically different from those in the Aleutians and that these two lineages diverged prior to the last glaciation. Analyses of molecular variance, as well as estimates of gene flow derived using coalescent theory, indicate that population genetic structure is best explained by peripheral isolation of murrelets in the Aleutian Islands, rather than by selection associated with different nesting habitats. No isolation-by-distance effects could be detected. Our results are consistent with a rapid expansion of murrelets from a single refugium during the early-mid Pleistocene, subsequent isolation and divergence in two or more refugia during the final Pleistocene glacial advance, and secondary contact following retreat of the ice sheets. Population genetic structure now appears to be maintained by distance effects combined with small populations and a highly fragmented habitat in the Aleutian Islands.

  8. Population Structure and Evolution after Speciation of the Hokkaido Salamander (Hynobius retardatus)

    PubMed Central

    Matsunami, Masatoshi; Igawa, Takeshi; Michimae, Hirofumi; Miura, Toru; Nishimura, Kinya

    2016-01-01

    The Hokkaido salamander (Hynobius retardatus) is endemic to Hokkaido Island, Japan, and shows intriguing flexible phenotypic plasticity and regional morphological diversity. However, to date, allozymes and partial mitochondria DNA sequences have provided only an outline of its demographic histories and the pattern of its genetic diversification. To understand the finer details of the population structure of this species and its evolution since speciation, we genotyped five regional populations by using 12 recently developed microsatellite polymorphic markers. We found a clear population structure with low gene flow among the five populations, but a close genetic relationship between the Teshio and Kitami populations. Our demographic analysis suggested that Teshio and Erimo had the largest effective population sizes among the five populations. These findings regarding the population structure and demography of H. retardatus improve our understanding of the faunal phylogeography on Hokkaido Island and also provide fundamental genetic information that will be useful for future studies. PMID:27257807

  9. Elevational differences in trait response to UV-B radiation by long-toed salamander populations.

    PubMed

    Thurman, Lindsey L; Garcia, Tiffany S; Hoffman, Peter D

    2014-07-01

    Amphibian species capable of optimizing trait response to environmental stressors may develop complex strategies for defending against rapid environmental change. Trait responses may differ between populations, particularly if stressor strength varies across spatial or temporal gradients. Ultraviolet-B (UV-B) radiation is one such stressor that poses a significant threat to amphibian species. We examined the ability of long-toed salamanders (Ambystoma macrodactylum) at high- and low-elevation breeding sites to cooperatively employ behavioral and physiological trait responses to mediate UV-B damage. We performed a microhabitat survey to examine differences in oviposition behavior and UV-B conditions among breeding populations at high- (n = 3; >1,500 m) and low-elevation (n = 3; <100 m) sites. We found significant differences in oviposition behavior across populations, with females at high-elevation sites selecting oviposition substrates in UV-B protected microhabitats. We also collected eggs (n = 633) from each of the breeding sites for analysis of photolyase activity, a photoreactivating enzyme that repairs UV-B damage to the DNA, using a photoproduct immunoassay. Our results revealed no significant differences in photolyase activity between long-toed salamander populations at high and low elevations. For high-elevation salamander populations, relatively low physiological repair capabilities in embryos appear to be buffered by extensive behavioral modifications to reduce UV-B exposure and standardize developmental temperatures. This study provides valuable insight into environmental stress responses via the assessment of multiple traits in allowing sensitive species to persist in rapidly changing landscapes.

  10. Population level differences in thermal sensitivity of energy assimilation in terrestrial salamanders.

    PubMed

    Clay, Timothy A; Gifford, Matthew E

    2017-02-01

    Thermal adaptation predicts that thermal sensitivity of physiological traits should be optimized to thermal conditions most frequently experienced. Furthermore, thermodynamic constraints predict that species with higher thermal optima should have higher performance maxima and narrower performance breadths. We tested these predictions by examining the thermal sensitivity of energy assimilation between populations within two species of terrestrial-lungless salamanders, Plethodon albagula and P. montanus. Within P. albagula, we examined populations that were latitudinally separated by >450km. Within P. montanus, we examined populations that were elevationally separated by >900m. Thermal sensitivity of energy assimilation varied substantially between populations of P. albagula separated latitudinally, but did not vary between populations of P. montanus separated elevationally. Specifically, in P. albagula, the lower latitude population had a higher thermal optimum, higher maximal performance, and narrower performance breadth compared to the higher latitude population. Furthermore, across all individuals as thermal optima increased, performance maxima also increased, providing support for the theory that "hotter is better".

  11. Population structure of spotted salamanders (Ambystoma maculatum) in a fragmented landscape.

    PubMed

    Purrenhage, J L; Niewiarowski, P H; Moore, F B-G

    2009-01-01

    Understanding the impacts of landscape-level processes on the population biology of amphibians is critical, especially for species inhabiting anthropogenically modified landscapes. Many pond-breeding amphibians are presumed to exist as metapopulations, but few studies demonstrate the extent and consequences of this metapopulation structure. Gene flow measures may facilitate the construction of more realistic models of population structure than direct measures of migration. This is especially true for species that are cryptic, such as many amphibians. We used eight polymorphic microsatellite loci to determine the genetic population structure of spotted salamanders (Ambystoma maculatum) breeding at 17 ponds in northeastern Ohio, a landscape fragmented by roads, agriculture, urban areas and the Cuyahoga River. Using a variety of analyses (Bayesian clustering, F-statistics, AMOVA) we generated a model of salamander population genetic structure. Our data revealed patterns of genetic connectivity that were not predicted by geographical distances between ponds (no isolation by distance). We also tested for a relationship between population structure and several indices of landscape resistance, but found no effect of potential barriers to dispersal on genetic connectivity. Strong overall connectivity among ponds, despite the hostile habitat matrix, may be facilitated by a network of riparian corridors associated with the Cuyahoga River; however, high gene flow in this system may indicate a general ability to disperse and colonize beyond particular corridors.

  12. Conservation genetics of extremely isolated urban populations of the northern dusky salamander (Desmognathus fuscus) in New York City.

    PubMed

    Munshi-South, Jason; Zak, Yana; Pehek, Ellen

    2013-01-01

    Urbanization is a major cause of amphibian decline. Stream-dwelling plethodontid salamanders are particularly susceptible to urbanization due to declining water quality and hydrological changes, but few studies have examined these taxa in cities. The northern dusky salamander (Desmognathus fuscus) was once common in the New York City metropolitan area, but has substantially declined throughout the region in recent decades. We used five tetranucleotide microsatellite loci to examine population differentiation, genetic variation, and bottlenecks among five remnant urban populations of dusky salamanders in NYC. These genetic measures provide information on isolation, prevalence of inbreeding, long-term prospects for population persistence, and potential for evolutionary responses to future environmental change. All populations were genetically differentiated from each other, and the most isolated populations in Manhattan have maintained very little genetic variation (i.e. <20% heterozygosity). A majority of the populations also exhibited evidence of genetic bottlenecks. These findings contrast with published estimates of high genetic variation within and lack of structure between populations of other desmognathine salamanders sampled over similar or larger spatial scales. Declines in genetic variation likely resulted from population extirpations and the degradation of stream and terrestrial paths for dispersal in NYC. Loss of genetic variability in populations isolated by human development may be an underappreciated cause and/or consequence of the decline of this species in urbanized areas of the northeast USA.

  13. Conservation genetics of extremely isolated urban populations of the northern dusky salamander (Desmognathus fuscus) in New York City

    PubMed Central

    Zak, Yana; Pehek, Ellen

    2013-01-01

    Urbanization is a major cause of amphibian decline. Stream-dwelling plethodontid salamanders are particularly susceptible to urbanization due to declining water quality and hydrological changes, but few studies have examined these taxa in cities. The northern dusky salamander (Desmognathus fuscus) was once common in the New York City metropolitan area, but has substantially declined throughout the region in recent decades. We used five tetranucleotide microsatellite loci to examine population differentiation, genetic variation, and bottlenecks among five remnant urban populations of dusky salamanders in NYC. These genetic measures provide information on isolation, prevalence of inbreeding, long-term prospects for population persistence, and potential for evolutionary responses to future environmental change. All populations were genetically differentiated from each other, and the most isolated populations in Manhattan have maintained very little genetic variation (i.e. <20% heterozygosity). A majority of the populations also exhibited evidence of genetic bottlenecks. These findings contrast with published estimates of high genetic variation within and lack of structure between populations of other desmognathine salamanders sampled over similar or larger spatial scales. Declines in genetic variation likely resulted from population extirpations and the degradation of stream and terrestrial paths for dispersal in NYC. Loss of genetic variability in populations isolated by human development may be an underappreciated cause and/or consequence of the decline of this species in urbanized areas of the northeast USA. PMID:23646283

  14. DEMOGRAPHY AND SPATIAL POPULATION STRUCTURE IN CALIFORNIA TIGER SALAMANDER

    EPA Science Inventory

    Although the causes of many amphibian declines remain mysterious, there is general agreement that human habitat alteration represents the greatest threat to amphibian populations. In January 2000 the US Fish and Wildlife Service proposed listing Santa Barbara County California Ti...

  15. DEMOGRAPHY AND SPATIAL POPULATION STRUCTURE IN CALIFORNIA TIGER SALAMANDER

    EPA Science Inventory

    Although the causes of many amphibian declines remain mysterious, there is general agreement that human habitat alteration represents the greatest threat to amphibian populations. In January 2000 the US Fish and Wildlife Service proposed listing Santa Barbara County California Ti...

  16. Intra-population variability in energy parameters of the salamander Plethodon Cinereus.

    PubMed

    Crump, M L

    1979-01-01

    Mean values of energetic parameters are used in ecosystem studies because only crude estimates are possible when dealing with a large scope. However, when the focus is at the population level, finer resolution is possible and thus potential ontogenetic differences should be examined. Analysis of energetic parameters of a population of terrestrial salamander, Plethodon cinereus, was undertaken in order to determine ontogenetic differences.Digestive efficiency does not differ significantly between age classes, nor is it correlated with energy intake. Adult males and non-gravid females have virtually identical mean efficiencies. Thus it is probably meaningful to calculate energy flow through the population using a mean digestive efficiency value. Percent water content decreases significantly with increasing age whereas percent ash content increases significantly. Thus when estimating energy tied up in standing crop, correction must be applied for ontogenetic differences in water and ash content. Once these corrections have been made, the AFDW-specific energy content is not significantly different between age groups (with the exception of gravid females which is higher). Salamanders accumulate energy in their tissues with increasing age, although immatures are not significantly different from non-gravid adults. Since gravid females have significantly more joules/mg wet weight than other groups, separate energy density values must be calculated for these individuals if a meaningful standing crop energy estimate is to be obtained from wet weight biomass.

  17. The First Estimates of Marbled Cat Pardofelis marmorata Population Density from Bornean Primary and Selectively Logged Forest.

    PubMed

    Hearn, Andrew J; Ross, Joanna; Bernard, Henry; Bakar, Soffian Abu; Hunter, Luke T B; Macdonald, David W

    2016-01-01

    The marbled cat Pardofelis marmorata is a poorly known wild cat that has a broad distribution across much of the Indomalayan ecorealm. This felid is thought to exist at low population densities throughout its range, yet no estimates of its abundance exist, hampering assessment of its conservation status. To investigate the distribution and abundance of marbled cats we conducted intensive, felid-focused camera trap surveys of eight forest areas and two oil palm plantations in Sabah, Malaysian Borneo. Study sites were broadly representative of the range of habitat types and the gradient of anthropogenic disturbance and fragmentation present in contemporary Sabah. We recorded marbled cats from all forest study areas apart from a small, relatively isolated forest patch, although photographic detection frequency varied greatly between areas. No marbled cats were recorded within the plantations, but a single individual was recorded walking along the forest/plantation boundary. We collected sufficient numbers of marbled cat photographic captures at three study areas to permit density estimation based on spatially explicit capture-recapture analyses. Estimates of population density from the primary, lowland Danum Valley Conservation Area and primary upland, Tawau Hills Park, were 19.57 (SD: 8.36) and 7.10 (SD: 1.90) individuals per 100 km2, respectively, and the selectively logged, lowland Tabin Wildlife Reserve yielded an estimated density of 10.45 (SD: 3.38) individuals per 100 km2. The low detection frequencies recorded in our other survey sites and from published studies elsewhere in its range, and the absence of previous density estimates for this felid suggest that our density estimates may be from the higher end of their abundance spectrum. We provide recommendations for future marbled cat survey approaches.

  18. The First Estimates of Marbled Cat Pardofelis marmorata Population Density from Bornean Primary and Selectively Logged Forest

    PubMed Central

    Hearn, Andrew J.; Ross, Joanna; Bernard, Henry; Bakar, Soffian Abu; Hunter, Luke T. B.; Macdonald, David W.

    2016-01-01

    The marbled cat Pardofelis marmorata is a poorly known wild cat that has a broad distribution across much of the Indomalayan ecorealm. This felid is thought to exist at low population densities throughout its range, yet no estimates of its abundance exist, hampering assessment of its conservation status. To investigate the distribution and abundance of marbled cats we conducted intensive, felid-focused camera trap surveys of eight forest areas and two oil palm plantations in Sabah, Malaysian Borneo. Study sites were broadly representative of the range of habitat types and the gradient of anthropogenic disturbance and fragmentation present in contemporary Sabah. We recorded marbled cats from all forest study areas apart from a small, relatively isolated forest patch, although photographic detection frequency varied greatly between areas. No marbled cats were recorded within the plantations, but a single individual was recorded walking along the forest/plantation boundary. We collected sufficient numbers of marbled cat photographic captures at three study areas to permit density estimation based on spatially explicit capture-recapture analyses. Estimates of population density from the primary, lowland Danum Valley Conservation Area and primary upland, Tawau Hills Park, were 19.57 (SD: 8.36) and 7.10 (SD: 1.90) individuals per 100 km2, respectively, and the selectively logged, lowland Tabin Wildlife Reserve yielded an estimated density of 10.45 (SD: 3.38) individuals per 100 km2. The low detection frequencies recorded in our other survey sites and from published studies elsewhere in its range, and the absence of previous density estimates for this felid suggest that our density estimates may be from the higher end of their abundance spectrum. We provide recommendations for future marbled cat survey approaches. PMID:27007219

  19. Northwest Forest Plan—the first 10 years (1994-2003): status and trends of populations and nesting habitat for the marbled murrelet.

    Treesearch

    Mark H. Huff; Martin G. Raphael; Sherri L. Miller; S. Kim Nelson; Jim Baldwin

    2006-01-01

    The Northwest Forest Plan (the Plan) is a large-scale ecosystem management plan for federal land in the Pacific Northwest. Marbled murrelet (Brachyramphus marmoratus) populations and habitat were monitored to evaluate effectiveness of the Plan. The chapters in this volume summarize information on marbled murrelet ecology and present the monitoring...

  20. The Effect of Recurrent Floods on Genetic Composition of Marble Trout Populations

    PubMed Central

    Pujolar, José Martin; Vincenzi, Simone; Zane, Lorenzo; Jesensek, Dusan; De Leo, Giulio A.; Crivelli, Alain J.

    2011-01-01

    A changing global climate can threaten the diversity of species and ecosystems. We explore the consequences of catastrophic disturbances in determining the evolutionary and demographic histories of secluded marble trout populations in Slovenian streams subjected to weather extremes, in particular recurrent flash floods and debris flows causing massive mortalities. Using microsatellite data, a pattern of extreme genetic differentiation was found among populations (global FST of 0.716), which exceeds the highest values reported in freshwater fish. All locations showed low levels of genetic diversity as evidenced by low heterozygosities and a mean of only 2 alleles per locus, with few or no rare alleles. Many loci showed a discontinuous allele distribution, with missing alleles across the allele size range, suggestive of a population contraction. Accordingly, bottleneck episodes were inferred for all samples with a reduction in population size of 3–4 orders of magnitude. The reduced level of genetic diversity observed in all populations implies a strong impact of genetic drift, and suggests that along with limited gene flow, genetic differentiation might have been exacerbated by recurrent mortalities likely caused by flash flood and debris flows. Due to its low evolutionary potential the species might fail to cope with an intensification and altered frequency of flash flood events predicted to occur with climate change. PMID:21931617

  1. The effect of recurrent floods on genetic composition of marble trout populations.

    PubMed

    Pujolar, José Martin; Vincenzi, Simone; Zane, Lorenzo; Jesensek, Dusan; De Leo, Giulio A; Crivelli, Alain J

    2011-01-01

    A changing global climate can threaten the diversity of species and ecosystems. We explore the consequences of catastrophic disturbances in determining the evolutionary and demographic histories of secluded marble trout populations in Slovenian streams subjected to weather extremes, in particular recurrent flash floods and debris flows causing massive mortalities. Using microsatellite data, a pattern of extreme genetic differentiation was found among populations (global F(ST) of 0.716), which exceeds the highest values reported in freshwater fish. All locations showed low levels of genetic diversity as evidenced by low heterozygosities and a mean of only 2 alleles per locus, with few or no rare alleles. Many loci showed a discontinuous allele distribution, with missing alleles across the allele size range, suggestive of a population contraction. Accordingly, bottleneck episodes were inferred for all samples with a reduction in population size of 3-4 orders of magnitude. The reduced level of genetic diversity observed in all populations implies a strong impact of genetic drift, and suggests that along with limited gene flow, genetic differentiation might have been exacerbated by recurrent mortalities likely caused by flash flood and debris flows. Due to its low evolutionary potential the species might fail to cope with an intensification and altered frequency of flash flood events predicted to occur with climate change.

  2. Regional population monitoring of the marbled murrelet: field and analytical methods.

    Treesearch

    Martin G. Raphael; Jim Baldwin; Gary A. Falxa; Mark H. Huff; Monique Lance; Sherri L. Miller; Scott F. Pearson; C. John Ralph; Craig Strong; Chris. Thompson

    2007-01-01

    The marbled murrelet (Brachyramphus marmoratus) ranges from Alaska to California and is listed under the Endangered Species Act as a threatened species in Washington, Oregon, and California. Marbled murrelet recovery depends, in large part, on conservation and restoration of breeding habitat on federally managed lands. A major objective of the...

  3. Population genetic structure of critically endangered salamander (Hynobius amjiensis) in China: recommendations for conservation.

    PubMed

    Yang, J; Chen, C S; Chen, S H; Ding, P; Fan, Z Y; Lu, Y W; Yu, L P; Lin, H D

    2016-06-10

    Amji's salamander (Hynobius amjiensis) is a critically endangered species (IUCN Red List), which is endemic to mainland China. In the present study, five haplotypes were genotyped for the mtDNA cyt b gene in 45 specimens from three populations. Relatively low levels of haplotype diversity (h = 0.524) and nucleotide diversity (π = 0.00532) were detected. Analyses of the phylogenic structure of H. amjiensis showed no evidence of major geographic partitions or substantial barriers to historical gene flow throughout the species' range. Two major phylogenetic haplotype groups were revealed, and were estimated to have diverged about 1.262 million years ago. Mismatch distribution analysis, neutrality tests, and Bayesian skyline plots revealed no evidence of dramatic changes in the effective population size. According to the SAMOVA and STRUCTURE analyses, H. amjiensis should be regarded as two different management units.

  4. Population structure of the salamander Hynobius retardatus inferred from a partial sequence of the mitochondrial DNA control region.

    PubMed

    Azuma, Noriko; Hangui, Jun-ichi; Wakahara, Masami; Michimae, Hirofumi

    2013-01-01

    We investigated population structure of the salamander Hynobius retardatus in Hokkaido, Japan using partial sequences of the mitochondrial DNA control region (490 bp) from 105 individuals. The salamanders were collected from 28 localities representing the entire regional distribution of this species. Twenty different haplotypes distributed across three haplotype groups were identified. Group 1 was widely distributed in central, northern, and eastern Hokkaido, except Erimo; Groups 2 and 3 appeared exclusively in Erimo and southern Hokkaido, respectively. The genetic distance between the three groups was not very large, but the distributions of the groups never overlapped spatially, indicating a hierarchical population structure comprising three regional groups, which was also supported by analysis of molecular variance. The results suggest that the present population structure is affected by current genetic barriers, as well as by historical transitions of climate and landscape.

  5. Ecological connectivity assessment in a strongly structured fire salamander (Salamandra salamandra) population.

    PubMed

    Bani, Luciano; Pisa, Giulia; Luppi, Massimiliano; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Orioli, Valerio

    2015-08-01

    Small populations are more prone to extinction if the dispersal among them is not adequately maintained by ecological connections. The degree of isolation between populations could be evaluated measuring their genetic distance, which depends on the respective geographic (isolation by distance, IBD) and/or ecological (isolation by resistance, IBR) distances. The aim of this study was to assess the ecological connectivity of fire salamander Salamandra salamandra populations by means of a landscape genetic approach. The species lives in broad-leaved forest ecosystems and is particularly affected by fragmentation due to its habitat selectivity and low dispersal capability. We analyzed 477 biological samples collected in 47 sampling locations (SLs) in the mainly continuous populations of the Prealpine and Eastern foothill lowland (PEF) and 10 SLs in the fragmented populations of the Western foothill (WF) lowland of Lombardy (northern Italy). Pairwise genetic distances (Chord distance, DC) were estimated from allele frequencies of 16 microsatellites loci. Ecological distances were calculated using one of the most promising methodology in landscape genetics studies, the circuit theory, applied to habitat suitability maps. We realized two habitat suitability models: one without barriers (EcoD) and a second one accounting for the possible barrier effect of main roads (EcoDb). Mantel tests between distance matrices highlighted how the Log-DC in PEF populations was related to log-transformed geographic distance (confirming a prevalence of IBD), while it was explained by the Log-EcoD, and particularly by the Log-EcoDb, in WF populations, even when accounting for the confounding effect of geographic distance (highlighting a prevalence of IBR). Moreover, we also demonstrated how considering the overall population, the effect of Euclidean or ecological distances on genetic distances acting at the level of a single group (PEF or WF populations) could not be detected, when

  6. Ecological connectivity assessment in a strongly structured fire salamander (Salamandra salamandra) population

    PubMed Central

    Bani, Luciano; Pisa, Giulia; Luppi, Massimiliano; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Orioli, Valerio

    2015-01-01

    Small populations are more prone to extinction if the dispersal among them is not adequately maintained by ecological connections. The degree of isolation between populations could be evaluated measuring their genetic distance, which depends on the respective geographic (isolation by distance, IBD) and/or ecological (isolation by resistance, IBR) distances. The aim of this study was to assess the ecological connectivity of fire salamander Salamandra salamandra populations by means of a landscape genetic approach. The species lives in broad-leaved forest ecosystems and is particularly affected by fragmentation due to its habitat selectivity and low dispersal capability. We analyzed 477 biological samples collected in 47 sampling locations (SLs) in the mainly continuous populations of the Prealpine and Eastern foothill lowland (PEF) and 10 SLs in the fragmented populations of the Western foothill (WF) lowland of Lombardy (northern Italy). Pairwise genetic distances (Chord distance, DC) were estimated from allele frequencies of 16 microsatellites loci. Ecological distances were calculated using one of the most promising methodology in landscape genetics studies, the circuit theory, applied to habitat suitability maps. We realized two habitat suitability models: one without barriers (EcoD) and a second one accounting for the possible barrier effect of main roads (EcoDb). Mantel tests between distance matrices highlighted how the Log-DC in PEF populations was related to log-transformed geographic distance (confirming a prevalence of IBD), while it was explained by the Log-EcoD, and particularly by the Log-EcoDb, in WF populations, even when accounting for the confounding effect of geographic distance (highlighting a prevalence of IBR). Moreover, we also demonstrated how considering the overall population, the effect of Euclidean or ecological distances on genetic distances acting at the level of a single group (PEF or WF populations) could not be detected, when

  7. Effects of structural complexity enhancement on eastern red-backed salamander (Plethodon cinereus) populations in northern hardwood forests

    USGS Publications Warehouse

    McKenny, H.C.; Keeton, W.S.; Donovan, T.M.

    2006-01-01

    Managing for stand structural complexity in northern hardwood forests has been proposed as a method for promoting microhabitat characteristics important to eastern red-backed salamanders (Plethodon cinereus). We evaluated the effects of alternate, structure-based silvicultural systems on red-backed salamander populations at two research sites in northwestern Vermont. Treatments included two uneven-aged approaches (single-tree selection and group-selection) and one unconventional approach, termed "structural complexity enhancement" (SCE), that promotes development of late-successional structure, including elevated levels of coarse woody debris (CWD). Treatments were applied to 2 ha units and were replicated two to four times depending on treatment. We surveyed red-backed salamanders with a natural cover search method of transects nested within vegetation plots 1 year after logging. Abundance estimates corrected for detection probability were calculated from survey data with a binomial mixture model. Abundance estimates differed between study areas and were influenced by forest structural characteristics. Model selection was conducted using Akaike Information Criteria, corrected for over-dispersed data and small sample size (QAICc). We found no difference in abundance as a response to treatment as a whole, suggesting that all of the uneven-aged silvicultural systems evaluated can maintain salamander populations after harvest. However, abundance was tied to specific structural habitat attributes associated with study plots within treatments. The most parsimonious model of habitat covariates included site, relative density of overstory trees, and density of more-decayed and less-decayed downed CWD. Abundance responded positively to the density of downed, well-decayed CWD and negatively to the density of poorly decayed CWD and to overstory relative density. CWD volume was not a strong predictor of salamander abundance. We conclude that structural complexity enhancement

  8. Ancient DNA Assessment of Tiger Salamander Population in Yellowstone National Park

    PubMed Central

    McMenamin, Sarah K.; Hadly, Elizabeth A.

    2012-01-01

    Recent data indicates that blotched tiger salamanders (Ambystoma tigrinum melanostictum) in northern regions of Yellowstone National Park are declining due to climate-related habitat changes. In this study, we used ancient and modern mitochondrial haplotype diversity to model the effective size of this amphibian population through recent geological time and to assess past responses to climatic changes in the region. Using subfossils collected from a cave in northern Yellowstone, we analyzed >700 base pairs of mitochondrial sequence from 16 samples ranging in age from 100 to 3300 years old and found that all shared an identical haplotype. Although mitochondrial diversity was extremely low within the living population, we still were able to detect geographic subdivision within the local area. Using serial coalescent modelling with Bayesian priors from both modern and ancient genetic data we simulated a range of probable population sizes and mutation rates through time. Our simulations suggest that regional mitochondrial diversity has remained relatively constant even through climatic fluctuations of recent millennia. PMID:22427878

  9. Ancient DNA assessment of tiger salamander population in Yellowstone National Park.

    PubMed

    McMenamin, Sarah K; Hadly, Elizabeth A

    2012-01-01

    Recent data indicates that blotched tiger salamanders (Ambystoma tigrinum melanostictum) in northern regions of Yellowstone National Park are declining due to climate-related habitat changes. In this study, we used ancient and modern mitochondrial haplotype diversity to model the effective size of this amphibian population through recent geological time and to assess past responses to climatic changes in the region. Using subfossils collected from a cave in northern Yellowstone, we analyzed >700 base pairs of mitochondrial sequence from 16 samples ranging in age from 100 to 3300 years old and found that all shared an identical haplotype. Although mitochondrial diversity was extremely low within the living population, we still were able to detect geographic subdivision within the local area. Using serial coalescent modelling with Bayesian priors from both modern and ancient genetic data we simulated a range of probable population sizes and mutation rates through time. Our simulations suggest that regional mitochondrial diversity has remained relatively constant even through climatic fluctuations of recent millennia.

  10. Chapter 30: Marbled Murrelet Populations of Washington — Marine Habitat Preferences and Variability of Occurrence

    Treesearch

    Steven M. Speich; Terrence R. Wahl

    1995-01-01

    Marbled Murrelets occur in Puget Sound marine habitats in relatively low numbers. The rates of occurrence of murrelets on censuses within marine habitats is generally low. Further analysis is required to determine if low occurrence rates are a general function of the movement of birds, or their consistent occurrence on particular censuses and not on others. Qualitative...

  11. Evidence of changes in populations of the Marbled Murrelet in the Pacific Northwest

    Treesearch

    C. John Ralph

    1994-01-01

    The Marbled Murrelet (Brachyramphus marmoratus) occurs along the coasts of the North Pacific. It is unique among the Alcidae in its tree nesting habits. Recent research has revealed that in forested areas it is closely associated with old-growth coniferous forests, most of which have been harvested over the past 100 years. All historical accounts,...

  12. Chapter 7: Breeding and Natal Dispersal, Nest Habitat Loss and Implications for Marbled Murrelet Populations

    Treesearch

    George J. Divoky; Michael Horton

    1995-01-01

    Evidence of breeding and natal dispersal in alcids is typically provided by the resightings of banded birds, the establishment of new colonies, and/or evidence of immigration to established colonies. The difficulties in banding, observing, and censusing Marbled Murrelets at nesting areas preclude using any of these methods for this species. Based on the limited number...

  13. Dramatic declines in neotropical salamander populations are an important part of the global amphibian crisis

    PubMed Central

    Rovito, Sean M.; Parra-Olea, Gabriela; Vásquez-Almazán, Carlos R.; Papenfuss, Theodore J.; Wake, David B.

    2009-01-01

    We document major declines of many species of salamanders at several sites in Central America and Mexico, with emphasis on the San Marcos region of Guatemala, one of the best studied and most diverse salamander communities in the Neotropics. Profound declines of several formerly abundant species, including 2 apparent extinctions, are revealed. Terrestrial microhabitat specialists at mid- to high elevations have declined more than microhabitat generalists. These terrestrial microhabitat specialists have largely disappeared from multiple sites in western Guatemala, including in well-protected areas, suggesting that the phenomenon cannot be explained solely by localized habitat destruction. Major declines in southern Mexican plethodontid salamanders occurred in the late 1970s to early 1980s, concurrent with or preceding many reported frog declines. The species in decline comprise several major evolutionary lineages of tropical salamanders, underscoring that significant portions of the phylogenetic diversity of Neotropical salamanders are at risk. Our results highlight the urgent need to document and understand Neotropical salamander declines as part of the larger effort to conserve global amphibian diversity. PMID:19204286

  14. Current and Historical Drivers of Landscape Genetic Structure Differ in Core and Peripheral Salamander Populations

    PubMed Central

    Dudaniec, Rachael Y.; Spear, Stephen F.; Richardson, John S.; Storfer, Andrew

    2012-01-01

    With predicted decreases in genetic diversity and greater genetic differentiation at range peripheries relative to their cores, it can be difficult to distinguish between the roles of current disturbance versus historic processes in shaping contemporary genetic patterns. To address this problem, we test for differences in historic demography and landscape genetic structure of coastal giant salamanders (Dicamptodon tenebrosus) in two core regions (Washington State, United States) versus the species' northern peripheral region (British Columbia, Canada) where the species is listed as threatened. Coalescent-based demographic simulations were consistent with a pattern of post-glacial range expansion, with both ancestral and current estimates of effective population size being much larger within the core region relative to the periphery. However, contrary to predictions of recent human-induced population decline in the less genetically diverse peripheral region, there was no genetic signature of population size change. Effects of current demographic processes on genetic structure were evident using a resistance-based landscape genetics approach. Among core populations, genetic structure was best explained by length of the growing season and isolation by resistance (i.e. a ‘flat’ landscape), but at the periphery, topography (slope and elevation) had the greatest influence on genetic structure. Although reduced genetic variation at the range periphery of D. tenebrosus appears to be largely the result of biogeographical history rather than recent impacts, our analyses suggest that inherent landscape features act to alter dispersal pathways uniquely in different parts of the species' geographic range, with implications for habitat management. PMID:22590604

  15. Northwest Forest Plan—the first 20 years (1994–2013): status and trend of marbled murrelet populations and nesting habitat

    Treesearch

    Gary A. Falxa; Martin G. Raphael

    2016-01-01

    A conservation goal of the Northwest Forest Plan (NWFP) is to stabilize and increase marbled murrelet (Brachyramphus marmoratus) populations by maintaining and increasing nesting habitat. We monitored murrelet populations offshore of the NWFP area from 2000 to 2013 to estimate population size and trend at several spatial scales. At the...

  16. Wispy Marble

    NASA Image and Video Library

    2010-02-12

    Appearing like the swirls of marble, the wispy terrain of Saturn moon Dione is captured by NASA Cassini spacecraft in a dramatic display of light and dark. These wispy features are a system of braided canyons with bright walls.

  17. Chapter 28: Abundance, Distribution, and Population Status of Marbled Murrelets in Alaska

    Treesearch

    John F. Piatt; Nancy L. Naslund

    1995-01-01

    Ship-based surveys conducted throughout Alaska during the 1970’s and 1980’s, and more recent small boat surveys conducted in the northern Gulf of Alaska, suggest that about 280,000 murrelets reside in Alaska during summer. Most Marbled Murrelets are concentrated offshore of large tracts of coastal coniferous forests in southeast Alaska, Prince William Sound, and the...

  18. Estimation of Coast-Wide Population Trends of Marbled Murrelets in Canada Using a Bayesian Hierarchical Model.

    PubMed

    Bertram, Douglas F; Drever, Mark C; McAllister, Murdoch K; Schroeder, Bernard K; Lindsay, David J; Faust, Deborah A

    2015-01-01

    Species at risk with secretive breeding behaviours, low densities, and wide geographic range pose a significant challenge to conservation actions because population trends are difficult to detect. Such is the case with the Marbled Murrelet (Brachyramphus marmoratus), a seabird listed as 'Threatened' by the Species at Risk Act in Canada largely due to the loss of its old growth forest nesting habitat. We report the first estimates of population trend of Marbled Murrelets in Canada derived from a monitoring program that uses marine radar to detect birds as they enter forest watersheds during 923 dawn surveys at 58 radar monitoring stations within the six Marbled Murrelet Conservation Regions on coastal British Columbia, Canada, 1996-2013. Temporal trends in radar counts were analyzed with a hierarchical Bayesian multivariate modeling approach that controlled for variation in tilt of the radar unit and day of year, included year-specific deviations from the overall trend ('year effects'), and allowed for trends to be estimated at three spatial scales. A negative overall trend of -1.6%/yr (95% credibility interval: -3.2%, 0.01%) indicated moderate evidence for a coast-wide decline, although trends varied strongly among the six conservation regions. Negative annual trends were detected in East Vancouver Island (-9%/yr) and South Mainland Coast (-3%/yr) Conservation Regions. Over a quarter of the year effects were significantly different from zero, and the estimated standard deviation in common-shared year effects between sites within each region was about 50% per year. This large common-shared interannual variation in counts may have been caused by regional movements of birds related to changes in marine conditions that affect the availability of prey.

  19. Estimation of Coast-Wide Population Trends of Marbled Murrelets in Canada Using a Bayesian Hierarchical Model

    PubMed Central

    Schroeder, Bernard K.; Lindsay, David J.; Faust, Deborah A.

    2015-01-01

    Species at risk with secretive breeding behaviours, low densities, and wide geographic range pose a significant challenge to conservation actions because population trends are difficult to detect. Such is the case with the Marbled Murrelet (Brachyramphus marmoratus), a seabird listed as ‘Threatened’ by the Species at Risk Act in Canada largely due to the loss of its old growth forest nesting habitat. We report the first estimates of population trend of Marbled Murrelets in Canada derived from a monitoring program that uses marine radar to detect birds as they enter forest watersheds during 923 dawn surveys at 58 radar monitoring stations within the six Marbled Murrelet Conservation Regions on coastal British Columbia, Canada, 1996–2013. Temporal trends in radar counts were analyzed with a hierarchical Bayesian multivariate modeling approach that controlled for variation in tilt of the radar unit and day of year, included year-specific deviations from the overall trend (‘year effects’), and allowed for trends to be estimated at three spatial scales. A negative overall trend of -1.6%/yr (95% credibility interval: -3.2%, 0.01%) indicated moderate evidence for a coast-wide decline, although trends varied strongly among the six conservation regions. Negative annual trends were detected in East Vancouver Island (-9%/yr) and South Mainland Coast (-3%/yr) Conservation Regions. Over a quarter of the year effects were significantly different from zero, and the estimated standard deviation in common-shared year effects between sites within each region was about 50% per year. This large common-shared interannual variation in counts may have been caused by regional movements of birds related to changes in marine conditions that affect the availability of prey. PMID:26258803

  20. Abundance and phenology patterns of two pond-breeding salamanders determine species interactions in natural populations.

    PubMed

    Anderson, Thomas L; Hocking, Daniel J; Conner, Christopher A; Earl, Julia E; Harper, Elizabeth B; Osbourn, Michael S; Peterman, William E; Rittenhouse, Tracy A G; Semlitsch, Raymond D

    2015-03-01

    Phenology often determines the outcome of interspecific interactions, where early-arriving species often dominate interactions over those arriving later. The effects of phenology on species interactions are especially pronounced in aquatic systems, but the evidence is largely derived from experimental studies. We examined whether differences in breeding phenology between two pond-breeding salamanders (Ambystoma annulatum and A. maculatum) affected metamorph recruitment and demographic traits within natural populations, with the expectation that the fall-breeding A. annulatum would negatively affect the spring-breeding A. maculatum. We monitored populations of each species at five ponds over 4 years using drift fences. Metamorph abundance and survival of A. annulatum were affected by intra- and interspecific processes, whereas metamorph size and date of emigration were primarily influenced by intraspecific effects. Metamorph abundance, snout-vent length, date of emigration and survival for A. maculatum were all predicted by combinations of intra- and interspecific effects, but often showed negative relationships with A. annulatum metamorph traits and abundance. Size and date of metamorphosis were strongly correlated within each species, but in opposite patterns (negative for A. annulatum and positive for A. maculatum), suggesting that the two species use alternative strategies to enhance terrestrial survival and that these factors may influence their interactions. Our results match predictions from experimental studies that suggest recruitment is influenced by intra- and interspecific processes which are determined by phenological differences between species. Incorporating spatiotemporal variability when modeling population dynamics is necessary to understand the importance of phenology in species interactions, especially as shifts in phenology occur under climate change.

  1. Detecting a hierarchical genetic population structure: the case study of the Fire Salamander (Salamandra salamandra) in Northern Italy.

    PubMed

    Pisa, Giulia; Orioli, Valerio; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Bani, Luciano

    2015-02-01

    The multistep method here applied in studying the genetic structure of a low dispersal and philopatric species, such as the Fire Salamander Salamandra salamandra, was proved to be effective in identifying the hierarchical structure of populations living in broad-leaved forest ecosystems in Northern Italy. In this study, 477 salamander larvae, collected in 28 sampling populations (SPs) in the Prealpine and in the foothill areas of Northern Italy, were genotyped at 16 specie-specific microsatellites. SPs showed a significant overall genetic variation (Global F ST = 0.032, P < 0.001). The genetic population structure was assessed by using STRUCTURE 2.3.4. We found two main genetic groups, one represented by SPs inhabiting the Prealpine belt, which maintain connections with those of the Eastern foothill lowland (PEF), and a second group with the SPs of the Western foothill lowland (WF). The two groups were significantly distinct with a Global F ST of 0.010 (P < 0.001). While the first group showed a moderate structure, with only one divergent SP (Global F ST = 0.006, P < 0.001), the second group proved more structured being divided in four clusters (Global F ST = 0.017, P = 0.058). This genetic population structure should be due to the large conurbations and main roads that separate the WF group from the Prealpine belt and the Eastern foothill lowland. The adopted methods allowed the analysis of the genetic population structure of Fire Salamander from wide to local scale, identifying different degrees of genetic divergence of their populations derived from forest fragmentation induced by urban and infrastructure sprawl.

  2. Detecting a hierarchical genetic population structure: the case study of the Fire Salamander (Salamandra salamandra) in Northern Italy

    PubMed Central

    Pisa, Giulia; Orioli, Valerio; Spilotros, Giulia; Fabbri, Elena; Randi, Ettore; Bani, Luciano

    2015-01-01

    The multistep method here applied in studying the genetic structure of a low dispersal and philopatric species, such as the Fire Salamander Salamandra salamandra, was proved to be effective in identifying the hierarchical structure of populations living in broad-leaved forest ecosystems in Northern Italy. In this study, 477 salamander larvae, collected in 28 sampling populations (SPs) in the Prealpine and in the foothill areas of Northern Italy, were genotyped at 16 specie-specific microsatellites. SPs showed a significant overall genetic variation (Global FST = 0.032, P < 0.001). The genetic population structure was assessed by using STRUCTURE 2.3.4. We found two main genetic groups, one represented by SPs inhabiting the Prealpine belt, which maintain connections with those of the Eastern foothill lowland (PEF), and a second group with the SPs of the Western foothill lowland (WF). The two groups were significantly distinct with a Global FST of 0.010 (P < 0.001). While the first group showed a moderate structure, with only one divergent SP (Global FST = 0.006, P < 0.001), the second group proved more structured being divided in four clusters (Global FST = 0.017, P = 0.058). This genetic population structure should be due to the large conurbations and main roads that separate the WF group from the Prealpine belt and the Eastern foothill lowland. The adopted methods allowed the analysis of the genetic population structure of Fire Salamander from wide to local scale, identifying different degrees of genetic divergence of their populations derived from forest fragmentation induced by urban and infrastructure sprawl. PMID:25691995

  3. Patch occupancy, number of individuals and population density of the Marbled White in a changing agricultural landscape

    NASA Astrophysics Data System (ADS)

    Lenda, Magdalena; Skórka, Piotr

    2010-09-01

    Metapopulation theory predicts the occurrence of animals in habitat patches. In this paper, we tested predictions based on this theory, including effects of spatial autocorrelation, to describe factors affecting the presence, local number of individuals and density of the Marbled White butterfly Melanargia galathea in habitat patches spread across the agricultural landscape of southern Poland. This agricultural landscape has undergone significant changes in recent decades due to the country's political transformation and is currently characterized by a large proportion of fallow (abandoned) land. We compared 48 occupied habitat patches with 60 unoccupied ones. Positive spatial autocorrelation was found in the number and density of individuals in habitat patches. The probability of patch occupancy was higher for patches that were larger, had a higher proportion of edges, were located closer to the nearest neighbouring local population and to the nearest piece of fallow, contained a smaller area of cut grass, and also had more nectar resources. The number of Marbled Whites in habitat patches was positively related to the patch area, the distance to the nearest fallow and the abundance of nectar resources, but was negatively related to the density of shrubs. The density of individuals was positively related to abundance of flowers, proportion of edge in a patch and distance to the nearest fallow, but it was negatively related to patch area, vegetation height and grass cover. These results indicate that recent land-use changes in agricultural landscapes have had both positive and negative effects on the presence and local number of individuals and density of the Marbled White. These changes affect the metapopulation of the species through changes in habitat quality and landscape connectivity in the area surrounding habitat patches.

  4. Fine-scale population differentiation and gene flow in a terrestrial salamander (Plethodon cinereus) living in continuous habitat.

    PubMed

    Cabe, P R; Page, R B; Hanlon, T J; Aldrich, M E; Connors, L; Marsh, D M

    2007-01-01

    Several recent studies have shown that amphibian populations may exhibit high genetic subdivision in areas with recent fragmentation and urban development. Less is known about the potential for genetic differentiation in continuous habitats. We studied genetic differentiation of red-backed salamanders (Plethodon cinereus) across a 2-km transect through continuous forest in Virginia, USA. Mark-recapture studies suggest very little dispersal for this species, whereas homing experiments and post-Pleistocene range expansion both suggest greater dispersal abilities. We used six microsatellite loci to examine genetic population structure and differentiation between eight subpopulations of red-backed salamanders at distances from 200 m to 2 km. We also used several methods to extrapolate dispersal frequencies and test for sex-biased dispersal. We found small, but detectable differentiation among populations, even at distances as small as 200 m. Differentiation was closely correlated with distance and both Mantel tests and assignment tests were consistent with an isolation-by-distance model for the population. Extrapolations of intergenerational variance in spatial position (sigma(2)<15 m(2)) and pair-wise dispersal frequencies (4 Nm < 25 for plots separated by 300 m) both suggest limited gene flow. Additionally, tests for sex-biased dispersal imply that dispersal frequency is similarly low for both sexes. We suggest that these low levels of gene flow and the infrequent dispersal observed in mark-recapture studies may be reconciled with homing ability and range expansion if dispersing animals rarely succeed in breeding in saturated habitats, if dispersal is flexible depending on the availability of habitat, or if dispersal frequency varies across the geographic range of red-backed salamanders.

  5. Calibrating abundance indices with population size estimators of red back salamanders (Plethodon cinereus) in a New England forest.

    PubMed

    Siddig, Ahmed A; Ellison, Aaron M; Jackson, Scott

    2015-01-01

    Herpetologists and conservation biologists frequently use convenient and cost-effective, but less accurate, abundance indices (e.g., number of individuals collected under artificial cover boards or during natural objects surveys) in lieu of more accurate, but costly and destructive, population size estimators to detect and monitor size, state, and trends of amphibian populations. Although there are advantages and disadvantages to each approach, reliable use of abundance indices requires that they be calibrated with accurate population estimators. Such calibrations, however, are rare. The red back salamander, Plethodon cinereus, is an ecologically useful indicator species of forest dynamics, and accurate calibration of indices of salamander abundance could increase the reliability of abundance indices used in monitoring programs. We calibrated abundance indices derived from surveys of P. cinereus under artificial cover boards or natural objects with a more accurate estimator of their population size in a New England forest. Average densities/m(2) and capture probabilities of P. cinereus under natural objects or cover boards in independent, replicate sites at the Harvard Forest (Petersham, Massachusetts, USA) were similar in stands dominated by Tsuga canadensis (eastern hemlock) and deciduous hardwood species (predominantly Quercus rubra [red oak] and Acer rubrum [red maple]). The abundance index based on salamanders surveyed under natural objects was significantly associated with density estimates of P. cinereus derived from depletion (removal) surveys, but underestimated true density by 50%. In contrast, the abundance index based on cover-board surveys overestimated true density by a factor of 8 and the association between the cover-board index and the density estimates was not statistically significant. We conclude that when calibrated and used appropriately, some abundance indices may provide cost-effective and reliable measures of P. cinereus abundance that

  6. Calibrating abundance indices with population size estimators of red back salamanders (Plethodon cinereus) in a New England forest

    PubMed Central

    Ellison, Aaron M.; Jackson, Scott

    2015-01-01

    Herpetologists and conservation biologists frequently use convenient and cost-effective, but less accurate, abundance indices (e.g., number of individuals collected under artificial cover boards or during natural objects surveys) in lieu of more accurate, but costly and destructive, population size estimators to detect and monitor size, state, and trends of amphibian populations. Although there are advantages and disadvantages to each approach, reliable use of abundance indices requires that they be calibrated with accurate population estimators. Such calibrations, however, are rare. The red back salamander, Plethodon cinereus, is an ecologically useful indicator species of forest dynamics, and accurate calibration of indices of salamander abundance could increase the reliability of abundance indices used in monitoring programs. We calibrated abundance indices derived from surveys of P. cinereus under artificial cover boards or natural objects with a more accurate estimator of their population size in a New England forest. Average densities/m2 and capture probabilities of P. cinereus under natural objects or cover boards in independent, replicate sites at the Harvard Forest (Petersham, Massachusetts, USA) were similar in stands dominated by Tsuga canadensis (eastern hemlock) and deciduous hardwood species (predominantly Quercus rubra [red oak] and Acer rubrum [red maple]). The abundance index based on salamanders surveyed under natural objects was significantly associated with density estimates of P. cinereus derived from depletion (removal) surveys, but underestimated true density by 50%. In contrast, the abundance index based on cover-board surveys overestimated true density by a factor of 8 and the association between the cover-board index and the density estimates was not statistically significant. We conclude that when calibrated and used appropriately, some abundance indices may provide cost-effective and reliable measures of P. cinereus abundance that could

  7. Temporal changes in allele frequencies in a small marble trout Salmo marmoratus population threatened by extreme flood events.

    PubMed

    Pujolar, J M; Vincenzi, S; Zane, L; Crivelli, A J

    2016-03-01

    The effect of extreme floods on the genetic composition of marble trout Salmo marmoratus living in Lipovscek, a tributary of the Soca River in Slovenia, which has been affected by multiple destructive flood events for centuries was investigated. By monitoring genetic variability during the period 2004-2011, apparent signatures of genetic erosion including a decline in observed and expected heterozygosities and allelic richness were observed. Contemporary effective population size was estimated between 11 and 55 individuals, which is congruent with census data. The data suggest asymmetric gene flow between the two sections of the river. The existence of substantial downstream migration (15-19%) was confirmed by paternity analysis. A small (1-3%) upstream migration was also suggested, which was confirmed by tagging data. Overall, low genetic diversity has not prevented the survival of the Lipovscek population, which might be a common feature of salmonid freshwater populations. © 2016 The Fisheries Society of the British Isles.

  8. Genetic structure and diversity in an isolated population of an endemic mole salamander (Ambystoma rivulare Taylor, 1940) of central Mexico.

    PubMed

    Heredia-Bobadilla, Rosa-Laura; Monroy-Vilchis, Octavio; Zarco-González, Martha M; Martínez-Gómez, Daniel; Mendoza-Martínez, Germán David; Sunny, Armando

    2016-12-01

    Human activities are affecting the distribution of species worldwide by causing fragmentation and isolation of populations. Isolation and fragmentation lead to populations with lower genetic variability and an increased chance of inbreeding and genetic drift, which results in a loss of biological fitness over time. Studies of the genetic structure of small and isolated populations are critically important for management and conservation decisions. Ambystoma rivulare is a micro-endemic Mexican mole salamander from central Mexico. It is found in the most ecologically disturbed region in Mexico, the Trans-Mexican Volcanic Belt. The goal of this study of the population genetics of the micro-endemic mole salamander was to provide information to be used as a basis for future research and conservation planning of this species and other species of the Ambystoma genus in Mexico. The structural analysis found two subpopulations, one for each river sampled, with no signs of admixture and very high levels of genetic differentiation. Medium to high levels of heterozygosity and few alleles and genotypes were observed. Evidence of an ancestral genetic bottleneck, low values of effective population size, small inbreeding coefficients, and low gene flow were also found.

  9. Survey for the Pathogenic Chytrid Fungus Batrachochytrium dendrobatidis in Southwestern North Carolina Salamander Populations

    Treesearch

    S. Keitzer; Reuben Goforth; Allan Pessier; April Johnson

    2011-01-01

    Batrachochytrium dendrobatidis is a fungal pathogen responsible for a potentially fatal disease of amphibians. We conducted a survey for B. dendrobatidis in the Appalachian Mountains of southwestern North Carolina, USA, from 10 June to 23 July 23 2009. Ventral skin swabs were collected from plethodontid salamanders (n=278) and real-time PCR was performed to test for...

  10. Newly discovered populations of salamanders from Siskiyou County California represent a species distinct from Plethodon Stormi.

    Treesearch

    Louise S. Mead; David R. Clayton; Richard S. Nauman; Deanna H. Olson; Michael E. Pfrender

    2005-01-01

    Plethodon stormi and Plethodon elongatus are two closely related species of plethodontid salamanders that are restricted to the Klamath Province of northwestern California and southwestern Oregon. Discovery of three localities south of the Klamath River, in the Scott River drainage, not assignable to either P....

  11. Effects of hatching time for larval ambystomatid salamanders

    USGS Publications Warehouse

    Boone, M.D.; Scott, D.E.; Niewiarowski, P.H.

    2002-01-01

    In aquatic communities, the phenology of breeding may influence species interactions. In the early-breeding marbled salamander, Ambystoma opacum, timing of pond filling may determine whether interactions among larvae are competitive or predatory. The objectives of our studies were to determine how time of egg hatching affected size, larval period, and survival to metamorphosis in A. opacum, and if early-hatching in A. opacum influenced the competitive and predator-prey relationships with smaller larvae of the mole salamander, Ambystoma talpoideum. Salamander larvae were reared from hatching through metamorphosis in large, outdoor enclosures located in a natural temporary pond in Aiken County, South Carolina, in two experiments. In study 1, we reared early- and late-hatching A. opacum larvae separately from hatching through metamorphosis. In study 2, we examined how early- versus late-hatching A. opacum affected a syntopic species, A. talpoideum. In general, early-hatching A. opacum were larger and older at metamorphosis, had greater survival, and left the pond earlier than late-hatching larvae. Ambystoma talpoideum reared in the presence of early-hatching A. opacum had lower survival than in controls, suggesting that A. opacum may predate upon A. talpoideum when they gain a growth advantage over later-hatching larvae. Our studies demonstrate that time of pond filling and phenology of breeding may influence population dynamics and alter the nature of relationships that develop among species.

  12. Fine-Scale Habitat Associations of a Terrestrial Salamander: The Role of Environmental Gradients and Implications for Population Dynamics

    PubMed Central

    Peterman, William E.; Semlitsch, Raymond D.

    2013-01-01

    Environmental gradients are instrumental in shaping the distribution and local abundance of species because at the most fundamental level, an organism’s performance is constrained by the environment it inhabits. In topographically complex landscapes, slope, aspect, and vegetative cover interact to affect solar exposure, creating temperature-moisture gradients and unique microclimates. The significance of the interaction of abiotic gradients and biotic factors such as competition, movement, or physiology has long been recognized, but the scale at which these factors vary on the landscape has generally precluded their inclusion in spatial abundance models. We used fine-scale spatial data relating to surface-soil moisture, temperature, and canopy cover to describe the spatial distribution of abundance of a terrestrial salamander, Plethodon albagula, across the landscape. Abundance was greatest in dense-canopy ravine habitats with high moisture and low solar exposure, resulting in a patchy distribution of abundance. We hypothesize that these patterns reflect the physiological constraints of Plethodontid salamanders. Furthermore, demographic cohorts were not uniformly distributed among occupied plots on the landscape. The probability of gravid female occurrence was nearly uniform among occupied plots, but juveniles were much more likely to occur on plots with lower surface temperatures. The disconnect between reproductive effort and recruitment suggests that survival differs across the landscape and that local population dynamics vary spatially. Our study demonstrates a connection between abundance, fine-scale environmental gradients, and population dynamics, providing a foundation for future research concerning movement, population connectivity, and physiology. PMID:23671586

  13. Marbles in Motion.

    ERIC Educational Resources Information Center

    Brown, Helen; Meyers, Bernice; Schmidt, William

    1999-01-01

    Marbles were successfully used to help primary students develop concepts of motion. Marble-unit activities began with shaking and rattling inference bags and predicting by listening just how many marbles were in each bag. Students made qualitative and quantitative observations of the marbles, manipulated marbles with a partner, and observed…

  14. Marbles in Motion.

    ERIC Educational Resources Information Center

    Brown, Helen; Meyers, Bernice; Schmidt, William

    1999-01-01

    Marbles were successfully used to help primary students develop concepts of motion. Marble-unit activities began with shaking and rattling inference bags and predicting by listening just how many marbles were in each bag. Students made qualitative and quantitative observations of the marbles, manipulated marbles with a partner, and observed…

  15. Chapter 32: Distribution and Population Estimates of Marbled Murrelets at Sea in Oregon During the Summers of 1992 and 1993

    Treesearch

    Craig S. Strong; Bradford S. Keitt; William R. McIver; Clifford J. Palmer; Ian Gaffney

    1995-01-01

    We used standardized transect techniques to count Marbled Murrelets and other seabird species at sea from a boat and from a low-flying light aircraft along the length of the Oregon coast. The focus of effort was on vessel surveys of the central Oregon coast. In both years, Marbled Murrelets were most abundant in central Oregon, between Cascade Head and Cape Arago. They...

  16. Reproductive biology of Ambystoma salamanders in the southeastern United States

    USGS Publications Warehouse

    Glorioso, Brad M.; Waddle, J. Hardin; Hefner, Jeromi M.

    2015-01-01

    Reproductive aspects of Ambystoma salamanders were investigated at sites in Louisiana (2010–12) and Mississippi (2013). Three species occurred at the Louisiana site, Spotted Salamander (A. maculatum), Marbled Salamander (A. opacum), and Mole Salamander (A. talpoideum), whereas only Spotted Salamanders were studied at the Mississippi site. A total of 162 and 71 egg masses of Spotted Salamanders were examined at the Louisiana and Mississippi sites, respectively. Significantly more Spotted Salamander eggs per egg mass were observed at the Mississippi site (x̄ = 78.2) than the Louisiana site (x̄ = 53.8; P < 0.001). The mean snout–vent length of female Spotted Salamanders at the Mississippi site (82.9 mm) was significantly larger than the Louisiana site (76.1 mm; P < 0.001). Opaque Spotted Salamander egg masses were not found at the Mississippi site, but accounted for 11% of examined egg masses at the Louisiana site. The mean number of eggs per egg mass at the Louisiana site did not differ between opaque (47.3) and clear (54.6) egg masses (P = 0.21). A total of 47 egg masses of the Mole Salamander were examined, with a mean number of 6.7 embryos per mass. Twenty-three individual nests of the Marbled Salamander were found either under or in decaying logs in the dry pond basins. There was no difference between the mean numbers of eggs per mass of attended nests (93.0) versus those that were discovered unattended (86.6; P = 0.67). Females tended to place their nests at intermediate heights within the pond basin.

  17. Bayesian salamanders: analysing the demography of an underground population of the European plethodontid Speleomantes strinatii with state-space modelling

    PubMed Central

    2010-01-01

    Background It has been suggested that Plethodontid salamanders are excellent candidates for indicating ecosystem health. However, detailed, long-term data sets of their populations are rare, limiting our understanding of the demographic processes underlying their population fluctuations. Here we present a demographic analysis based on a 1996 - 2008 data set on an underground population of Speleomantes strinatii (Aellen) in NW Italy. We utilised a Bayesian state-space approach allowing us to parameterise a stage-structured Lefkovitch model. We used all the available population data from annual temporary removal experiments to provide us with the baseline data on the numbers of juveniles, subadults and adult males and females present at any given time. Results Sampling the posterior chains of the converged state-space model gives us the likelihood distributions of the state-specific demographic rates and the associated uncertainty of these estimates. Analysing the resulting parameterised Lefkovitch matrices shows that the population growth is very close to 1, and that at population equilibrium we expect half of the individuals present to be adults of reproductive age which is what we also observe in the data. Elasticity analysis shows that adult survival is the key determinant for population growth. Conclusion This analysis demonstrates how an understanding of population demography can be gained from structured population data even in a case where following marked individuals over their whole lifespan is not practical. PMID:20122249

  18. Growth, survival, longevity, and population size of the Big Mouth Cave salamander (Gyrinophilus palleucus necturoides) from the type locality in Grundy County, Tennessee, USA

    USGS Publications Warehouse

    Niemiller, Matthew L.; Glorioso, Brad M.; Fenolio, Dante B.; Reynolds, R. Graham; Taylor, Steven J.; Miller, Brian T.

    2016-01-01

    Salamander species that live entirely in subterranean habitats have evolved adaptations that allow them to cope with perpetual darkness and limited energy resources. We conducted a 26-month mark–recapture study to better understand the individual growth and demography of a population of the Big Mouth Cave Salamander (Gyrinophilus palleucus necturoides). We employed a growth model to estimate growth rates, age at sexual maturity, and longevity, and an open population model to estimate population size, density, detectability, and survival rates. Furthermore, we examined cover use and evidence of potential predation. Individuals probably reach sexual maturity in 3–5 years and live at least nine years. Survival rates were generally high (>75%) but declined during the study. More than 30% of captured salamanders had regenerating tails or tail damage, which presumably represent predation attempts by conspecifics or crayfishes. Most salamanders (>90%) were found under cover (e.g., rocks, trash, decaying plant material). Based on 11 surveys during the study, population size estimates ranged from 21 to 104 individuals in the ca. 710 m2 study area. Previous surveys indicated that this population experienced a significant decline from the early 1970s through the 1990s, perhaps related to silvicultural and agricultural practices. However, our data suggest that this population has either recovered or stabilized during the past 20 years. Differences in relative abundance between early surveys and our survey could be associated with differences in survey methods or sampling conditions rather than an increase in population size. Regardless, our study demonstrates that this population is larger than previously thought and is in no immediate risk of extirpation, though it does appear to exhibit higher rates of predation than expected for a species believed to be an apex predator of subterranean food webs.

  19. [Effect of population density on enzymatic activity of antioxidative and phenol oxidase systems of imagoes and nymphs of the marble cockroach Nauphoeta cinerea].

    PubMed

    Murzagulov, G S; Saltykova, E S; Gaĭfullina, L R; Nikolenko, A G

    2013-01-01

    The work deals with effect of density of population on functional activity of components pf protective system of adult individuals and nymphs of the marble cockroach. The resistance of individuals has been noted to decrease both at individual maintenance and under conditions of overpopulation. Changes in activities of enzymes of antioxidative and phenoloxidase systems are studied ion the insect hemolymph and intestine. Possible consequences of isolation and overpopulation are discussed both for stability and for individual development.

  20. Salamander Saver

    ERIC Educational Resources Information Center

    Ilseman, Kelly; Hoffmann, Kristine

    2016-01-01

    On a spring morning in Maine, traps made of nets rise above vernal pools in a small wetland, ready to collect salamanders. The traps were designed by groups of rural and urban high school students from Maine and Massachusetts participating in the University of Maine Upward Bound Math Science Program (UBMS) at the university campus in Orono, Maine.…

  1. Salamander Saver

    ERIC Educational Resources Information Center

    Ilseman, Kelly; Hoffmann, Kristine

    2016-01-01

    On a spring morning in Maine, traps made of nets rise above vernal pools in a small wetland, ready to collect salamanders. The traps were designed by groups of rural and urban high school students from Maine and Massachusetts participating in the University of Maine Upward Bound Math Science Program (UBMS) at the university campus in Orono, Maine.…

  2. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders.

    PubMed

    Ziemba, Julie L; Hickerson, Cari-Ann M; Anthony, Carl D

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from "non-invaded" and "pheretimoid invaded" sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance following Asian

  3. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders

    PubMed Central

    Ziemba, Julie L.

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from “non-invaded” and “pheretimoid invaded” sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance

  4. Metals, Parasites, and Environmental Conditions Affecting Breeding Populations of Spotted Salamanders (Ambystoma maculatum) in Northern Arkansas, USA.

    PubMed

    DeMali, Heather M; Trauth, Stanley E; Bouldin, Jennifer L

    2016-06-01

    The spotted salamander (Ambystoma maculatum) is indigenous to northern Arkansas, and several breeding sites are known to exist in the region. Spotted salamanders (n = 17) were collected and examined for parasites and only three females harbored nematodes (Physaloptera spp.). Chronic aquatic bioassays were conducted using water collected from eight breeding ponds during different hydroperiod events. No lethal or sublethal effects were measured in Ceriodaphnia dubia; however, decreased growth and survival were seen in Pimephales promelas. Aqueous, sediment, and salamander hepatic samples were analyzed for As, Cd, Cu, Pb, and Ni. Metal analysis revealed possible increased metal exposure following precipitation, with greatest metal concentrations measured in sediment samples. Hepatic metal concentrations were similar in parasitized and non-parasitized individuals, and greatest Pb concentrations were measured following normal precipitation events. Determining environmental stressors of amphibians, especially during their breeding and subsequent larval life stage, is imperative to improve species conservation.

  5. Diseases of salamanders

    USGS Publications Warehouse

    Converse, K.A.; Green, D.E.; Majumdar, S.K.; Huffman, J.E.; Brenner, F.J.; Panah, A.I.

    2005-01-01

    Few diseases are reported in salamanders. Two notable exceptions are infections by Ranavirus and Ichthyophonus. Except for mortality events associated with ranaviruses in tiger salamanders (Ambystoma tigrinum) and spotted salamanders (A. maculatum), dieoffs of salamanders are rarely detected or reported. Diseases presented in this chapter are those encountered in free-living salamanders of the United States and Canada. A few additional diseases that are occasionally seen in captive and zoo animals have been reviewed by Green (2001). This chapter on Diseases of Salamanders will address five common infectious diseases of free-living larval and adult salamanders: Ranavirus (iridovims) infection, chytrid fungal infection, ichthyophoniasis, Clinostomum metacercaria, chiggers. Many helminthic parasites infect salamanders, but with few exceptions, these infections are unlikely to cause illness (morbidity) or death (mortality). Readers are referred to parasitology texts for a review of protozoan, helminthic and ectoparasitic organisms of amphibians (Flynn, 1973; Poynton and Whitaker, 2001).

  6. Populations and productivity of seabirds at South Marble Island, Glacier Bay, Alaska, during May-July, 1999

    USGS Publications Warehouse

    Zador, Stephani G.; Piatt, John F.

    1999-01-01

    In the course of directed research on glaucous-winged gulls, we investigated the numbers and activities of all breeding and non-breeding seabirds associated with South Marble Island in Glacier Bay, Alaska, during mid-May to late July, 1999. Most observations were made from the island; additional observations were made during transportation to and from the island. Data were collected on the presence and numbers of all seabirds observed. Detailed information on breeding chronology and productivity were also collected for glaucous-winged gulls (Larus glaucescens), pigeon guillemots (Cepphus columba), black-legged kittiwakes (Rissa tridactyla), and black oystercatchers (Haemantopus bachmani).

  7. Effects of Timber Harvests and Silvicultural Edges on Terrestrial Salamanders

    PubMed Central

    MacNeil, Jami E.; Williams, Rod N.

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m). Small harvests (<4 ha) and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years

  8. Effects of timber harvests and silvicultural edges on terrestrial salamanders.

    PubMed

    MacNeil, Jami E; Williams, Rod N

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m). Small harvests (<4 ha) and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years

  9. Separating Population Structure from Population History: A Cladistic Analysis of the Geographical Distribution of Mitochondrial DNA Haplotypes in the Tiger Salamander, Ambystoma Tigrinum

    PubMed Central

    Templeton, A. R.; Routman, E.; Phillips, C. A.

    1995-01-01

    Nonrandom associations of alleles or haplotypes with geographical location can arise from restricted gene flow, historical events (fragmentation, range expansion, colonization), or any mixture of these factors. In this paper, we show how a nested cladistic analysis of geographical distances can be used to test the null hypothesis of no geographical association of haplotypes, test the hypothesis that significant associations are due to restricted gene flow, and identify patterns of significant association that are due to historical events. In this last case, criteria are given to discriminate among contiguous range expansion, long-distance colonization, and population fragmentation. The ability to make these discriminations depends critically upon an adequate geographical sampling design. These points are illustrated with a worked example: mitochondrial DNA haplotypes in the salamander Ambystoma tigrinum. For this example, prior information exists about restricted gene flow and likely historical events, and the nested cladistic analyses were completely concordant with this prior information. This concordance establishes the plausibility of this nested cladistic approach, but much future work will be necessary to demonstrate robustness and to explore the power and accuracy of this procedure. PMID:7498753

  10. Gas Marbles: Much Stronger than Liquid Marbles

    NASA Astrophysics Data System (ADS)

    Timounay, Yousra; Pitois, Olivier; Rouyer, Florence

    2017-06-01

    Enwrapping liquid droplets with hydrophobic particles allows the manufacture of so-called "liquid marbles" [Aussillous and Quéré Nature (London) 411, 924 (2001); , 10.1038/35082026Mahadevan Nature (London)411, 895 (2001), 10.1038/35082164]. The recent intensive research devoted to liquid marbles is justified by their very unusual physical and chemical properties and by their potential for various applications, from microreactors to water storage, including water pollution sensors [Bormashenko Curr. Opin. Colloid Interface Sci. 16, 266 (2011), 10.1016/j.cocis.2010.12.002]. Here we demonstrate that this concept can be successfully applied for encapsulating and protecting small gas pockets within an air environment. Similarly to their liquid counterparts, those new soft-matter objects, that we call "gas marbles," can sustain external forces. We show that gas marbles are surprisingly tenfold stronger than liquid marbles and, more importantly, they can sustain both positive and negative pressure differences. This magnified strength is shown to originate from the strong cohesive nature of the shell. Those interesting properties could be exploited for imprisoning valuable or polluted gases or for designing new aerated materials.

  11. Marvelous Marbled Underwater Scenes

    ERIC Educational Resources Information Center

    Walkup, Nancy

    2005-01-01

    In an effort to intrigue her fifth graders with a novel and spontaneous approach to line and movement, Nancy Walkup introduced paper marbling as a means to create remarkable decorative surface designs. To marble paper, some kind of pigment, usually oil or acrylic paint, is floated upon the surface of a liquid such as water or liquid starch. In the…

  12. Solid Mathematical Marbling.

    PubMed

    Lu, Shufang; Jin, Xiaogang; Jaffer, Aubrey; Gao, Fei; Mao, Xiaoyang

    2016-05-25

    Years of research have been devoted to computer-generated two-dimensional marbling. However, three-dimensional marbling has yet to be explored. In this paper, we present mathematical marbling of three-dimensional solids which supports a compact random-access vector representation. Our solid marbling textures are created by composing closed-form 3D pattern tool functions. These tool functions are an injection function and five deformation functions. The injection function is used to generate basic patterns, and the deformation functions are responsible for transforming the basic pattern into complex marbling effects. The resulting representation is feature preserving and resolution-independent. Our approach can render high-quality images preserving both the sharp features and the smooth color variations of a solid texture. When implemented on the GPU, our representation enables efficient color evaluation during the real-time solid marbling texture mapping. The color of a point in the volume space is computed by the 3D pattern tool functions from its coordinates. Our method consumes very little memory because only the mathematical functions and their corresponding parameters are stored. In addition, we develop an intuitive user interface and a genetic algorithm to facilitate the solid marbling texture authoring process. We demonstrate the effectiveness of our approach through various solid marbling textures and 3D objects carved from them.

  13. Marvelous Marbled Underwater Scenes

    ERIC Educational Resources Information Center

    Walkup, Nancy

    2005-01-01

    In an effort to intrigue her fifth graders with a novel and spontaneous approach to line and movement, Nancy Walkup introduced paper marbling as a means to create remarkable decorative surface designs. To marble paper, some kind of pigment, usually oil or acrylic paint, is floated upon the surface of a liquid such as water or liquid starch. In the…

  14. Population status of Kittlitz's and Marbled Murrelets and surveys for other marine bird and mammal species in the Kenai Fjords area, Alaska

    USGS Publications Warehouse

    van Pelt, Thomas I.; Piatt, John F.

    2003-01-01

    The Kittlitz's murrelet (Brachyramphus brevirostris) is a rare seabird that nests in alpine terrain and generally forages near tidewater glaciers during the breeding season. More than 95% of the global population breeds in Alaska, with the remainder occurring in the Russian Far East. A global population estimate using best-available data in the early 1990s was 20,000 individuals. However, survey data from two core areas (Prince William Sound and Glacier Bay) suggest that populations have declined by 80-90% during the past 10-20 years. In response to these declines, a coalition of environmental groups petitioned the USFWS in May of 2001 to list the Kittlitz’s murrelet under the Endangered Species Act. In 2002, we began a three-year project to examine population status and trend of Kittlitz’s Murrelets in areas where distribution and abundance are poorly known. Here we report on the first field season, focused on the south coast of the Kenai Peninsula. We re-surveyed selected historical transects to evaluate trends, and surveyed new transects for improved population estimation during early July 2002. From a total of 66 Kittlitz’s Murrelets seen on transects, we estimate a total population of 509 Kittlitz’s Murrelets along the south coast of the Kenai Peninsula. Comparisons with past surveys suggest a decline of 83% since 1976, with an average rate of decline calculated as–6.9 % per annum. This decline is in agreement with population declines observed elsewhere in the species’ core glaciated range, indicating that steep population declines observed to date are likely to be a range-wide phenomenon. While the focus of the study was Kittlitz’s Murrelets, other species of marine birds and mammals were also surveyed. Populations of the closely related Marbled Murrelet appear to have increased during the same time period. The abundance and distribution of other species are presented in appendices.

  15. Plethodontid salamander response to Silvilcultural Practices in Missouri Ozark forests

    Treesearch

    Laura A. Herbeck; David R. Larsen

    1999-01-01

    There is little information on the effects of tree harvest on salamander populations in the midwestern United States. We present data on plethodontid salamander densities in replicated stands of three forest age classes in the southeastern Ozarks of Missouri. Forest age classes consisted of regeneration-cut sites

  16. Tracing the first step to speciation: ecological and genetic differentiation of a salamander population in a small forest.

    PubMed

    Steinfartz, Sebastian; Weitere, Markus; Tautz, Diethard

    2007-11-01

    Mechanisms and processes of ecologically driven adaptive speciation are best studied in natural situations where the splitting process is still occurring, i.e. before complete reproductive isolation is achieved. Here, we present a case of an early stage of adaptive differentiation under sympatric conditions in the fire salamander, Salamandra salamandra, that allows inferring the underlying processes for the split. Larvae of S. salamandra normally mature in small streams until metamorphosis, but in an old, continuous forest area near Bonn (the Kottenforst), we found salamander larvae not only in small streams but also in shallow ponds, which are ecologically very different from small streams. Common-environment experiments with larvae from both habitat types reveal specific adaptations to these different ecological conditions. Mitochondrial and microsatellite analyses show that the two ecologically differentiated groups also show signs of genetic differentiation. A parallel analysis of animals from a neighbouring much larger forest area (the Eifel), in which larvae mature only in streams, shows no signs of genetic differentiation, indicating that gene flow between ecologically similar types can occur over large distances. Hence, geographical factors cannot explain the differential larval habitat adaptations in the Kottenforst, in particular since adult life and mating of S. salamandra is strictly terrestrial and not associated with larval habitats. We propose therefore that the evolution of these adaptations was coupled with the evolution of cues for assortative mating which would be in line with models of sympatric speciation that suggest a co-evolution of habitat adaptations and associated mating signals.

  17. Efficacy of riparian buffers in mitigating local populations declines and the effects of even-aged timber harvest on larval salamanders

    Treesearch

    William E Peterman; Raymond D. Semlitch

    2009-01-01

    Headwater streams are an important and prevalent feature of the eastern North American landscape.These streams provide a wealth of ecosystem services and support tremendous biological diversity, which is predominated by salamanders in the Appalachian region. Salamanders are ubiquitous throughout the region, contributing a significant...

  18. Northwestern salamanders Ambystoma gracile in mountain lakes: record oviposition depths among salamanders

    USGS Publications Warehouse

    Hoffman, R.; Pearl, C.A.; Larson, G.L.; Samora, B.

    2012-01-01

    Oviposition timing, behaviors, and microhabitats of ambystomatid salamanders vary considerably (Egan and Paton 2004; Figiel and Semlitsch 1995; Howard and Wallace 1985; Mac-Cracken 2007). Regardless of species, however, females typically oviposit using sites conducive to embryo development and survival. For example, the results of an experiment by Figiel and Semlitsch (1995) on Ambystoma opacum (Marbled Salamander) oviposition indicated that females actively selected sites that were under grass clumps in wet versus dry treatments, and surmised that environmental conditions such as humidity, moisture, and temperature contributed to their results. Other factors associated with ambystomatid oviposition and embryo survival include water temperature (Anderson 1972; Brown 1976), dissolved oxygen concentration (Petranka et al. 1982; Sacerdote and King 2009), oviposition depth (Dougherty et al. 2005; Egan and Paton 2004), and oviposition attachment structures such as woody vegetation (McCracken 2007; Nussbaum et al. 1983). Resetarits (1996), in creating a model of oviposition site selection for anuran amphibians, hypothesized that oviparous organisms were also capable of modifying oviposition behavior and site selection to accommodate varying habitat conditions and to minimize potential negative effects of environmental stressors. Kats and Sih (1992), investigating the oviposition of Ambystoma barbouri (Streamside Salamander) in pools of a Kentucky stream, found that females preferred pools without predatory Lepomis cyanellus (Green Sunfish), and that the number of egg masses present in a pool historically containing fish increased significantly the year after fish had been extirpated from the pool. Palen et al. (2005) determined that Ambystoma gracile (Northwestern Salamander) and Ambystoma macrodactylum (Longtoed Salamander) eggs were deposited either at increased depth or in full shaded habitats, respectively, as water transperancy to UV-B radiation increased.

  19. Informing recovery in a human-transformed landscape: Drought-mediated coexistence alters population trends of an imperiled salamander and invasive predators

    USGS Publications Warehouse

    Hossack, Blake R.; Honeycutt, Richard; Sigafus, Brent H.; Muths, Erin L.; Crawford, Catherine L.; Jones, Thomas R.; Sorensen, Jeff A.; Rorabaugh, James C.; Chambert, Thierry

    2017-01-01

    Understanding the additive or interactive threats of habitat transformation and invasive species is critical for conservation, especially where climate change is expected to increase the severity or frequency of drought. In the arid southwestern USA, this combination of stressors has caused widespread declines of native aquatic and semi-aquatic species. Achieving resilience to drought and other effects of climate change may depend upon continued management, so understanding the combined effects of stressors is important. We used Bayesian hierarchical models fitted with 10-years of pond-based monitoring surveys for the federally-endangered Sonoran Tiger Salamander (Ambystoma mavortium stebbinsi) and invasive predators (fishes and American Bullfrogs, Lithobates catesbeianus) that threaten native species. We estimated trends in occupancy of salamanders and invasive predators while accounting for hydrological dynamics of ponds, then used a two-species interaction model to directly estimate how invasive predators affected salamander occupancy. We also tested a conceptual model that predicted that drought, by limiting the distribution of invasive predators, could ultimately benefit native species. Even though occupancy of invasive predators was stationary and their presence in a pond reduced the probability of salamander presence by 23%, occupancy of Sonoran Tiger Salamanders increased, annually, by 2.2%. Occupancy of salamanders and invasive predators both declined dramatically following the 5th consecutive year of drought. Salamander occupancy recovered quickly after return to non-drought conditions, while occupancy of invasive predators remained suppressed. Models that incorporated three time-lagged periods (1 to 4 years) of local moisture conditions confirmed that salamanders and invasive predators responded differently to drought, reflecting how life-history strategies shape responses to disturbances. The positive 10-year trend in salamander occupancy and their

  20. A test of the central-marginal hypothesis using population genetics and ecological niche modelling in an endemic salamander (Ambystoma barbouri).

    PubMed

    Micheletti, Steven J; Storfer, Andrew

    2015-03-01

    The central-marginal hypothesis (CMH) predicts that population size, genetic diversity and genetic connectivity are highest at the core and decrease near the edges of species' geographic distributions. We provide a test of the CMH using three replicated core-to-edge transects that encompass nearly the entire geographic range of the endemic streamside salamander (Ambystoma barbouri). We confirmed that the mapped core of the distribution was the most suitable habitat using ecological niche modelling (ENM) and via genetic estimates of effective population sizes. As predicted by the CMH, we found statistical support for decreased genetic diversity, effective population size and genetic connectivity from core to edge in western and northern transects, yet not along a southern transect. Based on our niche model, habitat suitability is lower towards the southern range edge, presumably leading to conflicting core-to-edge genetic patterns. These results suggest that multiple processes may influence a species' distribution based on the heterogeneity of habitat across a species' range and that replicated sampling may be needed to accurately test the CMH. Our work also emphasizes the importance of identifying the geographic range core with methods other than using the Euclidean centre on a map, which may help to explain discrepancies among other empirical tests of the CMH. Assessing core-to-edge population genetic patterns across an entire species' range accompanied with ENM can inform our general understanding of the mechanisms leading to species' geographic range limits.

  1. Marbling on a Budget.

    ERIC Educational Resources Information Center

    Gruber, Donald

    2001-01-01

    Provides historical information on the art technique called marbling. Includes floating paints on water and transferring the patterns formed in the water to paper. Discusses how teachers can teach this technique with materials that fit their budgets. Describes the process in detail. (CMK)

  2. Deterioration of marble structures

    SciTech Connect

    Cheng, R.J.; Hwu, H.R.; Kim, J.T.; Leu, S.M.

    1987-01-15

    The accelerated destruction of marble objects has focused attention on how the damage occurs and on the role of acid rain. Roger Cheng of the State University of New York and colleagues at the Johns Hopkins University describe their efforts to elucidate the process.

  3. From species divergence to population structure: a multimarker approach on the most basal lineage of Salamandridae, the spectacled salamanders (genus Salamandrina) from Italy.

    PubMed

    Hauswaldt, J Susanne; Angelini, Claudio; Gehara, Marcelo; Benavides, Edgar; Polok, Andy; Steinfartz, Sebastian

    2014-01-01

    The Apennine Peninsula is one of Europe's main glacial refugial areas and harbors a large number of lineages and species. Here, a pattern of higher genetic diversity in the south compared to that of the north is characteristic of most vertebrates; however, most studies that have produced these results have relied only on inferences based on mitochondrial DNA. The spectacled salamanders (genus Salamandrina) are endemic to the Apennine Peninsula and have diverged into two sibling species: S. terdigitata (in the south) and S. perspicillata (in the north), presumably in the late Miocene or early Pliocene. By sequencing one mitochondrial (cytb) and two nuclear genes (RAG1 and POMC) and genotyping 10 microsatellite loci, we traced the evolution of these sibling species from their divergence to their contemporary population structure at a fine scale. Using a multilocus coalescent-based approach, we estimated the temporal divergence of both species at approximately 2.25 mya (million years ago), which, hence, is much younger than previous estimates. The classical pattern of high genetic diversity in the south and lower diversity in the north was confirmed only for some markers, and the demographic histories of the two species differed substantially. Whereas S. perspicillata (north) expanded from a single major refugium in the center of the Apennine Peninsula, populations of S. terdigitata (south) persisted through cooler periods in multiple refugia. Further, the fine-scale population genetic structure of 16 S. perspicillata populations revealed significant genetic differentiation, even across short geographic distances. The results of our study stress that for a better understanding of phylogeographic patterns and past demographic processes, both mitochondrial and multiple nuclear loci should be analyzed to avoid gene-specific, and possibly biased results.

  4. Molecular Phylogeography and Population Genetic Structure of an Endangered Species Pachyhynobius shangchengensis (hynobiid Salamander) in a Fragmented Habitat of Southeastern China

    PubMed Central

    Zhao, Yanyu; Zhang, Yanhua; Li, Xiaochen

    2013-01-01

    The salamander Pachyhynobius shangchengensis (Hynobiidae) is a vulnerable species restricted to a patchy distribution associated with small mountain streams surrounded by forested slopes in the Mount Dabieshan region in southeastern China. However, molecular phylogeography and population genetic structure of P. shangchengensis remain poorly investigated. In this study, we explored the genetic structure and phylogeography of P. shangchengensis based on partial sequences of the mitochondrial DNA (mtDNA) cytochrome b and cytochrome c oxidase subunit I genes. Fifty-one haplotypes and four clades were found among 93 samples. Phylogenetic analyses revealed four deeply divergent and reciprocally monophyletic mtDNA lineages that approximately correspond to four geographic regions separated by complicated topography and long distances. The distinct geographic distributions of all lineages and the estimated divergence time suggest spatial and temporal separation coinciding with climatic changes during the Pleistocene. Analysis of molecular variance indicated that most of the observed genetic variation occurred among the four groups, implying long-term interruption of gene flow, and the possible separation of P. shangchengensis into four management units for conservation. PMID:24205092

  5. Molecular phylogeography and population genetic structure of an endangered species Pachyhynobius shangchengensis (hynobiid Salamander) in a fragmented habitat of southeastern China.

    PubMed

    Zhao, Yanyu; Zhang, Yanhua; Li, Xiaochen

    2013-01-01

    The salamander Pachyhynobius shangchengensis (Hynobiidae) is a vulnerable species restricted to a patchy distribution associated with small mountain streams surrounded by forested slopes in the Mount Dabieshan region in southeastern China. However, molecular phylogeography and population genetic structure of P. shangchengensis remain poorly investigated. In this study, we explored the genetic structure and phylogeography of P. shangchengensis based on partial sequences of the mitochondrial DNA (mtDNA) cytochrome b and cytochrome c oxidase subunit I genes. Fifty-one haplotypes and four clades were found among 93 samples. Phylogenetic analyses revealed four deeply divergent and reciprocally monophyletic mtDNA lineages that approximately correspond to four geographic regions separated by complicated topography and long distances. The distinct geographic distributions of all lineages and the estimated divergence time suggest spatial and temporal separation coinciding with climatic changes during the Pleistocene. Analysis of molecular variance indicated that most of the observed genetic variation occurred among the four groups, implying long-term interruption of gene flow, and the possible separation of P. shangchengensis into four management units for conservation.

  6. Ancestry of unisexual salamanders.

    PubMed

    Hedges, S B; Bogart, J P; Maxson, L R

    1992-04-23

    In eastern North America there are populations of all-female salamanders that incorporate the nuclear genomes of two or three of four sympatric bisexual species. The hybrids can be diploid, triploid, tetraploid or pentaploid, and 18 different combinations have been reported. All hybrids require sperm from a sympatric male of one of the bisexual species to reproduce, but the sperm may or may not be incorporated in the egg. Some of the hybrids are believed to represent separate, clonal species, but little is known of the origin of this hybrid complex. Vertebrate mitochondrial DNA is inherited maternally, allowing identification of the female parent that gave rise to hybrid lineages. A portion of the cytochrome b gene was sequenced from diploid and triploid hybrids that represent combinations of all four species. Nearly all hybrids had a similar mitochondrial genome sequence, independent of nuclear genome composition and ploidy, and the sequence was distinct from that of any of the four bisexual species. The hybrids maintain a mitochondrial lineage that has evolved independently of their nuclear genome and represent the most ancient known unisexual vertebrate lineage.

  7. Black Marble - Americas

    NASA Image and Video Library

    2017-09-27

    NASA image acquired April 18 - October 23, 2012 This image of North and South America at night is a composite assembled from data acquired by the Suomi NPP satellite in April and October 2012. The new data was mapped over existing Blue Marble imagery of Earth to provide a realistic view of the planet. The nighttime view was made possible by the new satellite’s “day-night band” of the Visible Infrared Imaging Radiometer Suite. VIIRS detects light in a range of wavelengths from green to near-infrared and uses filtering techniques to observe dim signals such as city lights, gas flares, auroras, wildfires, and reflected moonlight. In this case, auroras, fires, and other stray light have been removed to emphasize the city lights. “Artificial lighting is a excellent remote sensing observable and proxy for human activity,” says Chris Elvidge, who leads the Earth Observation Group at NOAA’s National Geophysical Data Center. Social scientists and demographers have used night lights to model the spatial distribution of economic activity, of constructed surfaces, and of populations. Planners and environmental groups have used maps of lights to select sites for astronomical observatories and to monitor human development around parks and wildlife refuges. Electric power companies, emergency managers, and news media turn to night lights to observe blackouts. Named for satellite meteorology pioneer Verner Suomi, NPP flies over any given point on Earth's surface twice each day at roughly 1:30 a.m. and p.m. The polar-orbiting satellite flies 824 kilometers (512 miles) above the surface, sending its data once per orbit to a ground station in Svalbard, Norway, and continuously to local direct broadcast users distributed around the world. The mission is managed by NASA with operational support from NOAA and its Joint Polar Satellite System, which manages the satellite's ground system. NASA Earth Observatory image by Robert Simmon, using Suomi NPP VIIRS data provided

  8. Evolutionary cytogenetics in salamanders.

    PubMed

    Sessions, Stanley K

    2008-01-01

    Salamanders (Amphibia: Caudata/Urodela) have been the subject of numerous cytogenetic studies, and data on karyotypes and genome sizes are available for most groups. Salamanders show a more-or-less distinct dichotomy between families with large chromosome numbers and interspecific variation in chromosome number, relative size, and shape (i.e. position of the centromere), and those that exhibit very little variation in these karyological features. This dichotomy is the basis of a major model of karyotype evolution in salamanders involving a kind of 'karyotypic orthoselection'. Salamanders are also characterized by extremely large genomes (in terms of absolute mass of nuclear DNA) and extensive variation in genome size (and overall size of the chromosomes), which transcends variation in chromosome number and shape. The biological significance and evolution of chromosome number and shape within the karyotype is not yet understood, but genome size variation has been found to have strong phenotypic, biogeographic, and phylogenetic correlates that reveal information about the biological significance of this cytogenetic variable. Urodeles also present the advantage of only 10 families and less than 600 species, which facilitates the analysis of patterns within the entire order. The purpose of this review is to present a summary of what is currently known about overall patterns of variation in karyology and genome size in salamanders. These patterns are discussed within an evolutionary context.

  9. Ambystoma maculatum (spotted salamander). Reproduction

    USGS Publications Warehouse

    Glorioso, Brad M.; Waddle, Hardin; Hefner, Jeromi

    2012-01-01

    The Spotted Salamander is a wide-ranging salamander of the eastern United States that typically breeds in winter or early spring in ephemeral pools in lowland forests. Ambystoma maculatum is known to deposit 2-4 egg masses per year, each containing 1-250 eggs. As part of ongoing research into the ecology and reproductive biology of Spotted Salamanders in the Kisatchie District of Kisatchie National Forest in Natchitoches Parish, Louisiana, USA, we have been counting the number of embryos per egg mass. We captured seven female A. maculatum in a small pool, six of which were still gravid. We took standard measurements, including SVL, and then implanted a Passive Integrated Transponder (PIT tag) into each adult female as was the protocol. About an hour after processing these animals we marked new A. maculatum egg masses found in the same small pool using PVC pin flags pushed carefully through the outer jelly. We did not have enough time to process them that evening, and it was not until a few days later that we photographed those masses. We discovered that one of the masses contained a PIT tag in the outer jelly that corresponded to one of the six gravid females that were marked that same evening. To our knowledge, this is the first report of PIT tags being the means, albeit coincidentally, by which a particular egg mass of Ambystoma maculatum has been assigned to a particular female. For our purposes, losing the PIT tag from the adult female is counter to the goals of our study of this population, and we will no longer be implanting PIT tags into gravid females.

  10. Effects of urbanization on occupancy of stream salamanders.

    PubMed

    Price, Steven J; Cecala, Kristen K; Browne, Robert A; Dorcas, Michael E

    2011-06-01

    Urban development is the most common form of land conversion in the United States. Using a before-after control-impact study design, we investigated the effects of urbanization on larval and adult stages of southern two-lined salamanders (Eurycea cirrigera) and northern dusky salamanders (Desmognathus fuscus). Over 5 years, we estimated changes in occupancy and probabilities of colonization and survival in 13 stream catchments after urbanization and in 17 catchments that were not urbanized. We also examined effects of proportion of urbanized area in a catchment and distance of the salamander population to the nearest stream on probabilities of colonization and survival. Before urbanization, adult and larval stages of the two salamander species occupied nearly all surveyed streams, with occupancy estimates ranging from 1.0 to 0.78. Four years after urbanization mean occupancy of larval and adult two-lined salamanders had decreased from 0.87 and 0.78 to 0.57 and 0.39, respectively. Estimates of mean occupancy of larval northern dusky salamanders decreased from 1.0 to 0.57 in urban streams 4 years after urbanization; however, adult northern dusky salamander occupancy remained close to 1.0 in urban streams over 5 years. Occupancy estimates in control streams were similar for each species and stage over 5 years. Urbanization was associated with decreases in survival probabilities of adult and larval two-lined salamanders and decreases in colonization probabilities of larval dusky salamanders. Nevertheless, proportion of impervious surface and distance to nearest stream had little effect on probabilities of survival and colonization. Our results imply that in the evaluation of the effects of urbanization on species, such as amphibians, with complex life cycles, consideration of the effects of urbanization on both adult and larval stages is required. ©2010 Society for Conservation Biology.

  11. Quantity discrimination in salamanders.

    PubMed

    Krusche, Paul; Uller, Claudia; Dicke, Ursula

    2010-06-01

    We investigated discrimination of large quantities in salamanders of the genus Plethodon. Animals were challenged with two different quantities (8 vs 12 or 8 vs 16) in a two-alternative choice task. Stimuli were live crickets, videos of live crickets or images animated by a computer program. Salamanders reliably chose the larger of two quantities when the ratio between the sets was 1:2 and stimuli were live crickets or videos thereof. Magnitude discrimination was not successful when the ratio was 2:3, or when the ratio was 1:2 when stimuli were computer animated. Analysis of the salamanders' success and failure as well as analysis of stimulus features points towards movement as a dominant feature for quantity discrimination. The results are generally consistent with large quantity discrimination investigated in many other animals (e.g. primates, fish), current models of quantity representation (analogue magnitudes) and data on sensory aspects of amphibian prey-catching behaviour (neuronal motion processing).

  12. The Blue Marble

    NASA Technical Reports Server (NTRS)

    2002-01-01

    This spectacular Moderate Resolution Imaging Spectroradiometer (MODIS) 'blue marble' image is based on the most detailed collection of true-color imagery of the entire Earth to date. Using a collection of satellite-based observations, scientists and visualizers stitched together months of observations of the land surface, oceans, sea ice, and clouds into a seamless, true-color mosaic of every square kilometer (.386 square mile) of our planet. Most of the information contained in this image came from MODIS, illustrating MODIS' outstanding capacity to act as an integrated tool for observing a variety of terrestrial, oceanic, and atmospheric features of the Earth. The land and coastal ocean portions of this image is based on surface observations collected from June through September 2001 and combined, or composited, every eight days to compensate for clouds that might block the satellite's view on any single day. Global ocean color (or chlorophyll) data was used to simulate the ocean surface. MODIS doesn't measure 3-D features of the Earth, so the surface observations were draped over topographic data provided by the U.S. Geological Survey EROS Data Center. MODIS observations of polar sea ice were combined with observations of Antarctica made by the National Oceanic and Atmospheric Administration's AVHRR sensor-the Advanced Very High Resolution Radiometer. The cloud image is a composite of two days of MODIS imagery collected in visible light wavelengths and a third day of thermal infra-red imagery over the poles. A large collection of imagery based on the blue marble in a variety of sizes and formats, including animations and the full (1 km) resolution imagery, is available at the Blue Marble page. Image by Reto Stockli, Render by Robert Simmon. Based on data from the MODIS Science Team

  13. The Blue Marble

    NASA Technical Reports Server (NTRS)

    2002-01-01

    This spectacular Moderate Resolution Imaging Spectroradiometer (MODIS) 'blue marble' image is based on the most detailed collection of true-color imagery of the entire Earth to date. Using a collection of satellite-based observations, scientists and visualizers stitched together months of observations of the land surface, oceans, sea ice, and clouds into a seamless, true-color mosaic of every square kilometer (.386 square mile) of our planet. Most of the information contained in this image came from MODIS, illustrating MODIS' outstanding capacity to act as an integrated tool for observing a variety of terrestrial, oceanic, and atmospheric features of the Earth. The land and coastal ocean portions of this image is based on surface observations collected from June through September 2001 and combined, or composited, every eight days to compensate for clouds that might block the satellite's view on any single day. Global ocean color (or chlorophyll) data was used to simulate the ocean surface. MODIS doesn't measure 3-D features of the Earth, so the surface observations were draped over topographic data provided by the U.S. Geological Survey EROS Data Center. MODIS observations of polar sea ice were combined with observations of Antarctica made by the National Oceanic and Atmospheric Administration's AVHRR sensor-the Advanced Very High Resolution Radiometer. The cloud image is a composite of two days of MODIS imagery collected in visible light wavelengths and a third day of thermal infra-red imagery over the poles. A large collection of imagery based on the blue marble in a variety of sizes and formats, including animations and the full (1 km) resolution imagery, is available at the Blue Marble page. Image by Reto Stockli, Render by Robert Simmon. Based on data from the MODIS Science Team

  14. Native Salamanders and Introduced Fish: Changing the Nature of Mountain Lakes and Ponds

    USGS Publications Warehouse

    Larson, Gary L.; Hoffman, Robert L.

    2003-01-01

    During the last century, many fishless mountain lakes and ponds in the Pacific Northwest were stocked with non-native fish, such as brook trout, for recreational purposes. These introduced fish replaced long-toed and northwestern salamander larvae as the top aquatic vertebrate predator by preying on salamander larvae. This predatory interaction has been shown to reduce the abundances of larval salamander populations. We conducted studies in two national parks to assess the abundances of salamander larvae in lakes with and without introduced fish. These studies suggest that the two salamander species were affected quite differently by the presence of introduced fish because of different life-history traits and different distributions of salamanders and fish within each park.

  15. Terrestrial distribution of pond-breeding salamanders around an isolated wetland.

    PubMed

    Scott, David E; Komoroski, Mark J; Croshaw, Dean A; Dixon, Philip M

    2013-11-01

    Terrestrial habitats surrounding isolated wetlands are a critical resource for many pond-breeding amphibian species, yet few studies have examined the terrestrial distribution of post-metamorphic juveniles and adults. We used an encircling drift fence at a breeding pond in conjunction with partial fences at 90, 172, and 332 m from the wetland to estimate the terrestrial distribution of adult marbled salamanders (Ambystoma opacum; four breeding seasons) and mole salamanders (A. talpoideum; two seasons), as well as the dispersion of newly metamorphosed A. opacum (one summer). For newly metamorphosed A. opacum, 79% emigrated < 90 m from the wetland, and 8% moved beyond 172 m; movement distance was unrelated to body size. Distribution of adult A. opacum varied among years, with an average of 28% (range 23-31%) occurring beyond 172 m in all years. Averaged across two years, 51% of adult A. talpoideum occurred beyond 172 m. Lognormal models provided a good fit to both the juvenile and adult ambystomatid distributions, and parameters differed between age classes, sexes, species, and years within species. For adult A. opacum a buffer radius of 300 m or 340 m, depending on the year, is estimated to include 95% of adults; for A. talpoideum the estimate is 464 m or 501 m. A reanalysis of distribution data for seven ambystomatid species shows that a previous estimate of a 164-m radius to protect 95% of a population underestimates the needed buffer radius by 185 m. Because our study wetland requires a nearly 500 m wide radius to protect 95% of its ambystomatid adults, preservation of similar communities may require much more surrounding terrestrial habitat than previously thought.

  16. Terrestrial salamander abundance on reclaimed mountaintop removal mines

    USGS Publications Warehouse

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Mountaintop removal mining, a large-scale disturbance affecting vegetation, soil structure, and topography, converts landscapes from mature forests to extensive grassland and shrubland habitats. We sampled salamanders using drift-fence arrays and coverboard transects on and near mountaintop removal mines in southern West Virginia, USA, during 2000–2002. We compared terrestrial salamander relative abundance and species richness of un-mined, intact forest with habitats on reclaimed mountaintop removal mines (reclaimed grassland, reclaimed shrubland, and fragmented forest). Salamanders within forests increased in relative abundance with increasing distance from reclaimed mine edge. Reclaimed grassland and shrubland habitats had lower relative abundance and species richness than forests. Characteristics of reclaimed habitats that likely contributed to lower salamander abundance included poor soils (dry, compacted, little organic matter, high rock content), reduced vertical structure of vegetation and little tree cover, and low litter and woody debris cover. Past research has shown that salamander populations reduced by clearcutting may rebound in 15–24 years. Time since disturbance was 7–28 years in reclaimed habitats on our study areas and salamander populations had not reached levels found in adjacent mature forests.

  17. The influence of ecology and genetics on behavioral variation in salamander populations across the Eastern Continental Divide.

    PubMed

    Rissler, Leslie J; Wilbur, Henry M; Taylor, Douglas R

    2004-08-01

    Understanding the unique contributions of ecology and history to the distribution of species within communities requires an integrative approach. The Eastern Continental Divide in southwestern Virginia separates river drainages that differ in species composition: the more aquatic, predatory Desmognathus quadramaculatus is present only in the New River drainage (which drains to the Gulf of Mexico), while Desmognathus monticola is present in both the New River drainage and the James River drainage (which drains to the Atlantic Ocean). We investigated natural distributions, behavioral variation in experimental mesocosms, population genetic, and phylogenetic implications of community structure. The presence of D. quadramaculatus increased the terrestriality of D. monticola in natural and experimental situations but to different degrees in allopatric and sympatric populations. Our ecological data suggest that the degree of terrestriality in D. monticola is a result of a balance between the optimal aquatic habitat and risks of predation. Our genetic analyses suggest that D. monticola has experienced a recent range expansion and has only a recent history of association with D. quadramaculatus in Virginia. This is surprising given the strong behavioral variation that exists in populations experiencing unique community compositions over a scale of meters. This study demonstrates the need to combine both ecology and genetics toward an understanding of the factors affecting species distributions, behavioral variation between populations, and patterns of genetic variation across a landscape.

  18. A nondestructive technique to monitor the relative abundance of terrestrial salamanders

    Treesearch

    Richard M. DeGraaf; Mariko. Yamasaki

    1992-01-01

    Salamanders are abundant vertebrates in many forest ecosystems, and their annual biomass production can be important in forest food webs (Pough et al. 1987). Population densities of eastern redback salamanders (Plethodon cinereus) can exceed 2 individuals/m2 in deciduous forests of the United States (Heatwole 1962, Jaeger 1980...

  19. 77 FR 36287 - Proposed Low-Effect Habitat Conservation Plan for the California Tiger Salamander, Calaveras...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-06-18

    ... Fish and Wildlife Service Proposed Low-Effect Habitat Conservation Plan for the California Tiger... listed animal, the threatened Central California Distinct Population Segment of the California tiger salamander (tiger salamander). The applicant would implement a conservation program to minimize and mitigate...

  20. The Abundance of Salamanders in Forest Stands with Different Histories of Disturbance

    Treesearch

    F. Harvey Pough; Donald H. Rhodes; Andres Collazo

    1987-01-01

    Because of the importance of salamanders in forest food chains, the effects of forest management practices on populations of these animals warrant consideration. We compared the numbers and activity patterns of salamanders in areas of a deciduous forest in central New York State that had been cut selectively for firewood, or c1earcut, or planted with conifers. Numbers...

  1. Response of two terrestrial salamander species to spring burning in the Sierra Nevada, California

    Treesearch

    Karen E. Bagne; Kathryn L. Purcell

    2009-01-01

    Terrestrial salamanders may be vulnerable to prescribed fire applications due to their moist, permeable skin and limited mobility. We present data collected on terrestrial salamander populations in a ponderosa pine-dominated forest in the Sierra Nevada where fire was applied in the spring. Two species, Sierra ensatina (Ensatina eschscholtzi platensis...

  2. Impact of valley fills on streamside salamanders in southern West Virginia

    USGS Publications Warehouse

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Valley fills associated with mountaintop-removal mining bury stream headwaters and affect water quality and ecological function of reaches below fills. We quantified relative abundance of streamside salamanders in southern West Virginia during 2002 in three streams below valley fills (VFS) and in three reference streams (RS). We surveyed 36 10- × 2-m stream transects, once in summer and fall, paired by order and structure. Of 2,343 salamanders captured, 66.7% were from RS. Total salamanders (adults plus larvae) were more abundant in RS than VFS for first-order and second-order reaches. Adult salamanders had greater abundance in first-order reaches of RS than VFS. Larval salamanders were more abundant in second-order reaches of RS than VFS. No stream width or mesohabitat variables differed between VFS and RS. Only two cover variables differed. Silt cover, greater in VFS than RS first-order reaches, is a likely contributor to reduced abundance of salamanders in VFS. Second-order RS had more boulder cover than second-order VFS, which may have contributed to the higher total and larval salamander abundance in RS. Water chemistry assessments of our VFS and RS reported elevated levels of metal and ion concentrations in VFS, which can depress macroinvertebrate populations and likely affect salamander abundance. Valley fills appear to have significant negative effects on stream salamander abundance due to alterations in habitat structure, water quality and chemistry, and macroinvertebrate communities in streams below fills.

  3. Effects of predator chemical cues and behavioral biorhythms on foraging activity of terrestrial salamanders.

    PubMed

    Maerz, J C; Panebianco, N L; Madison, D M

    2001-07-01

    Red-backed salamanders, Plethodon cinereus, show a variety of alarm responses to chemical cues from eastern garter snakes, Thamnophis sirtalis. We measured the foraging activity of red-backed salamanders exposed to water soiled by a garter snake (fed P. cinereus) or to unsoiled water. Salamanders exposed to snake-soiled water showed less foraging activity than salamanders exposed to unsoiled water; therefore, predators could have nonlethal effects on salamander populations. Our results also show additional factors influenced salamander foraging activity. Salamander foraging activity and responsiveness to chemical cues do not appear to have been affected by sex or food deprivation. Salamander foraging activity does appear to have been influenced by activity biorhythms. Foraging activity of animals in both treatments showed a bimodal periodicity that is consistent with natural activity patterns controlled by internal biorhythms. Exposure to snake-soiled water significantly reduced foraging activity during periods of peak foraging activity, but had a subtler effect on foraging activity during natural lulls in activity. We suggest that both activity biorhythms and exposure to chemical cues are important factors affecting salamander foraging behavior.

  4. Portugues Marbles as Stone Heritage

    NASA Astrophysics Data System (ADS)

    Lopes, Luis; Martins, Ruben

    2013-04-01

    The main objective of this paper is to present and justify the reasons for the worldwide recognition of Portuguese Marbles as Stone Heritage. These marbles are also known as "Estremoz Marble" since was the first county were exploited. In the Estremoz Anticline marbles occupy an intermediate stratigraphic position being part of a volcano-sedimentary sequence of Cambrian age. The anticlinal structure has a Precambrian core and the younger rocks aged Devonian Period. This sequence has deformed by the Variscan Orogeny, which performed twice with different intensities both in ductile and brittle tension fields. The early Alpine Cycle also acts in the region and cause more fracturing of the marble. Practically in all the quarries is possible to perceive the spatial-temporal continuity of the deformation where one can describe a complete Wilson Cycle. Together all these geological features imprint the marbles beautiful aesthetic patterns that can be highlighted when used as dimension stone. Nowadays most of the quarries are placed in the counties of Borba and mainly in Vila Viçosa. This last city claims for itself the "Capital of the Marble" title and named the marble as "White Gold". In fact, according to the historical record, the marbles were quarried in Portuguese Alentejo's Province since the fourth century BC. Locally these geological materials are available easily accessible. Exhibit physical properties that allow the fabrication of structural and decorative elements and so were used since humans settled in the region and developed a structured Society. In the Roman period, the pieces of art made with Estremoz Marbles were exported abroad and today are represented in Museums and Archaeological Sites throughout Europe and North Africa countries. The Portuguese Marbles and Limestones, transformed into altars, stairways, columns, statues and pieces of wall cladding, were carried as ballast in the holds of ships. At the destination the Portuguese People had built

  5. From lamprey to salamander: an exploratory modeling study on the architecture of the spinal locomotor networks in the salamander.

    PubMed

    Bicanski, Andrej; Ryczko, Dimitri; Cabelguen, Jean-Marie; Ijspeert, Auke Jan

    2013-10-01

    The evolutionary transition from water to land required new locomotor modes and corresponding adjustments of the spinal "central pattern generators" for locomotion. Salamanders resemble the first terrestrial tetrapods and represent a key animal for the study of these changes. Based on recent physiological data from salamanders, and previous work on the swimming, limbless lamprey, we present a model of the basic oscillatory network in the salamander spinal cord, the spinal segment. Model neurons are of the Hodgkin-Huxley type. Spinal hemisegments contain sparsely connected excitatory and inhibitory neuron populations, and are coupled to a contralateral hemisegment. The model yields a large range of experimental findings, especially the NMDA-induced oscillations observed in isolated axial hemisegments and segments of the salamander Pleurodeles waltlii. The model reproduces most of the effects of the blockade of AMPA synapses, glycinergic synapses, calcium-activated potassium current, persistent sodium current, and [Formula: see text]-current. Driving segments with a population of brainstem neurons yields fast oscillations in the in vivo swimming frequency range. A minimal modification to the conductances involved in burst-termination yields the slower stepping frequency range. Slow oscillators can impose their frequency on fast oscillators, as is likely the case during gait transitions from swimming to stepping. Our study shows that a lamprey-like network can potentially serve as a building block of axial and limb oscillators for swimming and stepping in salamanders.

  6. Marbled murrelets have declined in Alaska

    USGS Publications Warehouse

    Piatt, John F.

    1998-01-01

    In the last issue of Northwest Science, Hayward and Iverson (“Long-Term Trends in Marbled Murrelets in Southeast Alaska Based on Christmas Bird Counts”) failed to mention other evidence for 40-75% declines in murrelet populations, or discuss implications of a climate regime shift that has reduced populations of seabirds in Alaska, or present any useful information on the status of old-growth breeding habitat for murrelets. They examined Christmas Bird Count (CBC) data from Southeast Alaska, and concluded that there is no evidence for declines in populations. They suggested that our (Piatt and Naslund 1995) previous analysis of CBC data for murrelets was erroneous, and suggested that “the disparity between our conclusions… invites explanation”.Invitation accepted. In the following, I will show that there was no disparity in conclusions, that Hayward and Iverson mis-represented our conclusions and they conducted a highly selective review of evidence for murrelet population changes in Alaska. The result was a paper that was inaccurate, incomplete, out-of-date, mis-leading and of little service to the readers of Northwest Science who might have read the article hoping to gain some new insight on the status of marbled murrelets in Alaska.

  7. Subcritical crack growth in marble

    NASA Astrophysics Data System (ADS)

    Nara, Yoshitaka; Nishida, Yuki; Toshinori, Ii; Harui, Tomoki; Tanaka, Mayu; Kashiwaya, Koki

    2016-04-01

    It is essential to study time-dependent deformation and fracturing in various rock materials to prevent natural hazards related to the failure of a rock mass. In addition, information of time-dependent fracturing is essential to ensure the long-term stability of a rock mass surrounding various structures. Subcritical crack growth is one of the main causes of time-dependent fracturing in rock. It is known that subcritical crack growth is influenced by not only stress but also surrounding environment. Studies of subcritical crack growth have been widely conducted for silicate rocks such as igneous rocks and sandstones. By contrast, information of subcritical crack growth in carbonate rocks is not enough. Specifically, influence of surrounding environment on subcritical crack growth in carbonate rock should be clarified to ensure the long-term stability of a rock mass. In this study, subcritical crack growth in marble was investigated. Especially, the influence of the temperature, relative humidity and water on subcritical crack growth in marble is investigated. As rock samples, marbles obtained in Skopje-City in Macedonia and Carrara-City in Italy were used. To measure subcritical crack growth, we used the load relaxation method of the double-torsion (DT) test. All measurements by DT test were conducted under controlled temperature and relative humidity. For both marbles, it was shown that the crack velocity in marble in air increased with increasing relative humidity at a constant temperature. Additionally, the crack velocity in water was much higher than that in air. It was also found that the crack velocity increased with increasing temperature. It is considered that temperature and water have significant influences on subcritical crack growth in marble. For Carrara marble in air, it was recognized that the value of subcritical crack growth index became low when the crack velocity was higher than 10-4 m/s. This is similar to Region II of subcritical crack growth

  8. Marble Cake Perspectives

    NASA Astrophysics Data System (ADS)

    Langmuir, C. H.

    2007-12-01

    Since the original suggestions by Hanson (Geol. Soc. London, 1977) and Allegre and Turcotte (Nature, 1986), the concept of a "veined" or "marble cake" mantle has gained wide acceptance as a paradigm for mantle composition and components. The "veined mantle" was conceived thinking of the mantle as an ultramafic migmatite with many types of veins, but emphasized metasomatic components contained in hydrous phases as an explanation for alkali basalts. The "marble cake" mantle emphasized recycled oceanic lithosphere. Both types of veins are inevitable consequences of mantle convection. Oceanic lithosphere is recycled and stretched; low melting components of the mantle are inevitably melted in ascending mantle flow, even beneath thick lithsosphere. Both vein types have been widely invoked to explain incompatible element enriched basalts from the mantle. Most recently, disequilibrium melting of veined mantle sources by various mechanisms have become a popular suggestion to explain diverse aspects of mantle geochemistry (e.g. Sobolev et al., Nature, 2005; Phipps Morgan et al., EPSL, 1999). The physical mechanisms that would allow disequilibrium melting of fine scale veins, however, remain to be demonstrated. Average upper mantle composition is residual to continents and requires removal of low F melts to generate the depleted MORB source, and enrichment by low F melts to create the enriched source. Such a process is also necessary in the Sobolev et al model for Hawaii, which generates the equivalent of a low F melt by two stages of larger degree melting. Enriched sources are not restricted to ocean islands, and the name "OIB source" is a misnomer. Enriched basalts occur on normal ridges, in back-arc basins, behind subduction zones, in continental rifts and in isolated volcanic cones. Most of these are not mantle plumes. Enriched components have been ascribed to recycled ocean lithosphere, but recycled ocean crust is depleted, not enriched. Therefore the isotopic signature

  9. Marble decay due to microcracking

    NASA Astrophysics Data System (ADS)

    Shushakova, V.; Fuller, E. R., Jr.; Heidelbach, F.; Siegesmund, S.

    2012-04-01

    An actual degradation phenomenon of marble structures, i.e., microcracking, is examined via computer simulations with a microstructure-based finite element modelling. Crack initiation and crack propagation were characterized, as well their dependence on grain- shape preferred orientation (SPO), lattice preferred orientation (LPO), grain size and grain-boundary fracture toughness. Calcite is used as an illustrative example. Results are expected to be general for myriad marble microstructures, as the thermophysical properties of various marbles do not differ that much. Three SPOs were analyzed: equiaxed grains; elongated grains and a mixture of equiaxed and elongated grains. Six LPOs were considered: a random orientation distribution function (ODF); an ODF with strong directional crystal texture generated via March Dollase fiber-texture; and four types of actual marble texture as measured on marble samples with electron back-scattered diffraction (EBSD). Two different grain sizes were analyzed: fine grains range up to 200μm and medium size grains of approximate 1mm. The fracture surface energy for the grain boundaries was chosen to be 20 % and 40 % of the fracture surface energy of a grain, so that both intergranular and transgranular fractures were possible. Simulations were performed for both heating and cooling by 50 °C in steps of 1 °C. Microcracking results were correlated with the thermoelastic responses (indicators) related to degradation. Certain combinations of SPO, LPO, grain size, and grain-boundary fracture toughness have a significant influence on the thermal-elastic response of marble. For instance, thermal stresses and elastic strain energy are a strong function of the LPO. With increasing LPO the strain energy density and the maximum principal stress decreases. With decreasing grain size and increasing LPO and SPO, the area of microcracking is smaller and microcracking commences at a higher temperature differential.

  10. Survey of Pathogenic Chytrid Fungi (Batrachochytrium dendrobatidis and B. salamandrivorans) in Salamanders from Three Mountain Ranges in Europe and the Americas.

    PubMed

    Parrott, Joshua Curtis; Shepack, Alexander; Burkart, David; LaBumbard, Brandon; Scimè, Patrick; Baruch, Ethan; Catenazzi, Alessandro

    2017-06-01

    Batrachochytrium salamandrivorans (Bsal) is a virulent fungal pathogen that infects salamanders. It is implicated in the recent collapse of several populations of fire salamanders in Europe. This pathogen seems much like that of its sister species, Batrachochytrium dendrobatidis (Bd), the agent responsible for anuran extinctions and extirpations worldwide, and is considered to be an emerging global threat to salamander communities. Bsal thrives at temperatures found in many mountainous regions rich in salamander species; because of this, we have screened specimens of salamanders representing 17 species inhabiting mountain ranges in three continents: The Smoky Mountains, the Swiss Alps, and the Peruvian Andes. We screened 509 salamanders, with 192 representing New World salamanders that were never tested for Bsal previously. Bsal was not detected, and Bd was mostly present at low prevalence except for one site in the Andes.

  11. The Tower and Glass Marbles Problem

    ERIC Educational Resources Information Center

    Denman, Richard T.; Hailey, David; Rothenberg, Michael

    2010-01-01

    The Catseye Marble company tests the strength of its marbles by dropping them from various levels of their office tower, to find the highest floor from which a marble will not break. We find the smallest number of drops required and from which floor each drop should be made. We also find out how these answers change if a restriction is placed on…

  12. The Tower and Glass Marbles Problem

    ERIC Educational Resources Information Center

    Denman, Richard T.; Hailey, David; Rothenberg, Michael

    2010-01-01

    The Catseye Marble company tests the strength of its marbles by dropping them from various levels of their office tower, to find the highest floor from which a marble will not break. We find the smallest number of drops required and from which floor each drop should be made. We also find out how these answers change if a restriction is placed on…

  13. From trees to seas--Marbled Murrelet numbers are down

    Treesearch

    Martin G. Raphael; Gary A. Falxa; Joan. O' Callaghan

    2013-01-01

    In 1992, the marbled murrelet population in the Pacific Northwest was listed as threatened under the federal Endangered Species Act, along with the northern spotted owl and Pacific salmon. These designations were embodied in the 1994 Northwest Forest Plan, which takes an ecosystem approach to managing about 25 million acres of federal lands, with a goal of...

  14. Marbled murrelet effectiveness monitoring plan for the Northwest Forest Plan.

    Treesearch

    Sarah Madsen; Diane Evans; Thomas Hamer; Paul Henson; Sherri Miller; S. Kim Nelson; Daniel Roby; Martin. Stapanian

    1999-01-01

    This report describes options for effectiveness monitoring of long-term status and trends to evaluate the success of the Northwest Forest Plan in maintaining and restoring marbled murrelet nesting habitat and populations on Federal lands. A two-phase approach is described that begins with developing reliable and repeatable processes for identifying nesting habitat and...

  15. Conservation of the marbled murrelet under the northwest forest plan.

    Treesearch

    Martin G. Raphael

    2006-01-01

    The Marbled Murrelet (Brachyramphus marmoratus) was listed as threatened in 1992, primarily because of loss of its old-forest nesting habitat. Monitoring conducted over the first 10 years following implementation of the Northwest Forest Plan shows at-sea murrelet populations appear to be stationary, but recruitment is very low and demographic...

  16. Plethodon cinereus (Redback Salamander) predation

    USGS Publications Warehouse

    Jung, R.E.; Ward, W.L.; Kings, C.O.; Weir, L.A.

    2000-01-01

    In 1999 at the Patuxent Research Refuge, we observed a large rove beetle (Staphylinus maculosus) consuming an eviscerated redback salamander (Plethodon cinereus) underneath a coverboard. Rove beetles typically eat invertebrates.

  17. SPATIALLY AUTOCORRELATED DEMOGRAPHY AND INTERPOND MIGRATION IN THE CALIFORNIA TIGER SALAMANDER (AMBYSTOME CALIFORNIENSE)

    EPA Science Inventory

    We investigated the metapopulation structure of the California tiger salamander (Ambystoma californiense) using a combination of indirect and direct methods to evaluate two key requirements of modern metapopulation models: 1) that patches support somewhat independent populations ...

  18. SPATIALLY AUTOCORRELATED DEMOGRAPHY AND INTERPOND MIGRATION IN THE CALIFORNIA TIGER SALAMANDER (AMBYSTOME CALIFORNIENSE)

    EPA Science Inventory

    We investigated the metapopulation structure of the California tiger salamander (Ambystoma californiense) using a combination of indirect and direct methods to evaluate two key requirements of modern metapopulation models: 1) that patches support somewhat independent populations ...

  19. The marbled crayfish as a paradigm for saltational speciation by autopolyploidy and parthenogenesis in animals

    PubMed Central

    Vogt, Günter; Falckenhayn, Cassandra; Schrimpf, Anne; Schmid, Katharina; Hanna, Katharina; Panteleit, Jörn; Helm, Mark; Schulz, Ralf; Lyko, Frank

    2015-01-01

    ABSTRACT The parthenogenetic all-female marbled crayfish is a novel research model and potent invader of freshwater ecosystems. It is a triploid descendant of the sexually reproducing slough crayfish, Procambarus fallax, but its taxonomic status has remained unsettled. By cross-breeding experiments and parentage analysis we show here that marbled crayfish and P. fallax are reproductively separated. Both crayfish copulate readily, suggesting that the reproductive barrier is set at the cytogenetic rather than the behavioural level. Analysis of complete mitochondrial genomes of marbled crayfish from laboratory lineages and wild populations demonstrates genetic identity and indicates a single origin. Flow cytometric comparison of DNA contents of haemocytes and analysis of nuclear microsatellite loci confirm triploidy and suggest autopolyploidisation as its cause. Global DNA methylation is significantly reduced in marbled crayfish implying the involvement of molecular epigenetic mechanisms in its origination. Morphologically, both crayfish are very similar but growth and fecundity are considerably larger in marbled crayfish, making it a different animal with superior fitness. These data and the high probability of a divergent future evolution of the marbled crayfish and P. fallax clusters suggest that marbled crayfish should be considered as an independent asexual species. Our findings also establish the P. fallax–marbled crayfish pair as a novel paradigm for rare chromosomal speciation by autopolyploidy and parthenogenesis in animals and for saltational evolution in general. PMID:26519519

  20. Ecological separation in a polymorphic terrestrial salamander.

    PubMed

    Anthony, Carl D; Venesky, Matthew D; Hickerson, Cari-Ann M

    2008-07-01

    1. When studying speciation, researchers commonly examine reproductive isolation in recently diverged populations. Polymorphic species provide an opportunity to examine the role of reproductive isolation in populations that may be in the process of divergence. 2. We examined a polymorphic population of Plethodon cinereus (red-backed salamanders) for evidence of sympatric ecological separation by colour morphology. Recent studies have correlated temperature and climate with colour morphology in this species, but no studies have looked at differences in diet or mate choice between colour morphs. We used artificial cover objects to assess salamander diet, mating preference and surface activity over a 2-year period at a field site in north-eastern Ohio. 3. We detected differences in diet between two colour morphs, striped and unstriped. The diets of striped individuals were significantly more diverse and were made up of more profitable prey than the diets of unstriped salamanders. 4. Opposite sex pairs were made up of individuals of the same colour morph and striped males were found more often with larger females than were unstriped males. 5. We corroborate findings of earlier studies suggesting that the unstriped form is adapted to warmer conditions. Unstriped individuals were the first to withdraw from the forest floor as temperatures fell in the late fall. We found no evidence that the colour morphs responded differently to abiotic factors such as soil moisture and relative humidity, and responses to surface temperatures were also equivocal. 6. We conclude that the two colour morphs exhibit some degree of ecological separation and tend to mate assortatively, but are unlikely to be undergoing divergence given the observed frequency of intermorph pairings.

  1. The more the better - polyandry and genetic similarity are positively linked to reproductive success in a natural population of terrestrial salamanders (Salamandra salamandra).

    PubMed

    Caspers, Barbara A; Krause, E Tobias; Hendrix, Ralf; Kopp, Michael; Rupp, Oliver; Rosentreter, Katrin; Steinfartz, Sebastian

    2014-01-01

    Although classically thought to be rare, female polyandry is widespread and may entail significant fitness benefits. If females store sperm over extended periods of time, the consequences of polyandry will depend on the pattern of sperm storage, and some of the potential benefits of polyandry can only be realized if sperm from different males is mixed. Our study aimed to determine patterns and consequences of polyandry in an amphibian species, the fire salamander, under fully natural conditions. Fire salamanders are ideal study objects, because mating, fertilization and larval deposition are temporally decoupled, females store sperm for several months, and larvae are deposited in the order of fertilization. Based on 18 microsatellite loci, we conducted paternity analysis of 24 female-offspring arrays with, in total, over 600 larvae fertilized under complete natural conditions. More than one-third of females were polyandrous and up to four males were found as sires. Our data clearly show that sperm from multiple males is mixed in the female's spermatheca. Nevertheless, paternity is biased, and the most successful male sires on average 70% of the larvae, suggesting a 'topping off' mechanism with first-male precedence. Female reproductive success increased with the number of sires, most probably because multiple mating ensured high fertilization success. In contrast, offspring number was unaffected by female condition and genetic characteristics, but surprisingly, it increased with the degree of genetic relatedness between females and their sires. Sires of polyandrous females tended to be genetically similar to each other, indicating a role for active female choice. © 2013 John Wiley & Sons Ltd.

  2. Landmark learning by juvenile salamanders (Ambystoma maculatum).

    PubMed

    Heuring, Whitney L; Mathis, Alicia

    2014-10-01

    Learning to use a landmark as a beacon to locate resources is one of the simplest forms of spatial learning. We tested whether landmark learning occurs in a semifossorial salamander that migrates annually to breeding ponds as adults. Juvenile spotted salamanders (Ambystoma maculatum) were tested in square containers with a plastic feeding dish in each corner, and a piece of earthworm was placed in one randomly-chosen dish. For landmark-trained salamanders, a rock was placed beside the dish containing the prey. For control salamanders, the rock was placed beside a randomly selected feeding dish. Each salamander was trained once every 2 days for 30 days. Significantly more landmark-trained salamanders than control salamanders entered the landmark area first, and landmark-trained individuals had faster latencies to enter the landmark area and longer stay-times. These results suggest that spotted salamanders are able to locate resources by associating their positions with landmarks.

  3. Predicted changes in climatic niche and climate refugia of conservation priority salamander species in the northeastern United States

    USGS Publications Warehouse

    Sutton, William B.; Barrett, Kyle; Moody, Allison T.; Loftin, Cynthia S.; deMaynadier, Phillip G.; Nanjappa, Priya

    2015-01-01

    Global climate change represents one of the most extensive and pervasive threats to wildlife populations. Amphibians, specifically salamanders, are particularly susceptible to the effects of changing climates due to their restrictive physiological requirements and low vagility; however, little is known about which landscapes and species are vulnerable to climate change. Our study objectives included, (1) evaluating species-specific predictions (based on 2050 climate projections) and vulnerabilities to climate change and (2) using collective species responses to identify areas of climate refugia for conservation priority salamanders in the northeastern United States. All evaluated salamander species were projected to lose a portion of their climatic niche. Averaged projected losses ranged from 3%–100% for individual species, with the Cow Knob Salamander (Plethodon punctatus), Cheat Mountain Salamander (Plethodon nettingi), Shenandoah Mountain Salamander (Plethodon virginia), Mabee’s Salamander (Ambystoma mabeei), and Streamside Salamander (Ambystoma barbouri) predicted to lose at least 97% of their landscape-scale climatic niche. The Western Allegheny Plateau was predicted to lose the greatest salamander climate refugia richness (i.e., number of species with a climatically-suitable niche in a landscape patch), whereas the Central Appalachians provided refugia for the greatest number of species during current and projected climate scenarios. Our results can be used to identify species and landscapes that are likely to be further affected by climate change and potentially resilient habitats that will provide consistent climatic conditions in the face of environmental change.

  4. Evaluation of terrestrial and streamside salamander monitoring techniques at Shenandoah National Park

    USGS Publications Warehouse

    Jung, R.E.; Droege, S.; Sauer, J.R.; Landy, R.B.

    2000-01-01

    In response to concerns about amphibian declines, a study evaluating and validating amphibian monitoring techniques was initiated in Shenandoah and Big Bend National Parks in the spring of 1998. We evaluate precision, bias, and efficiency of several sampling methods for terrestrial and streamside salamanders in Shenandoah National Park and assess salamander abundance in relation to environmental variables, notably soil and water pH. Terrestrial salamanders, primarily redback salamanders (Plethodon cinereus), were sampled by searching under cover objects during the day in square plots (10 to 35 m2). We compared population indices (mean daily and total counts) with adjusted population estimates from capture-recapture. Analyses suggested that the proportion of salamanders detected (p) during sampling varied among plots, necessitating the use of adjusted population estimates. However, adjusted population estimates were less precise than population indices, and may not be efficient in relating salamander populations to environmental variables. In future sampling, strategic use of capture-recapture to verify consistency of p's among sites may be a reasonable compromise between the possibility of bias in estimation of population size and deficiencies due to inefficiency associated with the estimation of p. The streamside two-lined salamander (Eurycea bislineata) was surveyed using four methods: leaf litter refugia bags, 1 m2 quadrats, 50 x 1 m visual encounter transects, and electric shocking. Comparison of survey methods at nine streams revealed congruent patterns of abundance among sites, suggesting that relative bias among the methods is similar, and that choice of survey method should be based on precision and logistical efficiency. Redback and two-lined salamander abundance were not significantly related to soil or water pH, respectively.

  5. Impact dynamics of liquid marbles

    NASA Astrophysics Data System (ADS)

    Marston, Jeremy; Supakar, Tinku

    2016-11-01

    The impact of particle coated droplets (a.k.a. liquid marbles or armored droplets) onto solid substrates is assessed experimentally with high-speed video. The impact is characterized by the maximum spread diameter, which conforms to scaling laws in terms of the impact Weber number, meaning that the marbles behave similar to water droplets during this stage. However, the motion of the particles across the surface allows us to observe both clustering and divergence of the particle shell and, in particular, we observe the formation of arrested shapes (i.e. jammed interfaces) after impact onto hydrophobic surfaces, from an initially spherical shape. In this case, we postulate that the speed of retraction and rate of change of surface coverage is a key ingredient leading to arrested shapes.

  6. Nesting habitat characteristics of Marbled Murrelets occurring in near-shore waters of the Olympic Peninsula, Washington

    Treesearch

    Randall J. Wilk; Martin G. Raphael; Thomas D. Bloxton

    2016-01-01

    Marbled Murrelets (Brachyramphus marmoratus) are listed as threatened in the portion of their range extending from British Columbia to California due to loss of nesting habitat. Recovery of Marbled Murrelet populations requires a better understanding of the characteristics of their nesting habitat in this part of their range. Our objective,...

  7. Floating mechanism of a small liquid marble

    PubMed Central

    Ooi, Chin Hong; Plackowski, Chris; Nguyen, Anh V.; Vadivelu, Raja K.; John, James A. St.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-01-01

    Flotation of small solid objects and liquid droplets on water is critical to natural and industrial activities. This paper reports the floating mechanism of liquid marbles, or liquid droplets coated with hydrophobic microparticles. We used X-ray computed tomography (XCT) to acquire cross-sectional images of the floating liquid marble and interface between the different phases. We then analysed the shape of the liquid marble and the angles at the three-phase contact line (TPCL). We found that the small floating liquid marbles follow the mechanism governing the flotation of solid objects in terms of surface tension forces. However, the contact angles formed and deformation of the liquid marble resemble that of a sessile liquid droplet on a thin, elastic solid. For small liquid marbles, the contact angle varies with volume due to the deformability of the interface. PMID:26902930

  8. Biofouling of marbles by oxygenic photosynthetic microorganisms.

    PubMed

    Karaca, Zeki; Öztürk, Ayten; Çolak, Emel

    2015-08-01

    Phototrophic microorganisms disfigure the surfaces of different types of stone. Stone structure is damaged by the activity of photoautotrophic and other microorganisms. However, to date few, investigations have been undertaken into the relationship between microorganisms and the properties of different types of marble. In this study, biological activity of photoautotrophic microorganisms on three types of marble (Yatagan White, Giallo Anticato and Afyon White) was investigated under laboratory conditions over a short period of time. The three types of marble supported the growth of phototrophic microbial communities on their outer and inner layers, turning their original colour from white to a yellowish green colour. The porosity of the marble types facilitated filamentous microbial growth in the presence of water. Scanning electron microscope analysis revealed the accumulation of aggregates such as small spherical, fibrillar, calcified globular bodies on the inner surfaces of the marbles. This suggests that the microscopic characteristics of particular marble types may stimulate the growth of certain types of microorganisms.

  9. Raman and XRD characterization of Moroccan Marbles

    NASA Astrophysics Data System (ADS)

    Khrissi, S.; Haddad, M.; Bejjit, L.; Ait Lyazidi, S.; El Amraoui, M.; Falguères, C.

    2017-03-01

    Various marbles collected from Moroccan careers, and two white reference marbles originating from Carrare-Italy and Drama-Greece, have been studied by different analytical techniques. Chemical composition of rocks has been determined by X-Ray fluorescence. X-Ray diffraction and Raman spectroscopy allowed the identification of both major (calcite and dolomite) and minor (quartz) mineralogical components. Moreover, Raman spectroscopy has been used to identify the calcium carbonate phases and to examine the graphitic ones in the marbles.

  10. Adaptation to temporal contrast in primate and salamander retina.

    PubMed

    Chander, D; Chichilnisky, E J

    2001-12-15

    Visual adaptation to temporal contrast (intensity modulation of a spatially uniform, randomly flickering stimulus) was examined in simultaneously recorded ensembles of retinal ganglion cells (RGCs) in tiger salamander and macaque monkey retina. Slow contrast adaptation similar to that recently discovered in salamander and rabbit retina was observed in monkey retina. A novel method was developed to quantify the effect of temporal contrast on steady-state sensitivity and kinetics of light responses, separately from nonlinearities that would otherwise significantly contaminate estimates of sensitivity. Increases in stimulus contrast progressively and reversibly attenuated and sped light responses in both salamander and monkey RGCs, indicating that a portion of the contrast adaptation observed in visual cortex originates in the retina. The effect of adaptation on sensitivity and kinetics differed in simultaneously recorded populations of ON and OFF cells. In salamander, adaptation affected the sensitivity of OFF cells more than ON cells. In monkey, adaptation affected the sensitivity of ON cells more than OFF cells. In both species, adaptation sped the light responses of OFF cells more than ON cells. Functionally defined subclasses of ON and OFF cells also exhibited asymmetric adaptation. These findings indicate that contrast adaptation differs in parallel retinal circuits that convey distinct visual signals to the brain.

  11. Intracellular invasion of green algae in a salamander host

    PubMed Central

    Kerney, Ryan; Kim, Eunsoo; Hangarter, Roger P.; Heiss, Aaron A.; Bishop, Cory D.; Hall, Brian K.

    2011-01-01

    The association between embryos of the spotted salamander (Ambystoma maculatum) and green algae (“Oophila amblystomatis” Lamber ex Printz) has been considered an ectosymbiotic mutualism. We show here, however, that this symbiosis is more intimate than previously reported. A combination of imaging and algal 18S rDNA amplification reveals algal invasion of embryonic salamander tissues and cells during development. Algal cells are detectable from embryonic and larval Stages 26–44 through chlorophyll autofluorescence and algal 18S rDNA amplification. Algal cell ultrastructure indicates both degradation and putative encystment during the process of tissue and cellular invasion. Fewer algal cells were detected in later-stage larvae through FISH, suggesting that the decline in autofluorescent cells is primarily due to algal cell death within the host. However, early embryonic egg capsules also contained encysted algal cells on the inner capsule wall, and algal 18S rDNA was amplified from adult reproductive tracts, consistent with oviductal transmission of algae from one salamander generation to the next. The invasion of algae into salamander host tissues and cells represents a unique association between a vertebrate and a eukaryotic alga, with implications for research into cell–cell recognition, possible exchange of metabolites or DNA, and potential congruence between host and symbiont population structures. PMID:21464324

  12. Cannibalistic-morph Tiger Salamanders in unexpected ecological contexts

    USGS Publications Warehouse

    McLean, Kyle I.; Stockwell, Craig A.; Mushet, David M.

    2016-01-01

    Barred tiger salamanders [Ambystoma mavortium (Baird, 1850)] exhibit two trophic morphologies; a typical and a cannibalistic morph. Cannibalistic morphs, distinguished by enlarged vomerine teeth, wide heads, slender bodies, and cannibalistic tendencies, are often found where conspecifics occur at high density. During 2012 and 2013, 162 North Dakota wetlands and lakes were sampled for salamanders. Fifty-one contained A. mavortium populations; four of these contained cannibalistic morph individuals. Two populations with cannibalistic morphs occurred at sites with high abundances of conspecifics. However, the other two populations occurred at sites with unexpectedly low conspecific but high fathead minnow [Pimephales promelas (Rafinesque, 1820)] abundances. Further, no typical morphs were observed in either of these later two populations, contrasting with earlier research suggesting cannibalistic morphs only occur at low frequencies in salamander populations. Another anomaly of all four populations was the occurrence of cannibalistic morphs in permanent water sites, suggesting their presence was due to factors other than faster growth allowing them to occupy ephemeral habitats. Therefore, our findings suggest environmental factors inducing the cannibalistic morphism may be more complex than previously thought.

  13. Territories of male and female terrestrial salamanders: costs, benefits, and intersexual spatial associations.

    PubMed

    Mathis, Alicia

    1991-05-01

    I used a mark-recapture study to estimate home areas for 107 red-backed salamanders (Plethodon cinereus) in a natural forest habitat. Both males and females of this species defend feeding territories, but I presume that some individuals in this relatively highdensity population (approximately 2.8 salamanders per m(2)) are nonterritorial floaters. Although territorial salamanders exhibited greater numbers of tail autotomies, they had significantly longer relative tail lengths. This difference suggests that territorial individuals gain benefits from territorial ownership. From the observation that home area size was inversely correlated with body size, I infer that larger animals gained higher quality foraging areas. Home areas of adults were significantly more segregated intrasexually and more aggregated intersexually than would be expected from a random distribution. Furthermore, intersexual overlap of home areas was significantly greater than intrasexual home area overlap. Territorial defense of feeding areas by male and female red-backed salamanders therefore also may play a role in mating behavior.

  14. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander

    PubMed Central

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M.; Willard, Scott T.; Kouba, Andrew J.

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration. PMID:27258650

  15. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander.

    PubMed

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M; Willard, Scott T; Kouba, Andrew J

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration.

  16. Ecology and conservation of the Marbled Murrelet

    Treesearch

    C. John Ralph; George L. Hunt; Martin G. Raphael; John F. Piatt

    1995-01-01

    This report on the Marbled Murrelet (Brachyramphus marmoratus) was compiled and editied by the interagency Marbled Murrelet Conservation Assessment Core Team. The 37 Chapters cover both original studies and literature reviews of many aspects of the species’ biology, ecology, and conservation needs. It includes new information on the forest habitat...

  17. Liquid marble as microbioreactor for bioengineering applications

    NASA Astrophysics Data System (ADS)

    Sarvi, Fatemeh; Jain, Kanika; Alhasan, Layla; Arbatan, Tina; Shen, Wei; Chan, Peggy P. Y.

    2015-12-01

    This paper reports the use of liquid marbles (LMs) as miniature bioreactors to produce three-dimensional (3D) spheroids including tumor-like spheriods from cancer cells and embryoid bodies (EBs) from stem cells. A liquid marble microbioreactor is prepared by placing a drop of cell suspension onto a polytetrafluoroethylene (PTFE) particle bed. Without the addition of growth factors, suspended EBs from liquid marbles exhibit spontaneous contraction. These results indicate that the liquid marble provides a suitable microenvironment to induce EB formation and spontaneous cardiac differentiation. The EBs were further plated onto gelatin-coated tissue culture dishes. Plated EBs express mature cardiomyocyte marker cardiac troponinT (cTnT), indicating that these EBs have differentiated into functional cardiomyocytes. The cardiomyocytes generated using this liquid marble approach could be useful for transplantation.

  18. Drivers of salamander extirpation mediated by Batrachochytrium salamandrivorans.

    PubMed

    Stegen, Gwij; Pasmans, Frank; Schmidt, Benedikt R; Rouffaer, Lieze O; Van Praet, Sarah; Schaub, Michael; Canessa, Stefano; Laudelout, Arnaud; Kinet, Thierry; Adriaensen, Connie; Haesebrouck, Freddy; Bert, Wim; Bossuyt, Franky; Martel, An

    2017-04-19

    The recent arrival of Batrachochytrium salamandrivorans in Europe was followed by rapid expansion of its geographical distribution and host range, confirming the unprecedented threat that this chytrid fungus poses to western Palaearctic amphibians. Mitigating this hazard requires a thorough understanding of the pathogen's disease ecology that is driving the extinction process. Here, we monitored infection, disease and host population dynamics in a Belgian fire salamander (Salamandra salamandra) population for two years immediately after the first signs of infection. We show that arrival of this chytrid is associated with rapid population collapse without any sign of recovery, largely due to lack of increased resistance in the surviving salamanders and a demographic shift that prevents compensation for mortality. The pathogen adopts a dual transmission strategy, with environmentally resistant non-motile spores in addition to the motile spores identified in its sister species B. dendrobatidis. The fungus retains its virulence not only in water and soil, but also in anurans and less susceptible urodelan species that function as infection reservoirs. The combined characteristics of the disease ecology suggest that further expansion of this fungus will behave as a 'perfect storm' that is able to rapidly extirpate highly susceptible salamander populations across Europe.

  19. NASA Blue Marble 2007 East

    NASA Image and Video Library

    2017-09-27

    Meteorological Satellite Program mission between 1994–1995. The topography layer is based on radar data collected by the Space Shuttle Endeavour during an 11-day mission in February of 2000. Topography over Antarctica comes from the Radarsat Antarctic Mapping Project, version 2. Most of the data layers in this visualization are available as monthly composites as part of NASA’s Blue Marble Next Generation image collection. The images in the collection appear in cylindrical projection (rectangular maps), and they are available at 500-meter resolution. The large images provided above are the full-size versions of these globes. In their hope that these images will inspire people to appreciate the beauty of our home planet and to learn about the Earth system, the developers of these images encourage readers to re-use and re-publish the images freely. NASA images by Reto Stöckli, based on data from NASA and NOAA. To learn the history of the Blue Marble go here: earthobservatory.nasa.gov/Features/BlueMarble/BlueMarble_... To learn more about the Blue Marble go here: earthobservatory.nasa.gov/IOTD/view.php?id=8108 To learn more about NASA's Goddard Space Flight Center go here: www.nasa.gov/centers/goddard/home/index.html NASA Goddard Space Flight Center is home to the nation's largest organization of combined scientists, engineers and technologists that build spacecraft, instruments and new technology to study the Earth, the sun, our solar system, and the universe. NASA Goddard Space Flight Center is home to the nation's largest organization of combined scientists, engineers and technologists that build spacecraft, instruments and new technology to study the Earth, the sun, our solar system, and the universe. Follow us on Twitter Join us on Facebook

  20. NASA Blue Marble 2007 West

    NASA Image and Video Library

    2017-09-27

    Meteorological Satellite Program mission between 1994–1995. The topography layer is based on radar data collected by the Space Shuttle Endeavour during an 11-day mission in February of 2000. Topography over Antarctica comes from the Radarsat Antarctic Mapping Project, version 2. Most of the data layers in this visualization are available as monthly composites as part of NASA’s Blue Marble Next Generation image collection. The images in the collection appear in cylindrical projection (rectangular maps), and they are available at 500-meter resolution. The large images provided above are the full-size versions of these globes. In their hope that these images will inspire people to appreciate the beauty of our home planet and to learn about the Earth system, the developers of these images encourage readers to re-use and re-publish the images freely. NASA images by Reto Stöckli, based on data from NASA and NOAA. To learn the history of the Blue Marble go here: earthobservatory.nasa.gov/Features/BlueMarble/BlueMarble_... To learn more about the Blue Marble go here: earthobservatory.nasa.gov/IOTD/view.php?id=8108 NASA Goddard Space Flight Center is home to the nation's largest organization of combined scientists, engineers and technologists that build spacecraft, instruments and new technology to study the Earth, the sun, our solar system, and the universe. Follow us on Twitter Join us on Facebook

  1. Detection of Batrachochytrium dendrobatidis in endemic salamander species from central Texas.

    PubMed

    Gaertner, James P; Forstner, Michael R J; O'Donnell, Lisa; Hahn, Dittmar

    2009-03-01

    A nested PCR protocol was used to analyze five endemic salamander species from Central Texas for the presence of the emerging pathogen, chytrid fungus (Batrachochytrium dendrobatidis). Chytrid fungus was detected from samples of each of the five species sampled: with low abundance, in the Texas salamander (Eurycea neotenes) (1 positive out of 16 individuals tested; 1/16), the Blanco River Springs salamander (E. pterophila) (1/20), the threatened San Marcos salamander (E. nana) (1/17), and the endangered Barton Springs salamander (E. sosorum) (1/7); much higher abundance was obtained for the Jollyville Plateau salamander (E. tonkawae) (6/14), which has recently been petitioned for addition to the USA endangered species list. With one exception, sequences of PCR products were identical to the 5.8S rRNA gene, and nearly so for the flanking internal transcribed spacer (ITS) regions of B. dendrobatidis which confirmed the detection of chytrid fungus, and thus demonstrated the presence of this pathogen in populations of endangered species in Central Texas. These confirmations were obtained from nonconsumptive tail clippings which confirms the applicability of historically collected samples from other studies in the examination of the fungus across time.

  2. Adaptive Linkage Disequilibrium Between Two Esterase Loci of a Salamander

    PubMed Central

    Webster, T. Preston

    1973-01-01

    In some populations of the salamander Plethodon cinereus, two polymorphic esterase loci are in linkage disequilibrium. Short-term stability of the linkage disequilibrium is demonstrated by an age class analysis. Long, perhaps very long, term stability is suggested by its distribution. This stability and concordant geographic variation in allelic frequencies imply selective origin and maintenance. Data on the frequencies of two color morphs suggest that formation of the linkage disequilibrium is dependent on the genetic background. Images PMID:4515614

  3. Climate change and shrinking salamanders: alternative mechanisms for changes in plethodontid salamander body size.

    PubMed

    Connette, Grant M; Crawford, John A; Peterman, William E

    2015-08-01

    An increasing number of studies have demonstrated relationships between climate trends and body size change of organisms. In many cases, climate might be expected to influence body size by altering thermoregulation, energetics or food availability. However, observed body size change can result from a variety of ecological processes (e.g. growth, selection, population dynamics) or imperfect observation of biological systems. We used two extensive datasets to evaluate alternative mechanisms for recently reported changes in the observed body size of plethodontid salamanders. We found that mean adult body size of salamanders can be highly sensitive to survey conditions, particularly rainfall. This systematic bias in the detection of larger or smaller individuals could result in a signature of body size change in relation to reported climate trends when it is simply observation error. We also identify considerable variability in body size distributions among years and find that individual growth rates can be strongly influenced by weather. Finally, our study demonstrates that measures of mean adult body size can be highly variable among surveys and that large sample sizes may be required to make reliable inferences. Identifying the effects of climate change is a critical area of research in ecology and conservation. Researchers should be aware that observed changes in certain organisms can result from multiple ecological processes or systematic bias due to nonrandom sampling of populations. © 2015 John Wiley & Sons Ltd.

  4. From polymer latexes to multifunctional liquid marbles.

    PubMed

    Fernandes, Ana M; Mantione, Daniele; Gracia, Raquel; Leiza, Jose R; Paulis, Maria; Mecerreyes, David

    2015-02-25

    A simple method to prepare multifunctional liquid marbles and dry water with magnetic, color, and fluorescent properties is presented. Multifunctional liquid marbles were prepared by encapsulation of water droplets using flocculated polymer latexes. First, the emulsion polymerization reaction of polystyrene and poly(benzyl methacrylate) was carried out using cheap and commercially available cationic surfactants. Subsequently, flocculation of the latex was provoked by an anion-exchange reaction of the cationic surfactant by the addition of lithium bis(trifluoromethanesulfonyl)imide salt. The flocculated polymer latex was filtered and dried, leading to very hydrophobic micronanoparticulated powders. These powders showed a great ability to stabilize the air/water interface. Stable liquid marbles were obtained by rolling water droplets onto the hydrophobic powders previously prepared. The use of very small polystyrene nanoparticles led us to the preparation of very stable and the biggest known liquid marbles up to 2.5 mL of water. Furthermore, the introduction of fluorescent comonomer dyes into the polymer powders allowed us to obtain new morphological images and new knowledge about the structure of liquid marbles by confocal microscopy. Furthermore, the introduction of magnetic nanoparticles into the polymer latex led to magnetic responsive liquid marbles, where the iron oxide nanoparticles are protected within a polymer. Altogether this method represents an accessible and general platform for the preparation of multifunctional liquid marbles and dry water, which may contribute to extending of their actual range of applications.

  5. 'Salamander plague' on Britain's doorstep.

    PubMed

    Mills, Georgina

    2015-01-24

    Chytridiomycosis can cause mass declines in amphibians, and the chytrid fungus Batrachochytrium dendrobatidis is the classic cause of this disease. However, recently, a second strain of chytrid fungus has emerged in Europe, resulting in major declines in fire salamanders. The Zoological Society of London (ZSL) discussed this, and the implications for the UK, at a meeting in December in London. Georgina Mills reports. British Veterinary Association.

  6. Learning Nuclear Science with Marbles

    NASA Astrophysics Data System (ADS)

    Constan, Zach

    2010-02-01

    Nuclei are small: if an atom was the size of a football field, the nucleus would be an apple sitting on the 50-yd line. At the same time, nuclei are dense: the Earth, compressed to nuclear density, could fit inside four Sears Towers. The subatomic level is strange and exotic. For that reason, it's not hard to get young minds excited about nuclear science. But how does one move beyond analogies like those above and offer a better understanding of the extraordinary world of the nucleus? This is the challenge faced by the outreach program at Michigan State University's National Superconducting Cyclotron Laboratory (NSCL), a National Science Foundation-supported facility specializing in the creation and study of rare isotopes. It was necessary to devise a model of the nucleus that students could interact with and even use to approximate the nuclear reactions that create exotic nuclei. The solution was to use magnetic marbles.

  7. How aphids lose their marbles.

    PubMed Central

    Pike, Nathan; Richard, Denis; Foster, William; Mahadevan, L

    2002-01-01

    Insects provide examples of many cunning stratagems to cope with the challenges of living in a world dominated by surface forces. Despite being the current masters of the land environment, they are at constant risk of being entrapped in liquids, which they prevent by having waxy and hairy surfaces. The problem is particularly acute in an enclosed space, such as a plant gall. Using secreted wax to efficiently parcel and transport their own excrement, aphids were able to solve this problem 200 Myr ago. Here, we report on the physical and physiological significance of this ingenious solution. The secreted powdery wax has three distinct roles: (i) it is hydrophobic, (ii) it creates a microscopically rough inner gall surface made of weakly compacted wax needles making the gall ultra-hydrophobic, and (iii) it coats the honeydew droplets converting them into liquid marbles, that can be rapidly and efficiently moved. PMID:12065036

  8. Methodological considerations for detection of terrestrial small-body salamander eDNA and implications for biodiversity conservation.

    PubMed

    Walker, Donald M; Leys, Jacob E; Dunham, Kelly E; Oliver, Joshua C; Schiller, Emily E; Stephenson, Kelsey S; Kimrey, John T; Wooten, Jessica; Rogers, Mark W

    2017-03-15

    Environmental DNA (eDNA) can be used as an assessment tool to detect populations of threatened species and provide fine-scale data required to make management decisions. The objectives of this project were to use quantitative PCR (qPCR) to: (i) detect spiked salamander DNA in soil, (ii) quantify eDNA degradation over time, (iii) determine detectability of salamander eDNA in a terrestrial environment using soil, faeces, and skin swabs, (iv) detect salamander eDNA in a mesocosm experiment. Salamander eDNA was positively detected in 100% of skin swabs and 66% of faecal samples and concentrations did not differ between the two sources. However, eDNA was not detected in soil samples collected from directly underneath wild-caught living salamanders. Salamander genomic DNA (gDNA) was detected in all qPCR reactions when spiked into soil at 10.0, 5.0, and 1.0 ng/g soil and spike concentration had a significant effect on detected concentrations. Only 33% of samples showed recoverable eDNA when spiked with 0.25 ng/g soil, which was the low end of eDNA detection. To determine the rate of eDNA degradation, gDNA (1 ng/g soil) was spiked into soil and quantified over seven days. Salamander eDNA concentrations decreased across days, but eDNA was still amplifiable at day 7. Salamander eDNA was detected in two of 182 mesocosm soil samples over 12 weeks (n = 52 control samples; n = 65 presence samples; n = 65 eviction samples). The discrepancy in detection success between experiments indicates the potential challenges for this method to be used as a monitoring technique for small-bodied wild terrestrial salamander populations. © 2017 John Wiley & Sons Ltd.

  9. Characterization of displaced bipolar cells in the tiger salamander retina.

    PubMed

    Maple, Bruce R; Zhang, Jian; Pang, Ji-Jie; Gao, Fan; Wu, Samuel M

    2005-03-01

    In immunocytochemical studies of the tiger salamander retina, 17% of neurons in the outer nuclear layer did not label for recoverin, a photoreceptor marker. Lucifer yellow injection showed a population of cells in the ONL to be displaced bipolar cells, with axon terminals that stratified exclusively in the OFF sublamina of the inner plexiform layer (IPL), and predominately within the cone-dominated region of the OFF sublamina. Glutamate generated a dendritic cationic conductance increase in all displaced bipolar cells tested, and typical cone-dominated bipolar cell light responses were observed among displaced cells that stratified in the central IPL. We conclude that displaced bipolar cells in the tiger salamander retina are entirely OFF-center cells, and predominately cone-dominated cells.

  10. Susceptibility of the endangered California tiger salamander, Ambystoma californiense, to ranavirus infection.

    PubMed

    Picco, Angela M; Brunner, Jesse L; Collins, James P

    2007-04-01

    Emerging infectious diseases are implicated in the declines and extinctions of amphibians worldwide. Ranaviruses in the family Iridoviridae are a global concern and have caused amphibian die-offs in wild populations in North America, Europe, South America, and in commercial populations in Asia and South America. The movement of amphibians for bait, food, pets, and research provides a route for the introduction of ranaviruses into naive and potentially endangered species. In this report, we demonstrate that the California tiger salamander, Ambystoma californiense, is susceptible to Ambystoma tigrinum virus (ATV). This virus has not been previously reported in California tiger salamander, but observed mortality in experimentally infected animals suggests that California tiger salamander populations could be adversely affected by an ATV introduction.

  11. Hybrid vigor between native and introduced salamanders raises new challenges for conservation.

    PubMed

    Fitzpatrick, Benjamin M; Shaffer, H Bradley

    2007-10-02

    Hybridization between differentiated lineages can have many different consequences depending on fitness variation among hybrid offspring. When introduced organisms hybridize with natives, the ensuing evolutionary dynamics may substantially complicate conservation decisions. Understanding the fitness consequences of hybridization is an important first step in predicting its evolutionary outcome and conservation impact. Here, we measured natural selection caused by differential viability of hybrid larvae in wild populations where native California Tiger Salamanders (Ambystoma californiense) and introduced Barred Tiger Salamanders (Ambystoma tigrinum mavortium) have been hybridizing for 50-60 years. We found strong evidence of hybrid vigor; mixed-ancestry genotypes had higher survival rates than genotypes containing mostly native or mostly introduced alleles. Hybrid vigor may be caused by heterozygote advantage (overdominance) or recombinant hybrid vigor (due to epistasis or complementation). These genetic mechanisms are not mutually exclusive, and we find statistical support for both overdominant and recombinant contributions to hybrid vigor in larval tiger salamanders. Because recombinant homozygous genotypes can breed true, a single highly fit genotype with a mosaic of native and introduced alleles may eventually replace the historically pure California Tiger Salamander (listed as Threatened under the U.S. Endangered Species Act). The management implications of this outcome are complex: Genetically pure populations may not persist into the future, but average fitness and population viability of admixed California Tiger Salamanders may be enhanced. The ecological consequences for other native species are unknown.

  12. Hybrid vigor between native and introduced salamanders raises new challenges for conservation

    PubMed Central

    Fitzpatrick, Benjamin M.; Shaffer, H. Bradley

    2007-01-01

    Hybridization between differentiated lineages can have many different consequences depending on fitness variation among hybrid offspring. When introduced organisms hybridize with natives, the ensuing evolutionary dynamics may substantially complicate conservation decisions. Understanding the fitness consequences of hybridization is an important first step in predicting its evolutionary outcome and conservation impact. Here, we measured natural selection caused by differential viability of hybrid larvae in wild populations where native California Tiger Salamanders (Ambystoma californiense) and introduced Barred Tiger Salamanders (Ambystoma tigrinum mavortium) have been hybridizing for 50–60 years. We found strong evidence of hybrid vigor; mixed-ancestry genotypes had higher survival rates than genotypes containing mostly native or mostly introduced alleles. Hybrid vigor may be caused by heterozygote advantage (overdominance) or recombinant hybrid vigor (due to epistasis or complementation). These genetic mechanisms are not mutually exclusive, and we find statistical support for both overdominant and recombinant contributions to hybrid vigor in larval tiger salamanders. Because recombinant homozygous genotypes can breed true, a single highly fit genotype with a mosaic of native and introduced alleles may eventually replace the historically pure California Tiger Salamander (listed as Threatened under the U.S. Endangered Species Act). The management implications of this outcome are complex: Genetically pure populations may not persist into the future, but average fitness and population viability of admixed California Tiger Salamanders may be enhanced. The ecological consequences for other native species are unknown. PMID:17884982

  13. Earliest known crown-group salamanders.

    PubMed

    Gao, Ke-Qin; Shubin, Neil H

    2003-03-27

    Salamanders are a model system for studying the rates and patterns of the evolution of new anatomical structures. Recent discoveries of abundant Late Jurassic and Early Cretaceous salamanders are helping to address these issues. Here we report the discovery of well-preserved Middle Jurassic salamanders from China, which constitutes the earliest known record of crown-group urodeles (living salamanders and their closest relatives). The new specimens are from the volcanic deposits of the Jiulongshan Formation (Bathonian), Inner Mongolia, China, and represent basal members of the Cryptobranchidae, a family that includes the endangered Asian giant salamander (Andrias) and the North American hellbender (Cryptobranchus). These fossils document a Mesozoic record of the Cryptobranchidae, predating the previous record of the group by some 100 million years. This discovery provides evidence to support the hypothesis that the divergence of the Cryptobranchidae from the Hynobiidae had taken place in Asia before the Middle Jurassic period.

  14. Marble Ageing Characterization by Acoustic Waves

    NASA Astrophysics Data System (ADS)

    Boudani, Mohamed El; Wilkie-Chancellier, Nicolas; Martinez, Loïc; Hébert, Ronan; Rolland, Olivier; Forst, Sébastien; Vergès-Belmin, Véronique; Serfaty, Stéphane

    In cultural heritage, statue marble characterization by acoustic waves is a well-known non-destructive method. Such investigations through the statues by time of flight method (TOF) point out sound speeds decrease with ageing. However for outdoor stored statues as the ones in the gardens of Chateau de Versailles, ageing affects mainly the surface of the Carrara marble. The present paper proposes an experimental study of the marble acoustic properties variations during accelerated laboratory ageing. The surface degradation of the marble is reproduced in laboratory for 29 mm thick marble samples by using heating/cooling thermal cycles on one face of a marble plate. Acoustic waves are generated by 1 MHz central frequency contact transducers excited by a voltage pulse placed on both sides of the plate. During the ageing and by using ad hoc transducers, the marble samples are characterized in transmission, along their volume by shear, compressional TOF measurements and along their surface by Rayleigh waves measurements. For Rayleigh waves, both TOF by transducers and laser vibrometry methods are used to detect the Rayleigh wave. The transmission measurements point out a deep decrease of the waves speeds in conjunction with a dramatic decrease of the maximum frequency transmitted. The marble acts as a low pass filter whose characteristic frequency cut decreases with ageing. This pattern occurs also for the Rayleigh wave surface measurements. The speed change in conjunction with the bandwidth translation is shown to be correlated to the material de-structuration during ageing. With a similar behavior but reversed in time, the same king of phenomena have been observed trough sol-gel materials during their structuration from liquid to solid state (Martinez, L. et all (2004). "Chirp-Z analysis for sol-gel transition monitoring". Ultrasonics, 42(1), 507-510.). A model is proposed to interpret the acoustical measurements

  15. Geological and technical characterisation of Iscehisar (Afyon-Turkey) marble deposits and the impact of marble waste on environmental pollution.

    PubMed

    Yavuz Celik, Mustafa; Sabah, Eyüp

    2008-04-01

    Turkey, due to its location in the Alpine-Himalayan belt, has numerous marble deposits. More than 250 marble types with different colours and patterns have been produced from these deposits and one hundred of these are well known around the world. One such well-known marble type is Afyon-Iscehisar. Afyon-Iscehisar is Palaeozoic in age and has been quarried since the era of the Roman empire. The Afyon region is known as one of the most important marble production and processing centres in Turkey. The Afyon province, which possesses 3.5% of exploitable marble reserves (3,872,000,000 tonne) in Turkey, yields 9% of the total marble block production. The 409 marble processing plants in Afyon produce 19% of the total slab in Turkey. As a result of marble production activities, approximately 340,000 tonne of marble waste has accumulated in the area. While some of these unshaped marble blocks are re-used and returned to the economy, the majority are discarded. There are two waste marble storage fields located in the Afyon-Iscehisar region. All of the solid and fine-grained marble waste is stored in waste marble storage fields in Susuz Boğazi and in the nearby Iscehisar marble quarries. The ecological effects of the marble waste, which were once discharged everywhere and exhibited visual pollution, has now been reduced to a minimal level.

  16. Effects of host species and environment on the skin microbiome of Plethodontid salamanders.

    PubMed

    Muletz Wolz, Carly R; Yarwood, Stephanie A; Campbell Grant, Evan H; Fleischer, Robert C; Lips, Karen R

    2017-07-06

    environment is more influential in shaping skin microbiome structure than host differences in these congeneric species, and suggest that environmental characteristics that covary with elevation influence microbiome structure. High prevalence and abundance of anti-Bd bacteria may contribute to low Bd levels in these populations of Plethodon salamanders. © 2017 The Authors. Journal of Animal Ecology © 2017 British Ecological Society.

  17. Life history as a predictor of salamander recovery rate from timber harvest in southern appalachian forests, USA.

    PubMed

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Forest management often represents a balance between social, economic, and ecological objectives. In the eastern United States, numerous studies have established that terrestrial salamander populations initially decline in abundance following timber harvest, yet the large-scale and long-term consequences are relatively unknown. We used count data from terrestrial survey points to examine the relation between salamander abundance and historic timber harvest while accounting for imperfect detection of individuals. Overall, stream- and terrestrial-breeding salamanders appeared to differ by magnitude of population decline, rate of population recovery, and extent of recolonization from surrounding forest. Specifically, estimated abundance of both species groups was positively associated with stand age and recovery rates were predicted to increase over time for red-legged salamanders (Plethodon shermani) and decrease in stream-breeding species. Abundance of stream-breeding salamanders was predicted to reach a peak by 100 years after timber harvest, and the population growth rate of red-legged salamanders was predicted to undergo a significant increase 100 years after harvest. Estimated abundance of stream-breeding salamanders in young forest stands was also negatively associated with the distance to adjacent forest, a result that suggests immigration has a role in the recovery of these species. Our results indicate that salamander abundance in young forest stands may be only modestly lower than in more mature forest but that full recovery from timber harvest may take a substantial amount of time and that species life history may affect patterns of recovery. Historia de Vida como un Vaticinador de la Tasa de Recuperación de una Salamandra a la Colecta de Madera en los Bosques del Sur de los Apalaches, E.U.A. © 2013 Society for Conservation Biology.

  18. Evaporation rate of PTFE liquid marbles

    NASA Astrophysics Data System (ADS)

    Tosun, A.; Erbil, H. Y.

    2009-12-01

    Liquid marbles are hydrophilic liquid drops encapsulated with a hydrophobic powder. They behave as micro-reservoirs of liquids able to move rapidly without any leakage and are promising candidates to be applied in genetic analysis where 2D microfluidics and lab-on-a-chip methods are used. The manipulation of liquid marbles using gravitational, electrostatic and magnetic fields were recently investigated. In this work, we determined the evaporation rates of PTFE marbles formed by encapsulating PTFE micropowder on a water droplet in a closed chamber where relative humidity and temperature was kept constant. Evaporation rates of PTFE marbles were compared with the rates of pure water droplets in terms of evaporation resistance, ϕ parameter and it was found that PTFE marbles have longer life-time than water droplets so that ϕ values were found to increase regularly from 0.365 to 0.627 with the increase of RH of the evaporating medium. The barrier effect of PTFE microparticles at the water-air interface was more effective when water was evaporating slowly. PTFE water marbles have life-time of 26-60 min to retain their spherical shape under normal atmospheric conditions which is suitable for many promising applications in microfluidics, genetic analysis, electromagnetic actuators and valves.

  19. Photoresponsive liquid marbles and dry water.

    PubMed

    Tan, Tristan Tsai Yuan; Ahsan, Aniq; Reithofer, Michael R; Tay, Siok Wei; Tan, Sze Yu; Hor, Tzi Sum Andy; Chin, Jia Min; Chew, Benny Kia Jia; Wang, Xiaobai

    2014-04-01

    Stimuli-responsive liquid marbles for controlled release typically rely on organic moieties that require lengthy syntheses. We report herein a facile, one-step synthesis of hydrophobic and oleophobic TiO2 nanoparticles that display photoresponsive wettability. Water liquid marbles stabilized by these photoresponsive TiO2 particles were found to be stable when shielded from ultraviolet (UV) radiation; however, they quickly collapsed after being irradiated with 302 nm UV light. Oil- and organic-solvent-based liquid marbles could also be fabricated using oleophobic TiO2 nanoparticles and show similar UV-induced collapse. Finally, we demonstrated the formation of the micronized form of water liquid marbles, also known as dry water, by homogenization of the TiO2 nanoparticles with water. The TiO2 dry water displayed a similar photoresponse, whereby the micronized liquid marbles collapsed after irradiation and the dry water turned from a free-flowing powder to a paste. Hence, by exploiting the photoresponsive wettability of TiO2, we fabricated liquid marbles and dry water that display photoresponse and studied the conditions required for their collapse.

  20. Stream water temperature limits occupancy of salamanders in mid-Atlantic protected areas

    USGS Publications Warehouse

    Grant, Evan H. Campbell; Wiewel, Amber N. M.; Rice, Karen C.

    2014-01-01

    Stream ecosystems are particularly sensitive to urbanization, and tolerance of water-quality parameters is likely important to population persistence of stream salamanders. Forecasted climate and landscape changes may lead to significant changes in stream flow, chemical composition, and temperatures in coming decades. Protected areas where landscape alterations are minimized will therefore become increasingly important for salamander populations. We surveyed 29 streams at three national parks in the highly urbanized greater metropolitan area of Washington, DC. We investigated relationships among water-quality variables and occupancy of three species of stream salamanders (Desmognathus fuscus, Eurycea bislineata, and Pseudotriton ruber). With the use of a set of site-occupancy models, and accounting for imperfect detection, we found that stream-water temperature limits salamander occupancy. There was substantial uncertainty about the effects of the other water-quality variables, although both specific conductance (SC) and pH were included in competitive models. Our estimates of occupancy suggest that temperature, SC, and pH have some importance in structuring stream salamander distribution.

  1. Chapter 27: Mortality of Marbled Murrelets in Gill Nets in North America

    Treesearch

    Harry R. Carter; Michael L.C. McAllister; M.E. Pete Isleib

    1995-01-01

    Mortality of Marbled Murrelets (Brachyramphus marmoratus) due to accidental capture in gill nets is one of the major threats to murrelet populations. Gill-net mortality of murrelets throughout their range has been occurring for several decades and probably has contributed to declines in populations, in conjunction with loss of nesting habitat and...

  2. Chapter 26: Mortality of Marbled Murrelets Due to Oil Pollution in North America

    Treesearch

    Harry R. Carter; Katherine J. Kuletz

    1995-01-01

    Mortality of Marbled Murrelets (Brachyramphus marmoratus) due to oil pollution is one of the major threats to murrelet populations. Mortality from large spills and chronic oil pollution has been occurring for several decades but has been documented poorly throughout their range; it probably has contributed to declines in populations, in conjunction...

  3. Wildlife disease. Recent introduction of a chytrid fungus endangers Western Palearctic salamanders.

    PubMed

    Martel, A; Blooi, M; Adriaensen, C; Van Rooij, P; Beukema, W; Fisher, M C; Farrer, R A; Schmidt, B R; Tobler, U; Goka, K; Lips, K R; Muletz, C; Zamudio, K R; Bosch, J; Lötters, S; Wombwell, E; Garner, T W J; Cunningham, A A; Spitzen-van der Sluijs, A; Salvidio, S; Ducatelle, R; Nishikawa, K; Nguyen, T T; Kolby, J E; Van Bocxlaer, I; Bossuyt, F; Pasmans, F

    2014-10-31

    Emerging infectious diseases are reducing biodiversity on a global scale. Recently, the emergence of the chytrid fungus Batrachochytrium salamandrivorans resulted in rapid declines in populations of European fire salamanders. Here, we screened more than 5000 amphibians from across four continents and combined experimental assessment of pathogenicity with phylogenetic methods to estimate the threat that this infection poses to amphibian diversity. Results show that B. salamandrivorans is restricted to, but highly pathogenic for, salamanders and newts (Urodela). The pathogen likely originated and remained in coexistence with a clade of salamander hosts for millions of years in Asia. As a result of globalization and lack of biosecurity, it has recently been introduced into naïve European amphibian populations, where it is currently causing biodiversity loss.

  4. Detection of an enigmatic plethodontid Salamander using Environmental DNA

    USGS Publications Warehouse

    Pierson, Todd W.; Mckee, Anna; Spear, Stephen F.; Maerz, John C.; Camp, Carlos D.; Glenn, Travis C.

    2016-01-01

    The isolation and identification of environmental DNA (eDNA) offers a non-invasive and efficient method for the detection of rare and secretive aquatic wildlife, and it is being widely integrated into inventory and monitoring efforts. The Patch-Nosed Salamander (Urspelerpes brucei) is a tiny, recently discovered species of plethodontid salamander known only from headwater streams in a small region of Georgia and South Carolina. Here, we present results of a quantitative PCR-based eDNA assay capable of detecting Urspelerpes in more than 75% of 33 samples from five confirmed streams. We deployed the method at 31 additional streams and located three previously undocumented populations of Urspelerpes. We compare the results of our eDNA assay with our attempt to use aquatic leaf litterbags for the rapid detection of Urspelerpes and demonstrate the relative efficacy of the eDNA assay. We suggest that eDNA offers great potential for use in detecting other aquatic and semi-aquatic plethodontid salamanders.

  5. Extreme morphological and ecological homoplasy in tropical salamanders

    PubMed Central

    Parra-Olea, Gabriela; Wake, David B.

    2001-01-01

    Fossorial salamanders typically have elongate and attenuated heads and bodies, diminutive limbs, hands and feet, and extremely elongate tails. Batrachoseps from California, Lineatriton from eastern México, and Oedipina from southern México to Ecuador, all members of the family Plethodontidae, tribe Bolitoglossini, resemble one another in external morphology, which has evolved independently. Whereas Oedipina and Batrachoseps are elongate because there are more trunk vertebrae, a widespread homoplasy (parallelism) in salamanders, the genus Lineatriton is unique in having evolved convergently by an alternate “giraffe-neck” developmental program. Lineatriton has the same number of trunk vertebrae as related, nonelongated taxa, but individual trunk vertebrae are elongated. A robust phylogenetic hypothesis, based on sequences of three mtDNA genes, finds Lineatriton to be deeply nested within a clade characterized by generalized ecology and morphology. Lineatriton lineolus, the only currently recognized taxon in the genus, shows unanticipated genetic diversity. Surprisingly, geographically separated populations of L. lineolus are not monophyletic, but are sister taxa of different species of the morphologically generalized genus Pseudoeurycea. Lineatriton, long thought to be a unique monospecific lineage, is polyphyletic. Accordingly, the specialized morphology of Lineatriton displays homoplasy at two hierarchical levels: (i) with respect to other elongate lineages in the family (convergence), and (ii) within what is currently recognized as a single taxon (parallelism). These evolutionary events are of adaptive significance because to invade the lowland tropics salamanders must be either arboreal or fossorial; the repeated evolution of elongation and attenuation has led to multiple lowland invasions. PMID:11427707

  6. Age-related changes in the tiger salamander retina.

    PubMed

    Townes-Anderson, E; Colantonio, A; St Jules, R S

    1998-05-01

    Tiger salamanders have been used in visual science because of the large size of their cells and the ease of preparation and maintenance of in vitro retinal preparations. We have found that salamanders over 27 cm in length show a variety of visual abnormalities. Compared to smaller animals (15-23 cm), large animals exhibited a decrease in visual responses determined by tests of the optomotor reflex. Small animals responded correctly an average of 84.5% of the time in visual testing at three light levels compared to an average of 68.4% for the large animals with the poorest visual performance at the lowest level of illumination. In addition, large animals contained (i) histological degeneration of the outer retina, in particular, loss and disruption of outer segments and abnormalities of the retinal pigmented epithelium, (ii) loss of cells, including photoreceptors, by apoptosis as evaluated with the TUNEL technique, and (iii) an increase in the number of macrophages and lymphocytes within the retina as determined by morphological examination. These histological changes were present in all large animals and all quadrants of their retinas. In contrast, small animals showed virtually no retinal degeneration, no TUNEL-positive cells, and few immune-like cells in the retina. Since large animals are also older animals. the visual changes are age-related. Loss of visual function and histological degeneration in the outer retina also typify aged human eyes. Thus, we propose that large salamanders serve as an animal model for age-related retinal degeneration. In addition to providing a source of aging retina that is readily accessible to experimental manipulation, the salamander provides a pigmented retina with a mixed (2:1, rod:cone) population of photoreceptors, similar to the degeneration-prone parafoveal region of the human eye.

  7. Water rolling and floating upon water: marbles supported by a water/marble interface.

    PubMed

    Bormashenko, Edward; Bormashenko, Yelena; Musin, Albina

    2009-05-01

    Floating of liquid marbles on a water/air interface was studied. The critical density allowing floating marbles containing NaCl solution was established experimentally and compared with its calculated value. A satisfactory agreement between experimental and theoretical values of the critical density is reported.

  8. Late Jurassic salamanders from northern China.

    PubMed

    Gao, K Q; Shubin, N H

    2001-03-29

    With ten extant families, salamanders (urodeles) are one of the three major groups of modern amphibians (lissamphibians). Extant salamanders are often used as a model system to assess fundamental issues of developmental, morphological and biogeographical evolution. Unfortunately, our understanding of these issues has been hampered by the paucity of fossil evidence available to assess the early history of the group. Here we report the discovery of an extraordinary sample of salamander fossils, some with rare soft-tissue impressions, from the Upper Jurassic of China. With over 500 articulated specimens, this assemblage documents the morphological diversity of early urodeles and includes larvae and adults of both neotenic and metamorphosed taxa. Phylogenetic analysis confirms that these salamanders are primitive, and reveals that all basal salamander clades have Asian distributions. This is compelling evidence for an Asian origin of Recent salamanders, as well as for an extensive and early radiation of several major lineages. These discoveries show that the evolution of salamanders has involved phylogenetic and ecological diversification around a body plan that has remained fundamentally stable for over 150 million years.

  9. Using multiple metrics to assess the effects of forest succession on population status: a comparative study of two terrestrial salamanders in the US Pacific Northwest

    Treesearch

    Hart Welsh; Karen L. Pope; Clara A. Wheeler

    2008-01-01

    Investigations to determine stable or source-sink animal population dynamics are challenging and often infeasible for most species due to the time and expense of mark-recapture studies and the challenge of life histories attributes that result in low detectability and low recapture probabilities. Often, managers rely solely on occupancy or relative abundance patterns...

  10. Diversity of cutaneous bacteria with antifungal activity isolated from female four-toed salamanders.

    PubMed

    Lauer, Antje; Simon, Mary Alice; Banning, Jenifer L; Lam, Brianna A; Harris, Reid N

    2008-02-01

    Among the microbiota of amphibian skin are bacteria that produce antifungal compounds. We isolated cutaneous bacteria from the skins of three populations of the nest-attending plethodontid salamander Hemidactylium scutatum and subsequently tested the bacterial isolates against two different fungi (related to Mariannaea elegans and Rhizomucor variabilis) that were obtained from dead salamander eggs. The culturable antifungal bacteria were phylogenetically characterized based on 16S rRNA phylogeny, and belonged to four phyla, comprising 14 bacterial families, 16 genera and 48 species. We found that about half of the antifungal bacterial genera and families were shared with a related salamander species, but there was virtually no overlap at the species level. The proportion of culturable antifungal bacterial taxa shared between two large populations of H. scutatum was the same as the proportion of taxa shared between H. scutatum and Plethodon cinereus, suggesting that populations within a species have unique antifungal bacterial species. Approximately 30% of individuals from both salamander species carried anti-M. elegans cutaneous bacteria and almost 90% of P. cinereus and 100% of H. scutatum salamanders carried anti-R. variabilis cutaneous bacteria. A culture independent method (PCR/DGGE) revealed a shared resident bacterial community of about 25% of the entire resident bacterial community within and among populations of H. scutatum. Thus, the culturable antifungal microbiota was far more variable on salamander skins than was the bacterial microbiota detected by PCR/DGGE. The resident cutaneous antifungal bacteria may play an important role in amphibians' innate defense against pathogens, including the lethal chytrid fungus Batrachochytrium dendrobatidis.

  11. Impacts of a gape limited Brook Trout, Salvelinus fontinalis, on larval Northwestern salamander, Ambystoma gracile, growth: A field enclosure experiment

    USGS Publications Warehouse

    Currens, C.R.; Liss, W.J.; Hoffman, R.L.

    2007-01-01

    The formation of amphibian population structure is directly affected by predation. Although aquatic predators have been shown to have direct negative effects on larval salamanders in laboratory and field experiments, the potential impacts of gape-limited fish on larval salamander growth has been largely underexplored. We designed an enclosure experiment conducted in situ to quantify the effects of gape-limited Brook Trout (Salvelinus fontinalis) on larval Northwestern Salamander (Ambystoma gracile) growth. We specifically tested whether the presence of fish too small to consume larvae had a negative effect on larval growth. The results of this study indicate that the presence of a gape-limited S. fontinalis can have a negative effect on growth of larval A. gracile salamanders. Copyright 2007 Society for the Study of Amphibians and Reptiles.

  12. Phylogeography and genetic identification of the newly-discovered populations of torrent salamanders (Rhyacotriton cascade and R. variegatus) in the central Cascades (USA)

    USGS Publications Warehouse

    Wagner, R.S.; Miller, Mark P.; Haig, Susan M.

    2006-01-01

    Newly discovered populations of Rhyacotritonidae were investigated for taxonomic identity, hybridization, and sympatry. Species in the genus Rhyacotriton have been historically difficult to identify using morphological characters. Mitochondrial (mtDNA) 16S ribosomal RNA sequences (491 bp) and allozymes (6 loci) were used to identify the distribution of populations occurring intermediate between the previously described ranges of R. variegatus and R. cascadae in the central Cascade Mountain region of Oregon. Allozyme and mitochondrial sequence data both indicated the presence of two distinct evolutionary lineages, with each lineage corresponding to the allopatric distribution of R. cascadae and R. variegatus. Results suggest the Willamette River acts as a phylogeographic barrier limiting the distribution of both species, although we cannot exclude the possibility that reproductive isolation also exists that reinforces species' distributions. This study extends the previously described geographical ranges of both R. cascadae and R. variegatus and defines an eastern range limit for R. variegatus conservation efforts.

  13. At random meetings to the creation of new species of Salamander

    NASA Astrophysics Data System (ADS)

    Brillant, Marie-Pierre

    2013-04-01

    The pupils in final year of high school (15-18 years old) study the notion "species" and the creation of new species in various ways. Having studied genetic admixtures, this activity allows the pupils to build a scenario explaining the creation of a new species of Salamander in southern California from an ancestral population existing in northern Oregon. They can observe, on Google Earth, various populations of Salamander of the genus Ensatina. Salamanders of the genus Ensatina live in California around the Joaquin and Sacramento dry valleys. In this software, the pupils get information about the salamanders' environment and photographs of individuals and environments. During a migratory movement toward new territories to be colonized, these salamanders meet an inhospitable environment that they can not occupy. This population then splits up into two migratory branches, east and west, each overcoming the obstacles in different ways. The two groups gradually colonized southern territories but they avoided the too dry and hot San Joaquin plains. The two main branches of the original population gradually move away from each other, and genetic exchanges between them decrease over time. Eventually, we can find various populations of Salamander on both sides of the valleys, since the salamanders occupied new territories and diversified along the way. Among mutations that randomly occur, only those mutations that are best adapted in the origin were conserved in the genetic heritage of every population. When the individuals stemming from different western populations met, they were interfertile and give fertile hybrids, which was verified in the laboratory. Likewise, when individuals of the different eastern subspecies met accidentally, fertile hybrids also could arise from these crossings. The pupils can observe what happens in the overlap of various populations : interfertility or not. They also have geological, geographical and climatic information about the San Joaquin

  14. Estimating superpopulation size and annual probability of breeding for pond-breeding salamanders

    USGS Publications Warehouse

    Kinkead, K.E.; Otis, D.L.

    2007-01-01

    It has long been accepted that amphibians can skip breeding in any given year, and environmental conditions act as a cue for breeding. In this paper, we quantify temporary emigration or nonbreeding probability for mole and spotted salamanders (Ambystoma talpoideum and A. maculatum). We estimated that 70% of mole salamanders may skip breeding during an average rainfall year and 90% may skip during a drought year. Spotted salamanders may be more likely to breed, with only 17% avoiding the breeding pond during an average rainfall year. We illustrate how superpopulations can be estimated using temporary emigration probability estimates. The superpopulation is the total number of salamanders associated with a given breeding pond. Although most salamanders stay within a certain distance of a breeding pond for the majority of their life spans, it is difficult to determine true overall population sizes for a given site if animals are only captured during a brief time frame each year with some animals unavailable for capture at any time during a given year. ?? 2007 by The Herpetologists' League, Inc.

  15. Molecular characterization of major histocompatibility complex class II alleles in wild tiger salamanders (Ambystoma tigrinum).

    PubMed

    Bos, David H; DeWoody, J Andrew

    2005-11-01

    Major histocompatibility complex (MHC) class II genes are usually among the most polymorphic in vertebrate genomes because of their critical role (antigen presentation) in immune response. Prior to this study, the MHC was poorly characterized in tiger salamanders (Ambystoma tigrinum), but the congeneric axolotl (Ambystoma mexicanum) is thought to have an unusual MHC. Most notably, axolotl class II genes lack allelic variation and possess a splice variant without a full peptide binding region (PBR). The axolotl is considered immunodeficient, but it is unclear how or to what extent MHC genetics and immunodeficiency are interrelated. To study the evolution of MHC genes in urodele amphibians, we describe for the first time an expressed polymorphic class II gene in wild tiger salamanders. We sequenced the PBR of a class II gene from wild A. tigrinum (n=33) and identified nine distinct alleles. Observed heterozygosity was 73%, and there were a total of 46 polymorphic sites, most of which correspond to amino acid positions that bind peptides. Patterns of nucleotide substitutions exhibit the signature of diversifying selection, but no recombination was detected. Not surprisingly, trans-species evolution of tiger salamander and axolotl class II alleles was apparent. We have no direct data on the immunodeficiency of tiger salamanders, but the levels of polymorphism in our study population should suffice to bind a variety of foreign peptides (unlike axolotls). Our tiger salamander data suggest that the monomorphism and immunodeficiencies associated with axolotl class II genes is a relic of their unique historical demography, not their phylogenetic legacy.

  16. A case for using Plethodontid salamanders for monitoring biodiversity and ecosystem integrity of North American forests

    USGS Publications Warehouse

    Welsh, H.H.; Droege, S.

    2001-01-01

    Terrestrial salamanders of the family P!ethodontidae have unique attributes that make them excellent indicators of biodiversity and ecosystem integrity in forested habitats. Their longevity, small territory size, site fidelity, sensitivity to natural and anthropogenic perturbations, tendency to occur in high densities, and low sampling costs mean that counts of plethodontid salamanders provide numerous advantages over counts of other North American forest organisms for indicating environmental change. Furthermore, they are tightly linked physiologically to microclimatic and successional processes that influence the distribution and abundance of numerous other hydrophilic but difficult-to-study forest-dwelling plants and animals. Ecosystem processes such as moisture cycling, food-web dynamics, and succession, with their related structural and microclimatic variability, all affect forest biodiversity and have been shown to affect salamander populations as well. We determined the variability associated with sampling for plethodontid salamanders by estimating the coefficient of variation (CV) from available time-series data. The median coefficient of variation indicated that variation in counts of individuals among studies was much lower in plethodonticis (27%) than in lepidoptera (93%), passerine birds (57%), small mammals (69%), or other amphibians (37-46%), which means plethodontid salamanders provide an important statistical advantage over other species for monitoring long-term forest health.

  17. Larval long-toed salamanders incur nonconsumptive effects in the presence of nonnative trout

    USGS Publications Warehouse

    Kenison, Erin K.; Litt, Andrea R.; Pilliod, David; McMahon, Thomas E.

    2016-01-01

    Predators can influence prey directly through consumption or indirectly through nonconsumptive effects (NCEs) by altering prey behavior, morphology, and life history. We investigated whether predator-avoidance behaviors by larval long-toed salamanders (Ambystoma macrodactylum) in lakes with nonnative trout result in NCEs on morphology and development. Field studies in lakes with and without trout were corroborated by experimental enclosures, where prey were exposed only to visual and chemical cues of predators. We found that salamanders in lakes with trout were consistently smaller than in lakes without trout: 38% lower weight, 24% shorter body length, and 29% shorter tail length. Similarly, salamanders in protective enclosures grew 2.9 times slower when exposed to visual and olfactory trout cues than when no trout cues were present. Salamanders in trout-free lakes and enclosures were 22.7 times and 1.48 times, respectively, more likely to metamorphose during the summer season than those exposed to trout in lakes and/or their cues. Observed changes in larval growth rate and development likely resulted from a facultative response to predator-avoidance behavior and demonstrate NCEs occurred even when predation risk was only perceived. Reduced body size and growth, as well as delayed metamorphosis, could have ecological consequences for salamander populations existing with fish if those effects carry-over into lower recruitment, survival, and fecundity.

  18. Carrara Marble: a nomination for Global Heritage Stone Resource

    NASA Astrophysics Data System (ADS)

    primavori, piero

    2014-05-01

    In the collective memory, in ordinary people, or in any technical office not devoted expressly to stone, marble is automatically associated with the word Carrara (Italy). Indisputably, for decades and decades, there has been this word association: marble means Carrara and Carrara means marble. In few other commodity sectors is a word so automatically associated with a name, engendering an identification process that, despite the inexorable onslaught of globalization, continues to exist. Carrara Marble, probably one of the most famous dimension stone in the world, has been recently designated as a suitable "Global Heritage Stone Resource". The additional designation of "Global Ornamental Stone" has also been proposed. Quarried since pre-Roman times, this marble is the testimonial of an area/industry that was able - for a variety of reasons not easily repeatable in future stone history - from the dawn of the stone sector to trigger a flywheel-effect on a global scale. The term Carrara Marble, geographically referable to the marbles extracted in the sorroundings of Carrara town, is in reality a general one, erroneously used since long time to define a multitude of different marbles (more than two hundred commercial varieties) extracted in the whole Apuane Alps region, Nortwestern Tuscany, Italy. The district of Carrara Marble is part of a wider territory where five important extractive areas can be recognized: Lunigiana, Garfagnana, Versilia, Massa and the Carrara area sensu stricto. This region is approximately 30 km long and 12 km wide, with marble outcrops, useful for commercial purposes, covering over 75 km2. The Carrara Marble is currently excavated in more than 100 quarries, at a rate of about 1.500.000 tons per year, is processed almost everywhere, and sold all over the world. The most important commercial designations are the following: 1) "Marmo Bianco"/"Marmo Ordinario" (Carrara White marble/Ordinary marble); 2) "Marmo Venato" (Veined marble); 3) "Marmo

  19. Iteroparity in the variable environment of the salamander Ambystoma tigrinum

    USGS Publications Warehouse

    Church, D.R.; Bailey, L.L.; Wilbur, H.M.; Kendall, W.L.; Hines, J.E.

    2007-01-01

    Simultaneous estimation of survival, reproduction, and movement is essential to understanding how species maximize lifetime reproduction in environments that vary across space and time. We conducted a four-year, capture–recapture study of three populations of eastern tiger salamanders (Ambystoma tigrinum tigrinum) and used multistate mark–recapture statistical methods to estimate the manner in which movement, survival, and breeding probabilities vary under different environmental conditions across years and among populations and habitats. We inferred how individuals may mitigate risks of mortality and reproductive failure by deferring breeding or by moving among populations. Movement probabilities among populations were extremely low despite high spatiotemporal variation in reproductive success and survival, suggesting possible costs to movements among breeding ponds. Breeding probabilities varied between wet and dry years and according to whether or not breeding was attempted in the previous year. Estimates of survival in the nonbreeding, forest habitat varied among populations but were consistent across time. Survival in breeding ponds was generally high in years with average or high precipitation, except for males in an especially ephemeral pond. A drought year incurred severe survival costs in all ponds to animals that attempted breeding. Female salamanders appear to defer these episodic survival costs of breeding by choosing not to breed in years when the risk of adult mortality is high. Using stochastic simulations of survival and breeding under historical climate conditions, we found that an interaction between breeding probabilities and mortality limits the probability of multiple breeding attempts differently between the sexes and among populations.

  20. Iteroparity in the variable environment of the salamander Ambystoma tigrinum.

    PubMed

    Church, Don R; Bailey, Larissa L; Wilbur, Henry M; Kendall, William L; Hines, James E

    2007-04-01

    Simultaneous estimation of survival, reproduction, and movement is essential to understanding how species maximize lifetime reproduction in environments that vary across space and time. We conducted a four-year, capture-recapture study of three populations of eastern tiger salamanders (Ambystoma tigrinum tigrinum) and used multistate mark-recapture statistical methods to estimate the manner in which movement, survival, and breeding probabilities vary under different environmental conditions across years and among populations and habitats. We inferred how individuals may mitigate risks of mortality and reproductive failure by deferring breeding or by moving among populations. Movement probabilities among populations were extremely low despite high spatiotemporal variation in reproductive success and survival, suggesting possible costs to movements among breeding ponds. Breeding probabilities varied between wet and dry years and according to whether or not breeding was attempted in the previous year. Estimates of survival in the nonbreeding, forest habitat varied among populations but were consistent across time. Survival in breeding ponds was generally high in years with average or high precipitation, except for males in an especially ephemeral pond. A drought year incurred severe survival costs in all ponds to animals that attempted breeding. Female salamanders appear to defer these episodic survival costs of breeding by choosing not to breed in years when the risk of adult mortality is high. Using stochastic simulations of survival and breeding under historical climate conditions, we found that an interaction between breeding probabilities and mortality limits the probability of multiple breeding attempts differently between the sexes and among populations.

  1. Endoparasites of plethodontid salamanders from Paradise Brook, New Hampshire.

    PubMed

    Muzzall, P M; Peebles, C R; Burton, T M

    1997-12-01

    Totals of 52 dusky salamanders Desmognathus fuscus, 51 two-lined salamanders Eurycea bislineata, 54 red-backed salamanders Plethodon cinereus, and 3 spring salamanders Gyrinophilus porphyriticus (Plethodontidae) collected in June and August 1995 from Paradise Brook, a tributary to Hubbard Brook, New Hampshire, were examined for parasites. Parasites found were Brachycoelium storeriae, Brachycoelium sp., Bothriocephalus rarus, Falcaustra sp., Omeia sp., Batracholandros magnavulvaris, and Cepedietta michiganensis. Eighty-six percent of the red-backed salamanders, a terrestrial species, harbored 1 or more parasites. Among the aquatic and semiaquatic species, 27% of the dusky and 45% of the two-lined salamanders were infected with 1 or more parasites.

  2. Evaporation of Ethanol-Water Binary Mixture Sessile Liquid Marbles.

    PubMed

    Ooi, Chin Hong; Bormashenko, Edward; Nguyen, Anh V; Evans, Geoffrey M; Dao, Dzung V; Nguyen, Nam-Trung

    2016-06-21

    Liquid marble is a liquid droplet coated with particles. Recently, the evaporation process of a sessile liquid marble using geometric measurements has attracted great attention from the research community. However, the lack of gravimetric measurement limits further insights into the physical changes of a liquid marble during the evaporation process. Moreover, the evaporation process of a marble containing a liquid binary mixture has not been reported before. The present paper investigates the effective density and the effective surface tension of an evaporating liquid marble that contains aqueous ethanol at relatively low concentrations. The effective density of an evaporating liquid marble is determined from the concurrent measurement of instantaneous mass and volume. Density measurements combined with surface profile fitting provide the effective surface tension of the marble. We found that the density and surface tension of an evaporating marble are significantly affected by the particle coating.

  3. Stabilization of a salamander moving hybrid zone.

    PubMed

    Visser, Michaël; de Leeuw, Maarten; Zuiderwijk, Annie; Arntzen, Jan W

    2017-01-01

    When related species meet upon postglacial range expansion, hybrid zones are frequently formed. Theory predicts that such zones may move over the landscape until equilibrium conditions are reached. One hybrid zone observed to be moving in historical times (1950-1979) is that of the pond-breeding salamanders Triturus cristatus and Triturus marmoratus in western France. We identified the ecological correlates of the species hybrid zone as elevation, forestation, and hedgerows favoring the more terrestrial T. marmoratus and pond density favoring the more aquatic T. cristatus. The past movement of the zone of ca. 30 km over three decades has probably been driven by the drastic postwar reduction of the "bocage" hedgerow landscape, favoring T. cristatus over T. marmoratus. No further hybrid zone movement was observed from 1979 to the present. To explain the changing dynamics of the hybrid zone, we propose that it stalled, either because an equilibrium was found at an altitude of ca. 140 m a.s.l. or due to pond loss and decreased population densities. While we cannot rule out the former explanation, we found support for the latter. Under agricultural intensification, ponds in the study area are lost at an unprecedented rate of 5.5% per year, so that remaining Triturus populations are increasingly isolated, hampering dispersal and further hybrid zone movement.

  4. Mineralogical characterization of the Shelburne marble and the Salem limestone

    SciTech Connect

    McGee, E.S.

    1989-01-01

    Samples of Shelburne marble and Salem limestone were selected to represent marbles and limestones used in buildings and monuments. The Royal variety of Shelburne marble is a white marble predominantly composed of calcite but has heterogeneously distributed gray inclusions. The select buff Salem limestone is a beige, homogeneous, fossiliferous limestone, predominantly composed of fragments of echinoderms and bryozoans. The author reports that both samples are appropriate test stones for the National Acid Precipitation Assessment Program stone exposure studies.

  5. Electrical discharges in Chinese salamander Andrias davidianus.

    PubMed

    Olshanskii, V M; Baron, V D; Wei, Xue

    2016-11-01

    In 2-year-old Chinese giant salamanders Andrias davidianus, occasional electric discharges with a characteristic pattern similar to the electric discharges of weakly electric catfish, Polypterus and Protopterus, were recorded for the first time. The discharges markedly differ in shape from the myograms accompanying abrupt movements of the salamander or exceeded them in amplitude by more than an order of magnitude. The discharges were recorded both in the autonomous experiment in the absence of experimenters and at a weak tactile stimulation.

  6. A conservation assessment for the marbled murrelet in southeast Alaska.

    Treesearch

    Anthony R. DeGange

    1996-01-01

    This assessment summarizes available information on the marbled murrelet in southeast Alaska and evaluates its current status. Marbled murrelets are broadly distributed across marine waters throughout southeast Alaska. They are abundant, numbering at least in the low hundreds of thousands. Marbled murrelets are believed to be at increasing risk in biogeographic...

  7. Marble Bone Disease: A Rare Bone Disorder

    PubMed Central

    Harinathbabu, Maheswari; Thillaigovindan, Ranjani; Prabhu, Geetha

    2015-01-01

    Osteopetrosis, or marble bone disease, is a rare skeletal disorder due to a defective function of the osteoclasts. This defect renders bones more susceptible to osteomyelitis due to decreased vascularity. This disorder is inherited as autosomal dominant and autosomal recessive. Healthcare professionals should urge these patients to maintain their oral health as well as general health, as this condition makes these patients more susceptible to frequent infections and fractures. This case report emphasizes the signs and symptoms of marble bone disease and presents clinical and radiographic findings.  PMID:26594603

  8. Geographic variation, genetic structure, and conservation unit designation in the Larch Mountain salamander (Plethodon larselli).

    Treesearch

    R. Steven Wagner; Mark P. Miller; Charles M. Crisafulli; Susan M. Haig

    2005-01-01

    The Larch Mountain salamander (Plethodon larselli Burns, 1954) is an endemic species in the Pacific northwestern United States facing threats related to habitat destruction. To facilitate development of conservation strategies, we used DNA sequences and RAPDs (random amplified polymorphic DNA) to examine differences among populations of this...

  9. Sensitive species of snakes, frogs, and salamanders in southern California conifer forest areas: status and management

    Treesearch

    Glenn R. Stewart; Mark R. Jennings; Robert H. Jr. Goodman

    2005-01-01

    At least 35 species of amphibians and reptiles occur regularly in the conifer forest areas of southern California. Twelve of them have some or all of their populations identified as experiencing some degree of threat. Among the snakes, frogs, and salamanders that we believe need particular attention are the southern rubber boa (Charina bottae umbratica...

  10. Proximate contributions to adult body size in two species of Dusky Salamanders (Plethodontidae: Desmognathus)

    Treesearch

    Richard Bruce

    2010-01-01

    I used skeletochronological data to evaluate the contributions of propagule size, larval/juvenile growth, and age at first reproduction to differences in adult body size in two species of plethodontid salamanders of the genus Desmognathus. The traits in question were evaluated in populations of the larger D. quadramaculatus and smaller D. monticola in the southern Blue...

  11. The Dynamics of Two Hybrid Zones in Appalachian Salamanders of the Genus Plethodon

    Treesearch

    Nelson G. Hairston; R. Haven Wiley; Charles K. Smith; Kenneth A. Kneidel

    1992-01-01

    Two zones of intergradation between populations of Plethodon have been studied for 18 and 20 years, respectively. The data consist of systematic scores of colors, made at least twice annually. Near Heintooga Overlook in the Balsam Mountains (Great Smoky Mountains National Park), the salamanders' cheeks are gray. Proceeding north toward the...

  12. Conservation assessment for the Siskiyou Mountains salamander and Scott Bar salamander in northern California.

    SciTech Connect

    Vinikour, W. S.; LaGory, K. E.; Adduci, J. J.; Environmental Science Division

    2006-10-20

    The purpose of this conservation assessment is to summarize existing knowledge regarding the biology and ecology of the Siskiyou Mountains salamander and Scott Bar salamander, identify threats to the two species, and identify conservation considerations to aid federal management for persistence of the species. The conservation assessment will serve as the basis for a conservation strategy for the species.

  13. Environmental acidification is not associated with altered plasma corticosterone levels in the stream-side salamander, Desmognathus ochrophaeus.

    PubMed

    Woodley, Sarah K; Freeman, Peter; Ricciardella, Lauren F

    2014-05-15

    As environments become increasingly altered due to anthropogenic factors, interest is growing in how endocrine systems respond to pollution and environmental degradation. Glucocorticoid hormones (GCs) are a type of stress hormones that are released upon activation of the hypothalamic-pituitary-adrenal axis and have widespread effects throughout the body. We tested the hypothesis that exposure to environmental acidification is associated with altered levels of plasma GCs in adult, stream-side Allegheny Mountain dusky salamanders (Desmognathus ochrophaeus). We compared plasma corticosterone (CORT) in salamanders living in 9 streams that differed in pH. Although capture and handling induced a robust increase in plasma CORT in all populations of salamanders, we discerned no significant effect of environmental pH on baseline CORT or handling-induced CORT levels. In a laboratory study, low pH decreased salamander locomotory activity compared to acid-neutral controls, but there was no effect of pH on plasma CORT. Decreased locomotory activity is a common amphibian response to stress, indicating that low pH has adverse effects on Allegheny Mountain dusky salamanders. Overall, we conclude that the effects of environmental pH on salamander behavior and other potential responses are not mediated by changes in plasma CORT levels. We discuss alternative explanations for our results and describe difficulties involved in searching for relationships between plasma GCs and environmental degradation.

  14. Colorado Yule Marble; building stone of the Lincoln Memorial

    USGS Publications Warehouse

    McGee, Elaine S.

    1999-01-01

    The Colorado Yule marble, quarried in Marble, Colo., is a very pure white marble, and it has been widely acclaimed for its quality and purity. This marble has been used for many prominent buildings; one of the most notable is the Lincoln Memorial in Washington, D.C., built nearly 80 years ago. Although most of the marble in the memorial appears to be in very good condition, some of the stones have developed pronounced surficial roughness and show a significant loss of carved details and rounded edges compared with adjacent stones. Because adjacent blocks of marble receive nearly identical exposure to weathering agents that cause deterioration of the marble, it seems very likely that this pronounced difference in durability of adjacent stones arises from some inherent characteristic of the marble. The Colorado Yule marble is a nearly pure calcite marble with minor inclusions of mica, quartz, and feldspar. Compositions of the calcite and the inclusion phases in the marble are typical for those phases. The calcite grains that compose the marble are irregularly shaped and range from 100 to 600 micrometers in diameter. The texture of the marble is even, with a slight preferred directional elongation that is visible when the marble is cut in certain directions. Physical tests of the marble show that its strength is comparable to that of other marbles typically used in buildings. Variations in the durability of the marble, like those seen at the Lincoln Memorial, are not related to variations in calcite composition or to the presence of inclusions in the marble. Most likely, the variations arise from differences in the calcite grain boundaries and the degree to which the grains interlock with one another. Weak grain boundaries that permit water or solutions to penetrate into the marble and dissolve the calcite grains at their edges cause the marble to disaggregate or ?sugar.? Subtle differences in texture that occur in the marble from various parts of the quarry probably

  15. Low breeding propensity and wide-ranging movements by marbled murrelets in Washington

    Treesearch

    Teresa J. Lorenz; Martin G. Raphael; Thomas D. Bloxton; Patrick G. Cunningham

    2016-01-01

    The marbled murrelet (Brachyramphus marmoratus) is a threatened seabird that forages in nearshore marine waters but nests inland, commonly in older coniferous forests. Information on ranging behavior and breeding propensity can be useful for informing management, especially when comparisons can be made between declining or threatened populations...

  16. Marine habitat selection by marbled murrelets (Brachyramphus marmoratus) during the breeding season

    Treesearch

    Teresa J. Lorenz; Martin G. Raphael; Thomas D. Bloxton; Christian Andrew Hagen

    2016-01-01

    The marbled murrelet (Brachyramphus marmoratus) is a declining seabird that is wellknown for nesting in coastal old-growth forests in the Pacific Northwest. Most studies of habitat selection have focused on modeling terrestrial nesting habitat even though marine habitat is believed to be a major contributor to population declines in some regions....

  17. Chapter 35: Productivity of marbled murrelets in California from observations of young at sea

    Treesearch

    C. John Ralph; Linda L. Long

    1995-01-01

    We designed and tested an intensive survey method in 1993 to identify juvenile Marbled Murrelets (Brachyramphus marmoratus) at sea. From this, we used the percent of juveniles seen in the sample as an index of productivity of murrelets along the California coast. We found 2.2 percent of the population sampled were juveniles, similar to our estimates...

  18. Use of fragmented landscapes by Marbled Murrelets for nesting in Southern Oregon

    Treesearch

    C.B. Meyer; S.L. Miller

    2002-01-01

    As oldgrowth forest becomes more fragmented in the Pacific Northwest (U.S.A.), species dependent on large patches of oldgrowth forest may be at greater risk of extinction. The Marbled Murrelet (Brachyramphus marmoratus), a seabird whose populations are declining in North America, nests in such old-growth forests or forests with large remnant trees....

  19. Black Marble - Asia and Australia

    NASA Image and Video Library

    2017-09-27

    NASA image acquired April 18 - October 23, 2012 This image of Asia and Australia at night is a composite assembled from data acquired by the Suomi NPP satellite in April and October 2012. The new data was mapped over existing Blue Marble imagery of Earth to provide a realistic view of the planet. The nighttime view was made possible by the new satellite’s “day-night band” of the Visible Infrared Imaging Radiometer Suite. VIIRS detects light in a range of wavelengths from green to near-infrared and uses filtering techniques to observe dim signals such as city lights, gas flares, auroras, wildfires, and reflected moonlight. In this case, auroras, fires, and other stray light have been removed to emphasize the city lights. “Night time imagery provides an intuitively graspable view of our planet,” says William Stefanov, a scientist in NASA’s International Space Station program office who has worked with similar images from astronauts. “City lights are an excellent means to track urban and suburban growth, which feeds into planning for energy use and urban hazards, for studying urban heat islands, and for initializing climate models.” Named for satellite meteorology pioneer Verner Suomi, NPP flies over any given point on Earth's surface twice each day at roughly 1:30 a.m. and p.m. The polar-orbiting satellite flies 824 kilometers (512 miles) above the surface, sending its data once per orbit to a ground station in Svalbard, Norway, and continuously to local direct broadcast users distributed around the world. The mission is managed by NASA with operational support from NOAA and its Joint Polar Satellite System, which manages the satellite's ground system. NASA Earth Observatory image by Robert Simmon, using Suomi NPP VIIRS data provided courtesy of Chris Elvidge (NOAA National Geophysical Data Center). Suomi NPP is the result of a partnership between NASA, NOAA, and the Department of Defense. Caption by Mike Carlowicz. Instrument: Suomi NPP - VIIRS

  20. ARE SALAMANDERS USEFUL INDICATORS OF HYDROLOGIC PERMANENCE IN HEADWATER STREAMS?

    EPA Science Inventory

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collect...

  1. ARE SALAMANDERS USEFUL INDICATORS OF HYDROLOGIC PERMANENCE IN HEADWATER STREAMS?

    EPA Science Inventory

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collect...

  2. Persistence and extirpation in invaded landscapes: patch characteristics and connectivity determine effects of non-native predatory fish on native salamanders

    USGS Publications Warehouse

    Pilliod, David S.; Arkle, Robert S.; Maxell, Bryce A.

    2012-01-01

    Studies have demonstrated negative effects of non-native, predatory fishes on native amphibians, yet it is still unclear why some amphibian populations persist, while others are extirpated, following fish invasion. We examined this question by developing habitat-based occupancy models for the long-toed salamander (Ambystoma macrodactylum) and nonnative fish using survey data from 1,749 water bodies across 470 catchments in the Northern Rocky Mountains, USA. We first modeled the habitat associations of salamanders at 468 fishless water bodies in 154 catchments where non-native fish were historically, and are currently, absent from the entire catchment. Wethen applied this habitat model to the complete data set to predict the probability of salamander occupancy in each water body, removing any effect of fish presence. Finally, we compared field-observed occurrences of salamanders and fish to modeled probability of salamander occupancy. Suitability models indicated that fish and salamanders had similar habitat preferences, possibly resulting in extirpations of salamander populations from entire catchments where suitable habitats were limiting. Salamanders coexisted with non-native fish in some catchments by using marginal quality, isolated (no inlet or outlet) habitats that remained fishless. They rarely coexisted with fish within individual water bodies and only where habitat quality was highest. Connectivity of water bodies via streams resulted in increased probability of fish invasion and consequently reduced probability of salamander occupancy.These results could be used to identify and prioritize catchments and water bodies where control measures would be most effective at restoring amphibian populations. Our approach could be useful as a framework for improved investigations into questions of persistence and extirpation of native species when non-native species have already become established.

  3. Coexistence in streams: Do source-sink dynamics allow salamanders to persist with fish predators?

    USGS Publications Warehouse

    Sepulveda, A.J.; Lowe, W.H.

    2011-01-01

    Theory suggests that source-sink dynamics can allow coexistence of intraguild predators and prey, but empirical evidence for this coexistence mechanism is limited. We used capture-mark-recapture, genetic methods, and stable isotopes to test whether source-sink dynamics promote coexistence between stream fishes, the intraguild predator, and stream salamanders (Dicamptodon aterrimus), the intraguild prey. Salamander populations from upstream reaches without fish were predicted to maintain or supplement sink populations in downstream reaches with fish. We found instead that downstream reaches with fish were not sinks even though fish consumed salamander larvae-apparent survival, recruitment, and population growth rate did not differ between upstream and downstream reaches. There was also no difference between upstream and downstream reaches in net emigration. We did find that D. aterrimus moved frequently along streams, but believe that this is a response to seasonal habitat changes rather than intraguild predation. Our study provides empirical evidence that local-scale mechanisms are more important than dispersal dynamics to coexistence of streams salamanders and fish. More broadly, it shows the value of empirical data on dispersal and gene flow for distinguishing between local and spatial mechanisms of coexistence. ?? 2011 Springer-Verlag.

  4. Coexistence in streams: do source-sink dynamics allow salamanders to persist with fish predators?

    PubMed

    Sepulveda, Adam J; Lowe, Winsor H

    2011-08-01

    Theory suggests that source-sink dynamics can allow coexistence of intraguild predators and prey, but empirical evidence for this coexistence mechanism is limited. We used capture-mark-recapture, genetic methods, and stable isotopes to test whether source-sink dynamics promote coexistence between stream fishes, the intraguild predator, and stream salamanders (Dicamptodon aterrimus), the intraguild prey. Salamander populations from upstream reaches without fish were predicted to maintain or supplement sink populations in downstream reaches with fish. We found instead that downstream reaches with fish were not sinks even though fish consumed salamander larvae-apparent survival, recruitment, and population growth rate did not differ between upstream and downstream reaches. There was also no difference between upstream and downstream reaches in net emigration. We did find that D. aterrimus moved frequently along streams, but believe that this is a response to seasonal habitat changes rather than intraguild predation. Our study provides empirical evidence that local-scale mechanisms are more important than dispersal dynamics to coexistence of streams salamanders and fish. More broadly, it shows the value of empirical data on dispersal and gene flow for distinguishing between local and spatial mechanisms of coexistence.

  5. Foraging under the risk of cannibalism leads to divergence in body size among tiger salamander larvae.

    PubMed

    Ziemba, R E; Myers, M T; Collins, J P

    2000-08-01

    Populations of plants and animals are almost always made up of individuals of different sizes. In populations where cannibalism is common, this size variation can influence rates of mortality and growth and affect population regulation. Size variation can be caused by a variety of mechanisms. One of these is due to size-specific responses to the threat of predation by potentially cannibalistic conspecifics. We investigated the role of anti-predator behavior in size structure development within single-aged cohorts of Arizona tiger salamander larvae. In a laboratory experiment, we show that size variation increases over time within groups of salamanders, even if they are fed in isolation. We also show that increasing the size of neighbors decreases the feeding rate of small salamander larvae. However, increasing density of neighbors did not have a significant effect on feeding rate. These results are consistent with the hypothesis that size variation among tiger salamander larvae is, in part, a result of size-specific responses to predation risk. We discuss the potential for feedback between size structure development, predation risk, and rates of cannibalism.

  6. LTR retrotransposons contribute to genomic gigantism in plethodontid salamanders.

    PubMed

    Sun, Cheng; Shepard, Donald B; Chong, Rebecca A; López Arriaza, José; Hall, Kathryn; Castoe, Todd A; Feschotte, Cédric; Pollock, David D; Mueller, Rachel Lockridge

    2012-01-01

    Among vertebrates, most of the largest genomes are found within the salamanders, a clade of amphibians that includes 613 species. Salamander genome sizes range from ~14 to ~120 Gb. Because genome size is correlated with nucleus and cell sizes, as well as other traits, morphological evolution in salamanders has been profoundly affected by genomic gigantism. However, the molecular mechanisms driving genomic expansion in this clade remain largely unknown. Here, we present the first comparative analysis of transposable element (TE) content in salamanders. Using high-throughput sequencing, we generated genomic shotgun data for six species from the Plethodontidae, the largest family of salamanders. We then developed a pipeline to mine TE sequences from shotgun data in taxa with limited genomic resources, such as salamanders. Our summaries of overall TE abundance and diversity for each species demonstrate that TEs make up a substantial portion of salamander genomes, and that all of the major known types of TEs are represented in salamanders. The most abundant TE superfamilies found in the genomes of our six focal species are similar, despite substantial variation in genome size. However, our results demonstrate a major difference between salamanders and other vertebrates: salamander genomes contain much larger amounts of long terminal repeat (LTR) retrotransposons, primarily Ty3/gypsy elements. Thus, the extreme increase in genome size that occurred in salamanders was likely accompanied by a shift in TE landscape. These results suggest that increased proliferation of LTR retrotransposons was a major molecular mechanism contributing to genomic expansion in salamanders.

  7. An Environmental Handbook of the Marble Area.

    ERIC Educational Resources Information Center

    Campbell, Dan

    The Elk Range located in the very center of the Colorado Rocky Mountains is described in this guide to the Maroon Bells-Snowmass Wilderness Area. Near the ghost town of Marble, Colorado, this wilderness area is described as 66,000 acres 150 miles outside Denver encompassing 25% of all established wilderness in Colorado, 130 miles of marked trails,…

  8. Lead poisoning of a marbled godwit

    USGS Publications Warehouse

    Locke, L.N.; Smith, M.R.; Windingstad, R.M.; Martin, S.J.

    1991-01-01

    A thin adult female marbled godwit (Limosa fedoa) found dead at Benton Lake National Wildlife Refuge, Montana, was found to have 17 ingested lead shot in its gizzard. Its liver contained 51.7 ppm lead (wet weight). Based on these necropsy findings a diagnosis of lead poisoning was made.

  9. Marbles, Anyone? Traditional Games in the Classroom.

    ERIC Educational Resources Information Center

    Casbergue, Renee M.; Kieff, Judith

    1998-01-01

    Children now play more solitary games, perhaps missing benefits of traditional games such as jacks, marbles, and dominoes. Such games offer children of all backgrounds the opportunity to consolidate knowledge and skills, develop a more orderly way of thinking, and establish themselves with peers. By making these games available in classrooms,…

  10. An Environmental Handbook of the Marble Area.

    ERIC Educational Resources Information Center

    Campbell, Dan

    The Elk Range located in the very center of the Colorado Rocky Mountains is described in this guide to the Maroon Bells-Snowmass Wilderness Area. Near the ghost town of Marble, Colorado, this wilderness area is described as 66,000 acres 150 miles outside Denver encompassing 25% of all established wilderness in Colorado, 130 miles of marked trails,…

  11. Marbles, Anyone? Traditional Games in the Classroom.

    ERIC Educational Resources Information Center

    Casbergue, Renee M.; Kieff, Judith

    1998-01-01

    Children now play more solitary games, perhaps missing benefits of traditional games such as jacks, marbles, and dominoes. Such games offer children of all backgrounds the opportunity to consolidate knowledge and skills, develop a more orderly way of thinking, and establish themselves with peers. By making these games available in classrooms,…

  12. Data Collection and the Marble Company.

    ERIC Educational Resources Information Center

    Harper, Nancy L.

    A study investigated how managers in various kinds of organizations make decisions and also examined ways that using the Marble Company simulation (developed by L. C. Lederman and L. P. Stewart in 1985) could enhance, clarify, and extend its findings. Managers were asked to write down what they would say to their subordinates in order to elicit…

  13. Liquid Marble Coalescence and Triggered Microreaction Driven by Acoustic Levitation.

    PubMed

    Chen, Zhen; Zang, Duyang; Zhao, Liang; Qu, Mengfei; Li, Xu; Li, Xiaoguang; Li, Lixin; Geng, Xingguo

    2017-03-31

    Liquid marbles show promising potential for application in the microreactor field. Control of the coalescence between two or among multiple liquid marbles is critical; however, the successful merging of two isolated marbles is difficult because of their mechanically robust particle shells. In this work, the coalescence of multiple liquid marbles was achieved via acoustic levitation. The dynamic behaviors of the liquid marbles were monitored by a high-speed camera. Driven by the sound field, the liquid marbles moved toward each other, collided, and eventually coalesced into a larger single marble. The underlying mechanisms of this process were probed via sound field simulation and acoustic radiation pressure calculation. The results indicated that the pressure gradient on the liquid marble surface favors the formation of a liquid bridge between the liquid marbles, resulting in their coalescence. A preliminary indicator reaction was induced by the coalescence of dual liquid marbles, which suggests that expected chemical reactions can be successfully triggered with multiple reagents contained in isolated liquid marbles via acoustic levitation.

  14. Functional organization of ganglion cells in the salamander retina.

    PubMed

    Segev, Ronen; Puchalla, Jason; Berry, Michael J

    2006-04-01

    Recently, we reported a novel technique for recording all of the ganglion cells in a retinal patch and showed that their receptive fields cover visual space roughly 60 times over in the tiger salamander. Here, we carry this analysis further and divide the population of ganglion cells into functional classes using quantitative clustering algorithms that combine several response characteristics. Using only the receptive field to classify ganglion cells revealed six cell types, in agreement with anatomical studies. Adding other response measures served to blur the distinctions between these cell types rather than resolve further classes. Only the biphasic off type had receptive fields that tiled the retina. Even when we attempted to split these classes more finely, ganglion cells with almost identical functional properties were found to have strongly overlapping spatial receptive fields. A territorial spatial organization, where ganglion cell receptive fields tend to avoid those of other cells of the same type, was only found for the biphasic off cell. We further studied the functional segregation of the ganglion cell population by computing the amount of visual information shared between pairs of cells under natural movie stimulation. This analysis revealed an extensive mixing of visual information among cells of different functional type. Together, our results indicate that the salamander retina uses a population code in which every point in visual space is represented by multiple neurons with subtly different visual sensitivities.

  15. Black Marble - City Lights 2012

    NASA Image and Video Library

    2017-09-27

    The night side of Earth twinkles with light, and the first thing to stand out is the cities. “Nothing tells us more about the spread of humans across the Earth than city lights,” asserts Chris Elvidge, a NOAA scientist who has studied them for 20 years. This new global view and animation of Earth’s city lights is a composite assembled from data acquired by the Suomi National Polar-orbiting Partnership (Suomi NPP) satellite. The data was acquired over nine days in April 2012 and thirteen days in October 2012. It took satellite 312 orbits and 2.5 terabytes of data to get a clear shot of every parcel of Earth’s land surface and islands. This new data was then mapped over existing Blue Marble imagery of Earth to provide a realistic view of the planet. The nighttime view in visible light was made possible by the new “day-night band” of Suomi NPP’s Visible Infrared Imaging Radiometer Suite. VIIRS detects light in a range of wavelengths from green to near-infrared and uses filtering techniques to observe dim signals such as city lights, auroras, wildfires, and reflected moonlight. This low-light sensor can distinguish night lights with ten to hundreds of times better light detection capability than scientists had before. Named for satellite meteorology pioneer Verner Suomi, NPP flies over any given point on Earth&rsquos surface twice each day at roughly 1:30 a.m. and 1:30 p.m. The polar-orbiting satellite flies 824 kilometers (512 miles) above the surface as it circles the planet 14 times a day. Data is sent once per orbit to a ground station in Svalbard, Norway, and continuously to local direct broadcast users around the world. The mission is managed by NASA with operational support from NOAA and its Joint Polar Satellite System, which manages the satellite's ground system. NASA Earth Observatory image and animation by Robert Simmon, using Suomi NPP VIIRS data provided courtesy of Chris Elvidge (NOAA National Geophysical Data Center). Suomi NPP is the

  16. Innocent until proven guilty? Stable coexistence of alien rainbow trout and native marble trout in a Slovenian stream

    NASA Astrophysics Data System (ADS)

    Vincenzi, Simone; Crivelli, Alain J.; Jesensek, Dusan; Rossi, Gianluigi; de Leo, Giulio A.

    2011-01-01

    To understand the consequences of the invasion of the nonnative rainbow trout Oncorhynchus mykiss on the native marble trout Salmo marmoratus, we compared two distinct headwater sectors where marble trout occur in allopatry (MTa) or sympatry (MTs) with rainbow trout (RTs) in the Idrijca River (Slovenia). Using data from field surveys from 2002 to 2009, with biannual (June and September) sampling and tagging from June 2004 onwards, we analyzed body growth and survival probabilities of marble trout in each stream sector. Density of age-0 in September over the study period was greater for MTs than MTa and very similar between MTs and RTs, while density of trout ≥age-1 was similar for MTa and MTs and greater than density of RTs. Monthly apparent survival probabilities were slightly higher in MTa than in MTs, while RTs showed a lower survival than MTs. Mean weight of marble and rainbow trout aged 0+ in September was negatively related to cohort density for both marble and rainbow trout, but the relationship was not significantly different between MTs and MTa. No clear depression of body growth of sympatric marble trout between sampling intervals was observed. Despite a later emergence, mean weight of RTs cohorts at age 0+ in September was significantly higher than weight of both MTs and MTa. The establishment of a self-sustaining population of rainbow trout does not have a significant impact on body growth and survival probabilities of sympatric marble trout. The numerical dominance of rainbow trout in streams at lower altitudes seem to suggest that while the low summer flow pattern of Slovenian streams is favorable for rainbow trout invasion, the adaptation of marble trout to headwater environments may limit the invasion success of rainbow trout in headwaters.

  17. Innocent until proven guilty? Stable coexistence of alien rainbow trout and native marble trout in a Slovenian stream.

    PubMed

    Vincenzi, Simone; Crivelli, Alain J; Jesensek, Dusan; Rossi, Gianluigi; De Leo, Giulio A

    2011-01-01

    To understand the consequences of the invasion of the nonnative rainbow trout Oncorhynchus mykiss on the native marble trout Salmo marmoratus, we compared two distinct headwater sectors where marble trout occur in allopatry (MTa) or sympatry (MTs) with rainbow trout (RTs) in the Idrijca River (Slovenia). Using data from field surveys from 2002 to 2009, with biannual (June and September) sampling and tagging from June 2004 onwards, we analyzed body growth and survival probabilities of marble trout in each stream sector. Density of age-0 in September over the study period was greater for MTs than MTa and very similar between MTs and RTs, while density of trout ≥age-1 was similar for MTa and MTs and greater than density of RTs. Monthly apparent survival probabilities were slightly higher in MTa than in MTs, while RTs showed a lower survival than MTs. Mean weight of marble and rainbow trout aged 0+ in September was negatively related to cohort density for both marble and rainbow trout, but the relationship was not significantly different between MTs and MTa. No clear depression of body growth of sympatric marble trout between sampling intervals was observed. Despite a later emergence, mean weight of RTs cohorts at age 0+ in September was significantly higher than weight of both MTs and MTa. The establishment of a self-sustaining population of rainbow trout does not have a significant impact on body growth and survival probabilities of sympatric marble trout. The numerical dominance of rainbow trout in streams at lower altitudes seem to suggest that while the low summer flow pattern of Slovenian streams is favorable for rainbow trout invasion, the adaptation of marble trout to headwater environments may limit the invasion success of rainbow trout in headwaters.

  18. Role of habitat complexity in predator-prey dynamics between an introduced fish and larval Long-toed Salamanders (Ambystoma macrodactylum)

    USGS Publications Warehouse

    Kenison, Erin K; Litt, Andrea R.; Pilliod, David; McMahon, Tom E

    2016-01-01

    Predation by nonnative fishes has reduced abundance and increased extinction risk for amphibian populations worldwide. Although rare, fish and palatable amphibians have been observed to coexist where aquatic vegetation and structural complexity provide suitable refugia. We examined whether larval long-toed salamanders (Ambystoma macrodactylum Baird, 1849) increased use of vegetation cover in lakes with trout and whether adding vegetation structure could reduce predation risk and nonconsumptive effects (NCEs), such as reductions in body size and delayed metamorphosis. We compared use of vegetation cover by larval salamanders in lakes with and without trout and conducted a field experiment to investigate the influence of added vegetation structure on salamander body morphology and life history. The probability of catching salamanders in traps in lakes with trout was positively correlated with the proportion of submerged vegetation and surface cover. Growth rates of salamanders in enclosures with trout cues decreased as much as 85% and the probability of metamorphosis decreased by 56%. We did not find evidence that adding vegetation reduced NCEs in experimental enclosures, but salamanders in lakes with trout utilized more highly-vegetated areas which suggests that adding vegetation structure at the scale of the whole lake may facilitate coexistence between salamanders and introduced trout.

  19. Phylogeny and genetic history of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870) inferred from complete mitochondrial genomes.

    PubMed

    Malyarchuk, Boris; Derenko, Miroslava; Denisova, Galina

    2013-05-01

    We assessed phylogeny of the Siberian salamander (Salamandrella keyserlingii, Dybowski, 1870), the most northern ectothermic, terrestrial vertebrate in Eurasia, by sequence analysis of complete mitochondrial genomes in 26 specimens from different localities (China, Khabarovsk region, Sakhalin, Yakutia, Magadan region, Chukotka, Kamchatka, Ural, European part of Russia). In addition, a complete mitochondrial genome of the Schrenck salamander, Salamandrella schrenckii, was determined for the first time. Bayesian phylogenetic analysis of the entire mtDNA genomes of S. keyserlingii demonstrates that two haplotype clades, AB and C, radiated about 1.4 million years ago (Mya). Bayesian skyline plots of population size change through time show an expansion around 250 thousand years ago (kya) and then a decline around the Last Glacial Maximum (25 kya) with subsequent restoration of population size. Climatic changes during the Quaternary period have dramatically affected the population genetic structure of the Siberian salamanders. In addition, complete mtDNA sequence analysis allowed us to recognize that the vast area of Northern Eurasia was colonized only by the Siberian salamander clade C1b during the last 150 kya. Meanwhile, we were unable to find evidence of molecular adaptation in this clade by analyzing the whole mitochondrial genomes of the Siberian salamanders.

  20. The amphibian chytrid fungus, Batrachochytrium dendrobatidis, in fully aquatic salamanders from Southeastern North America.

    PubMed

    Chatfield, Matthew W H; Moler, Paul; Richards-Zawacki, Corinne L

    2012-01-01

    Little is known about the impact that the pathogenic amphibian chytrid fungus, Batrachochytrium dendrobatidis (Bd), has on fully aquatic salamander species of the eastern United States. As a first step in determining the impacts of Bd on these species, we aimed to determine the prevalence of Bd in wild populations of fully aquatic salamanders in the genera Amphiuma, Necturus, Pseudobranchus, and Siren. We sampled a total of 98 salamanders, representing nine species from sites in Florida, Mississippi, and Louisiana. Overall, infection prevalence was found to be 0.34, with significant differences among genera but no clear geographic pattern. We also found evidence for seasonal variation, but additional sampling throughout the year is needed to clarify this pattern. The high rate of infection discovered in this study is consistent with studies of other amphibians from the southeastern United States. Coupled with previously published data on life histories and population densities, the results presented here suggest that fully aquatic salamanders may be serving as important vectors of Bd and the interaction between these species and Bd warrants additional research.

  1. A survey for Batrachochytrium dendrobatidis in endangered and highly susceptible Vietnamese salamanders (Tylototriton spp.).

    PubMed

    Thien, Tao Nguyen; Martel, An; Brutyn, Melanie; Bogaerts, Sergé; Sparreboom, Max; Haesebrouck, Freddy; Fisher, Matthew C; Beukema, Wouter; Van, Tang Duong; Chiers, Koen; Pasmans, Frank

    2013-09-01

    Until now, Asian amphibians appear to have largely escaped declines driven by chytridiomycosis. Vietnamese salamanders that belong to the genus Tylototriton are rare and have a patchy distribution in mountainous areas, falling within the proposed environmental envelope of chytrid infections, surrounded by Batrachochytrium dendrobatidis infected regions. If these salamanders are susceptible to chytridiomycosis, then their populations could be highly vulnerable after the introduction of B. dendrobatidis. Examination for the presence of the chytrid fungus in skin swabs from 19 Tylototriton asperrimus and 104 Tylototriton vietnamensis by using quantitative polymerase chain reaction was performed. Susceptibility of T. asperrimus to experimental infection by using the global panzootic lineage (BdGPL) strain of B. dendrobatidis was examined. The fungus was absent in all samples from all wild salamanders examined. Inoculation with the BdGPL strain resulted in mortality of all five inoculated salamanders within 3 weeks after inoculation with infected animals that manifested severe orthokeratotic hyperkeratosis, epidermal hyperplasia, and spongiosis. Although infection by B. dendrobatidis currently appears absent in Vietnamese Tylototriton populations, the rarity of these animals, their pronounced susceptibility to chytridiomycosis, an apparently suitable environmental context and increasing likelihood of the pathogen being introduced, together suggest the need of urgent measures to avoid future scenarios of extinction as witnessed in Central America and Australia.

  2. The Amphibian Chytrid Fungus, Batrachochytrium dendrobatidis, in Fully Aquatic Salamanders from Southeastern North America

    PubMed Central

    Chatfield, Matthew W. H.; Moler, Paul; Richards-Zawacki, Corinne L.

    2012-01-01

    Little is known about the impact that the pathogenic amphibian chytrid fungus, Batrachochytrium dendrobatidis (Bd), has on fully aquatic salamander species of the eastern United States. As a first step in determining the impacts of Bd on these species, we aimed to determine the prevalence of Bd in wild populations of fully aquatic salamanders in the genera Amphiuma, Necturus, Pseudobranchus, and Siren. We sampled a total of 98 salamanders, representing nine species from sites in Florida, Mississippi, and Louisiana. Overall, infection prevalence was found to be 0.34, with significant differences among genera but no clear geographic pattern. We also found evidence for seasonal variation, but additional sampling throughout the year is needed to clarify this pattern. The high rate of infection discovered in this study is consistent with studies of other amphibians from the southeastern United States. Coupled with previously published data on life histories and population densities, the results presented here suggest that fully aquatic salamanders may be serving as important vectors of Bd and the interaction between these species and Bd warrants additional research. PMID:22984569

  3. Stream salamander species richness and abundance in relation to environmental factors in Shenandoah National Park, Virginia

    USGS Publications Warehouse

    Campbell Grant, Evan H.; Jung, Robin E.; Rice, Karen C.

    2005-01-01

    Stream salamanders are sensitive to acid mine drainage and may be sensitive to acidification and low acid neutralizing capacity (ANC) of a watershed. Streams in Shenandoah National Park, Virginia, are subject to episodic acidification from precipitation events. We surveyed 25 m by 2 m transects located on the stream bank adjacent to the water channel in Shenandoah National Park for salamanders using a stratified random sampling design based on elevation, aspect and bedrock geology. We investigated the relationships of four species (Eurycea bislineata, Desmognathus fuscus, D. monticola and Gyrinophilus porphyriticus) to habitat and water quality variables. We did not find overwhelming evidence that stream salamanders are affected by the acid-base status of streams in Shenandoah National Park. Desmognathus fuscus and D. monticola abundance was greater both in streams that had a higher potential to neutralize acidification, and in higher elevation (>700 m) streams. Neither abundance of E. bislineata nor species richness were related to any of the habitat variables. Our sampling method preferentially detected the adult age class of the study species and did not allow us to estimate population sizes. We suggest that continued monitoring of stream salamander populations in SNP will determine the effects of stream acidification on these taxa.

  4. Salamander occupancy in headwater stream networks

    USGS Publications Warehouse

    Grant, E.H.C.; Green, L.E.; Lowe, W.H.

    2009-01-01

    1. Stream ecosystems exhibit a highly consistent dendritic geometry in which linear habitat units intersect to create a hierarchical network of connected branches. 2. Ecological and life history traits of species living in streams, such as the potential for overland movement, may interact with this architecture to shape patterns of occupancy and response to disturbance. Specifically, large-scale habitat alteration that fragments stream networks and reduces connectivity may reduce the probability a stream is occupied by sensitive species, such as stream salamanders. 3. We collected habitat occupancy data on four species of stream salamanders in first-order (i.e. headwater) streams in undeveloped and urbanised regions of the eastern U.S.A. We then used an information-theoretic approach to test alternative models of salamander occupancy based on a priori predictions of the effects of network configuration, region and salamander life history. 4. Across all four species, we found that streams connected to other first-order streams had higher occupancy than those flowing directly into larger streams and rivers. For three of the four species, occupancy was lower in the urbanised region than in the undeveloped region. 5. These results demonstrate that the spatial configuration of stream networks within protected areas affects the occurrences of stream salamander species. We strongly encourage preservation of network connections between first-order streams in conservation planning and management decisions that may affect stream species.

  5. Linking the evolution of habitat choice to ecosystem functioning: direct and indirect effects of pond-reproducing fire salamanders on aquatic-terrestrial subsidies.

    PubMed

    Reinhardt, Timm; Steinfartz, Sebastian; Paetzold, Achim; Weitere, Markus

    2013-09-01

    Shifts in life history traits and in the behaviour of species can potentially alter ecosystem functioning. The reproduction of the central European fire salamander (Salamandra salamandra), which usually deposits its larvae in first-order streams, in small pool and pond-like habitats, is an example of a recent local adaptation in this species. Here we aimed to quantify the direct and indirect effects of the predatory larvae on the aquatic food webs in the ponds and on the flux of matter between the ponds and adjacent terrestrial habitats. Our estimates are based on biomass data of the present pond fauna as well as on the analysis of stomach content data, growth rates and population dynamics of the salamander larvae in pond habitats. By their deposition of larvae in early spring, female fire salamanders import between 0.07 and 2.86 g dry mass m(-2) larval biomass into the ponds. Due to high mortality rates in the larval phase and the relatively small size at metamorphosis of the pond-adapted salamanders compared to stream-adapted ones, the biomass export of the metamorphosed salamanders clearly falls below the initial biomass import. Catastrophic events such as high water temperatures and low oxygen levels may even occasionally result in mass mortalities of salamander larvae and thus in a net 100 % import of the salamander biomass into the pond food webs. Indirect effects further accelerate this net import of matter into the aquatic habitat, e.g. the feeding of salamanders on aquatic insect larvae with the emergence of terrestrial adults-thus preventing export-and on terrestrial organisms that fall on the water surface (supporting import). This study demonstrates that the adaptation of salamanders to pond reproduction can alter food web linkages across ecosystem boundaries by enhancing the flux of materials and energy from terrestrial (i.e. forest) to the aquatic (i.e. pond) habitat.

  6. The First Salamander Defensin Antimicrobial Peptide

    PubMed Central

    Jiang, Ke; Rong, Mingqiang; Lai, Ren

    2013-01-01

    Antimicrobial peptides have been widely identified from amphibian skins except salamanders. A novel antimicrobial peptide (CFBD) was isolated and characterized from skin secretions of the salamander, Cynops fudingensis. The cDNA encoding CFBD precursor was cloned from the skin cDNA library of C. fudingensis. The precursor was composed of three domains: signal peptide of 17 residues, mature peptide of 41 residues and intervening propeptide of 3 residues. There are six cysteines in the sequence of mature CFBD peptide, which possibly form three disulfide-bridges. CFBD showed antimicrobial activities against Staphylococcus aureus, Bacillus subtilis, Candida albicans and Escherichia coli. This peptide could be classified into family of β-defensin based on its seqeuence similarity with β-defensins from other vertebrates. Evolution analysis indicated that CFBD was close to fish β-defensin. As far as we know, CFBD is the first β-defensin antimicrobial peptide from salamanders. PMID:24386139

  7. The first salamander defensin antimicrobial peptide.

    PubMed

    Meng, Ping; Yang, Shilong; Shen, Chuanbin; Jiang, Ke; Rong, Mingqiang; Lai, Ren

    2013-01-01

    Antimicrobial peptides have been widely identified from amphibian skins except salamanders. A novel antimicrobial peptide (CFBD) was isolated and characterized from skin secretions of the salamander, Cynops fudingensis. The cDNA encoding CFBD precursor was cloned from the skin cDNA library of C. fudingensis. The precursor was composed of three domains: signal peptide of 17 residues, mature peptide of 41 residues and intervening propeptide of 3 residues. There are six cysteines in the sequence of mature CFBD peptide, which possibly form three disulfide-bridges. CFBD showed antimicrobial activities against Staphylococcus aureus, Bacillus subtilis, Candida albicans and Escherichia coli. This peptide could be classified into family of β-defensin based on its sequence similarity with β-defensins from other vertebrates. Evolution analysis indicated that CFBD was close to fish β-defensin. As far as we know, CFBD is the first β-defensin antimicrobial peptide from salamanders.

  8. Evolution of gigantism in amphiumid salamanders.

    PubMed

    Bonett, Ronald M; Chippindale, Paul T; Moler, Paul E; Van Devender, R Wayne; Wake, David B

    2009-05-20

    The Amphiumidae contains three species of elongate, permanently aquatic salamanders with four diminutive limbs that append one, two, or three toes. Two of the species, Amphiuma means and A. tridactylum, are among the largest salamanders in the world, reaching lengths of more than one meter, whereas the third species (A. pholeter), extinct amphiumids, and closely related salamander families are relatively small. Amphiuma means and A. tridactylum are widespread species and live in a wide range of lowland aquatic habitats on the Coastal Plain of the southeastern United States, whereas A. pholeter is restricted to very specialized organic muck habitats and is syntopic with A. means. Here we present analyses of sequences of mitochondrial and nuclear loci from across the distribution of the three taxa to assess lineage diversity, relationships, and relative timing of divergence in amphiumid salamanders. In addition we analyze the evolution of gigantism in the clade. Our analyses indicate three lineages that have diverged since the late Miocene, that correspond to the three currently recognized species, but the two gigantic species are not each other's closest relatives. Given that the most closely related salamander families and fossil amphiumids from the Upper Cretaceous and Paleocene are relatively small, our results suggest at least two extreme changes in body size within the Amphuimidae. Gigantic body size either evolved once as the ancestral condition of modern amphiumas, with a subsequent strong size reduction in A. pholeter, or gigantism independently evolved twice in the modern species, A. means and A. tridactylum. These patterns are concordant with differences in habitat breadth and range size among lineages, and have implications for reproductive isolation and diversification of amphiumid salamanders.

  9. Social monogamy in a territorial salamander.

    PubMed

    Gillette; Jaeger; Peterson

    2000-06-01

    Social monogamy, which does not necessarily imply mating or genetic monogamy, is important in the formation of male-female pair associations. We operationally define social monogamy as occurring when two heterosexual adults, exclusive of kin-directed behaviour, direct significantly less aggression and significantly more submission towards each other, and/or spend significantly more time associating with each other relative to other adult heterosexual conspecifics. Long-term pair associations (i.e. those lasting through a lengthy breeding season) that are characteristic of social monogamy are common in some taxa but are virtually unknown in amphibians. Recent studies, however, have suggested that red-backed salamanders, Plethodon cinereus, have complex (for amphibians) social systems. Our laboratory experiments tested the hypothesis that red-backed salamanders found in pairs in the forest display behaviours consistent with social monogamy. During the summer noncourtship season, newly collected male-females pairs showed no preference to associate with their partners more than with a novel conspecific of the opposite sex. However, during the autumn courtship season, paired males and females significantly directed preferential behaviours towards their partners rather than towards a surrogate or a novel paired salamander. Focal animals showed no significant preferences when presented with their partner and a novel single salamander, but they never directed preferential behaviours towards a novel salamander (whether paired or single) or a surrogate. These results are the first to suggest that a salamander species engages in social monogamy. Furthermore, our results suggest that social monogamy may not inhibit paired males and females from displaying alternative strategies: preferring partners when extrapair associations may be disadvantageous (i.e. the extrapair animal is already paired) but not preferring partners when extrapair associations may be advantageous (i

  10. Evolution of Gigantism in Amphiumid Salamanders

    PubMed Central

    Bonett, Ronald M.; Chippindale, Paul T.; Moler, Paul E.; Van Devender, R. Wayne; Wake, David B.

    2009-01-01

    The Amphiumidae contains three species of elongate, permanently aquatic salamanders with four diminutive limbs that append one, two, or three toes. Two of the species, Amphiuma means and A. tridactylum, are among the largest salamanders in the world, reaching lengths of more than one meter, whereas the third species (A. pholeter), extinct amphiumids, and closely related salamander families are relatively small. Amphiuma means and A. tridactylum are widespread species and live in a wide range of lowland aquatic habitats on the Coastal Plain of the southeastern United States, whereas A. pholeter is restricted to very specialized organic muck habitats and is syntopic with A. means. Here we present analyses of sequences of mitochondrial and nuclear loci from across the distribution of the three taxa to assess lineage diversity, relationships, and relative timing of divergence in amphiumid salamanders. In addition we analyze the evolution of gigantism in the clade. Our analyses indicate three lineages that have diverged since the late Miocene, that correspond to the three currently recognized species, but the two gigantic species are not each other's closest relatives. Given that the most closely related salamander families and fossil amphiumids from the Upper Cretaceous and Paleocene are relatively small, our results suggest at least two extreme changes in body size within the Amphuimidae. Gigantic body size either evolved once as the ancestral condition of modern amphiumas, with a subsequent strong size reduction in A. pholeter, or gigantism independently evolved twice in the modern species, A. means and A. tridactylum. These patterns are concordant with differences in habitat breadth and range size among lineages, and have implications for reproductive isolation and diversification of amphiumid salamanders. PMID:19461997

  11. Phylogenetic relationships of the endangered Shenandoah salamander (Plethodon shenandoah) and other salamanders of the Plethodon cinereus group (Caudata : Plethodontidae)

    USGS Publications Warehouse

    Sites, J.W.; Morando, M.; Highton, R.; Huber, F.; Jung, R.E.

    2004-01-01

    The Shenandoah salamander (Plethodon shenandoah), known from isolated talus slopes on three of the highest mountains in Shenandoah National Park, is listed as state-endangered in Virginia and federally endangered under the U.S. Endangered Species Act. A 1999 paper by G. R. Thurow described P. shenandoah-like salamanders from three localities further south in the Blue Ridge Physiographic Province, which, if confirmed, would represent a range extension for P. shenandoah of approximately 90 km from its nearest known locality. Samples collected from two of these three localities were included in a molecular phylogenetic study of the known populations of P. shenandoah, and all other recognized species in the Plethodon cinereus group, using a 792 bp region of the mitochondrial cytochrome-b gene. Phylogenetic estimates were based on Bayesian, maximum likelihood, and maximum parsimony methods and topologies examined for placement of the new P. shenandoah-like samples relative to all others. All topologies recovered all haplotypes of the P. shenandoah-like animals nested within P. cinereus, and a statistical comparison of the best likelihood tree topology with one with an enforced (Thurow + Shenandoah P. shenandoah) clade revealed that the unconstrained tree had a significantly lower -In L score (P < 0.05, using the Shimodaira-Hasegawa test) than the constraint tree. This result and other anecdotal information give us no solid reason to consider the Thurow report valid. The current recovery program for P. shenandoah should remain focused on populations in Shenandoah National Park.

  12. Antifungal Bacteria on Woodland Salamander Skin Exhibit High Taxonomic Diversity and Geographic Variability.

    PubMed

    Muletz-Wolz, Carly R; DiRenzo, Graziella V; Yarwood, Stephanie A; Campbell Grant, Evan H; Fleischer, Robert C; Lips, Karen R

    2017-05-01

    role for these salamanders.IMPORTANCE Amphibians harbor skin bacteria that can kill an amphibian fungal pathogen, Batrachochytrium dendrobatidis Some amphibians die from B. dendrobatidis infection, whereas others do not. The bacteria that can kill B. dendrobatidis, called anti-B. dendrobatidis bacteria, are thought to influence the B. dendrobatidis infection outcome for the amphibian. Yet how anti-B. dendrobatidis bacterial species vary among amphibian species and populations is unknown. We determined the distribution of anti-B. dendrobatidis bacterial species among three salamander species (n = 61) sampled at three localities. We identified 50 unique anti-B. dendrobatidis bacterial species and found that all of the tested salamanders were negative for B. dendrobatidis Five anti-B. dendrobatidis bacterial species were commonly detected, suggesting a stable, functional association with these salamanders. The number of anti-B. dendrobatidis bacteria per individual varied among localities but not among co-occurring salamander species, demonstrating that environment is more influential than host factors in structuring the anti-B. dendrobatidis bacterial community. These anti-B. dendrobatidis bacteria may serve a protective function for their salamander hosts. Copyright © 2017 American Society for Microbiology.

  13. Biodeterioration of marble in an underwater environment.

    PubMed

    Cámara, Beatriz; de Buergo, Mónica Álvarez; Bethencourt, Manuel; Fernández-Montblanc, Tomás; La Russa, Mauro F; Ricca, Michela; Fort, Rafael

    2017-12-31

    This study examines the deterioration of geomaterials used throughout history that today may be found lying on the ocean floor. Submerged archaeological sites including cargoes from shipwrecks or ancient city ruins have been a topic of interest from a perspective of in situ musealization, as a way of making underwater cultural heritage accessible to the public. In an experimental study conducted at an underwater archaeological site in the Bay of Cádiz (SW Spain), we subjected two types of marble (Carrara and Macael) to three conditions to which submerged archaeological objects are often exposed: full exposure to the water column, natural processes of burial and unearthing, or permanent burial. After an 18-month study period, the factor found to mostly affect these materials was their biological colonization. This factor was assessed by estimating total surface biocover and the rate of surface biocolonization, and also through the identification of skeletons and associated alteration forms by light microscopy, and scanning electron microscopy (SEM). Biofouling and bioerosion were the main causes of biodeterioration and dependent on the position of the marble specimens in the seawater. The response of both materials was similar, though dolomite crystals in the Carrara marble acted as a protective barrier against actively penetrating microorganisms. These investigations have allowed the study of tracers left by epilithic encrusting organisms and endolithic bioeroders on marbles intentionally exposed to seawater, providing new insights to the understanding of the biodeterioration processes occurring in cultural heritage stones, with significant implications when they are part of underwater archaeological remains. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Context-dependent movement behavior of woodland salamanders (Plethodon) in two habitat types.

    PubMed

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Animal movement is critical to the maintenance of functional connectivity at the landscape scale and can play a key role in population persistence and metapopulation dynamics. The permeability of habitat to animal movement may vary as a result of either differential mortality, physical resistance, or simply the behavioral responses of organisms to perceived habitat quality. Understanding how and when animal movement behavior varies among habitat types is critical for identifying barriers to dispersal and predicting species distributions in relation to landscape features. We conducted an experimental translocation study and compared the movement success and behavioral strategies of plethodontid salamanders in both forest and open-canopy habitat. We found that individuals in closed-canopy forest oriented more strongly towards their home ranges and moved significantly farther on their release night. In spite of the clear differences in movement paths, the ultimate movement success of homing salamanders did not appear to vary with habitat type. Our study contributes to a growing body of literature suggesting the importance of recognizing the context dependence of animal movement behavior. Because the movement rates of displaced salamanders were significantly reduced in open-canopy, dispersal rates of plethodontid salamanders in open-canopy habitat are likely lower than in control forest. Further mechanistic studies focusing on habitat-specific movement behavior and survival costs will be valuable for effectively identifying and mitigating barriers to animal movement.

  15. Cutaneous Bacteria of the Redback Salamander Prevent Morbidity Associated with a Lethal Disease

    PubMed Central

    Becker, Matthew H.; Harris, Reid N.

    2010-01-01

    Chytridiomycosis, caused by the fungal pathogen Batrachochytrium dendrobatidis (Bd), is an infectious disease that causes population declines of many amphibians. Cutaneous bacteria isolated from redback salamanders, Plethodon cinereus, and mountain yellow-legged frogs, Rana muscosa, inhibit the growth of Bd in vitro. In this study, the bacterial community present on the skin of P. cinereus individuals was investigated to determine if it provides protection to salamanders from the lethal and sub-lethal effects of chytridiomycosis. When the cutaneous bacterial community was reduced prior to Bd exposure, salamanders experienced a significantly greater decrease in body mass, which is a symptom of the disease, when compared to infected individuals with a normal bacterial community. In addition, a greater proportion of infected individuals with a reduced bacterial community experienced limb-lifting, a behavior seen only in infected individuals. Overall, these results demonstrate that the cutaneous bacterial community of P. cinereus provides protection to the salamander from Bd and that alteration of this community can change disease resistance. Therefore, symbiotic microbes associated with this species appear to be an important component of its innate skin defenses. PMID:20532032

  16. Cutaneous bacteria of the redback salamander prevent morbidity associated with a lethal disease.

    PubMed

    Becker, Matthew H; Harris, Reid N

    2010-06-04

    Chytridiomycosis, caused by the fungal pathogen Batrachochytrium dendrobatidis (Bd), is an infectious disease that causes population declines of many amphibians. Cutaneous bacteria isolated from redback salamanders, Plethodon cinereus, and mountain yellow-legged frogs, Rana muscosa, inhibit the growth of Bd in vitro. In this study, the bacterial community present on the skin of P. cinereus individuals was investigated to determine if it provides protection to salamanders from the lethal and sub-lethal effects of chytridiomycosis. When the cutaneous bacterial community was reduced prior to Bd exposure, salamanders experienced a significantly greater decrease in body mass, which is a symptom of the disease, when compared to infected individuals with a normal bacterial community. In addition, a greater proportion of infected individuals with a reduced bacterial community experienced limb-lifting, a behavior seen only in infected individuals. Overall, these results demonstrate that the cutaneous bacterial community of P. cinereus provides protection to the salamander from Bd and that alteration of this community can change disease resistance. Therefore, symbiotic microbes associated with this species appear to be an important component of its innate skin defenses.

  17. Anciet marble quarries in Lesvos island Greece

    NASA Astrophysics Data System (ADS)

    Mataragkas, M.; Mataragkas, D.

    2009-04-01

    ANCIENT MARBLE QUARRIES IN LESBOS ISLAND, GREECE Varti- Matarangas M.1 & Matarangas D. 1 Institute of Geological and Mining Exploration (IGME), Olympic Village, Entrance C, ACHARNAE 13677, GREECE myrsini@igme.gr , myrsini@otenet.g r A B S T R A C T Ten ancient marble quarries of Lesbos Island, most of them previously unknown, have been studied, in the frame of the research study on the ancient marble quarries in the Aegean Sea. In the present paper the geological, petrological and morphological features of the aforementioned quarries are examined. Concerning the six ancient quarries located in the areas of Tarti, Agia Paraskevi (Tsaf), Mageiras, Loutra, Latomi (Plomari) and Thermi, the authochthonous neopaleozoic unit constitutes their geological formation, while their hosting lithological formations are the included crystalline limestone lens like beds. In two ancient quarries in the areas Moria and Alyfanta, the geological formation is the authochthonous upper Triassic series and the hosting lithological formation the upper Triassic carbonate sequence, while in the areas of Akrasi-Abeliko and Karyni, the geological formation is the thrust Triassic unit and the lithological hosting formations are the included strongly deformed or not crystalline limestone lenticular beds. Furthermore, the petrographic features were also determined permitting the identification of the building stones that have been used.

  18. Spatial and temporal patterns of Ambystoma tigrinum virus (ATV) prevalence in tiger salamanders Ambystoma tigrinum nebulosum.

    PubMed

    Greer, Amy L; Brunner, Jesse L; Collins, James P

    2009-05-27

    Amphibian ranaviruses have been documented as causes of mass mortality in amphibian populations throughout the world. The temporal and spatial dynamics of ranavirus infections when epidemics are not apparent remains unclear. To address this question, we collected tissue samples from 2003 to 2006 in 4 geographically separated tiger salamander Ambystoma tigrinum nebulosum host populations on the Kaibab Plateau in northern Arizona. We tested for Ambystoma tigrinum virus (ATV), a lethal ranavirus of tiger salamanders, calculated ATV prevalence for each sampling date, and examined temporal and spatial patterns by quantifying the annual level of ATV synchrony among populations using the intraclass correlation coefficient. Salamander populations were commonly infected with ATV. We observed no morbidity or mortality in these populations even as ATV prevalence values varied from 0 to 57%. Infection prevalence across the landscape was more similar within a given year than between years. There was no statistically significant spatial pattern in prevalence across the landscape. Our findings highlight the need to explore new hypotheses regarding the population level impact of these pathogens on amphibian communities.

  19. Study of marble deterioration at City Hall, Schenectady, NY

    SciTech Connect

    Cheng, R.J.; Castillo, R.

    1984-01-01

    The effects of air pollution and acid precipitation were investigated as causing the erosion of marble. The research indicated that the marble grains are being structurally weakened by a chemical conversion process of marble to gypsum crystals. The surface zone of chemical activity (2-5 mm) shows the presence of fly ash and iron particles, and points to the possibility of a catalytic mechanism for the conversion of sulfur dioxide to sulfate.

  20. Macrophages are required for adult salamander limb regeneration.

    PubMed

    Godwin, James W; Pinto, Alexander R; Rosenthal, Nadia A

    2013-06-04

    The failure to replace damaged body parts in adult mammals results from a muted growth response and fibrotic scarring. Although infiltrating immune cells play a major role in determining the variable outcome of mammalian wound repair, little is known about the modulation of immune cell signaling in efficiently regenerating species such as the salamander, which can regrow complete body structures as adults. Here we present a comprehensive analysis of immune signaling during limb regeneration in axolotl, an aquatic salamander, and reveal a temporally defined requirement for macrophage infiltration in the regenerative process. Although many features of mammalian cytokine/chemokine signaling are retained in the axolotl, they are more dynamically deployed, with simultaneous induction of inflammatory and anti-inflammatory markers within the first 24 h after limb amputation. Systemic macrophage depletion during this period resulted in wound closure but permanent failure of limb regeneration, associated with extensive fibrosis and disregulation of extracellular matrix component gene expression. Full limb regenerative capacity of failed stumps was restored by reamputation once endogenous macrophage populations had been replenished. Promotion of a regeneration-permissive environment by identification of macrophage-derived therapeutic molecules may therefore aid in the regeneration of damaged body parts in adult mammals.

  1. Evidence for Sex Chromosome Turnover in Proteid Salamanders.

    PubMed

    Sessions, Stanley K; Bizjak Mali, Lilijana; Green, David M; Trifonov, Vladimir; Ferguson-Smith, Malcolm

    2016-01-01

    A major goal of genomic and reproductive biology is to understand the evolution of sex determination and sex chromosomes. Species of the 2 genera of the Salamander family Proteidae - Necturus of eastern North America, and Proteus of Southern Europe - have similar-looking karyotypes with the same chromosome number (2n = 38), which differentiates them from all other salamanders. However, Necturus possesses strongly heteromorphic X and Y sex chromosomes that Proteus lacks. Since the heteromorphic sex chromosomes of Necturus were detectable only with C-banding, we hypothesized that we could use C-banding to find sex chromosomes in Proteus. We examined mitotic material from colchicine-treated intestinal epithelium, and meiotic material from testes in specimens of Proteus, representing 3 genetically distinct populations in Slovenia. We compared these results with those from Necturus. We performed FISH to visualize telomeric sequences in meiotic bivalents. Our results provide evidence that Proteus represents an example of sex chromosome turnover in which a Necturus-like Y-chromosome has become permanently translocated to another chromosome converting heteromorphic sex chromosomes to homomorphic sex chromosomes. These results may be key to understanding some unusual aspects of demographics and reproductive biology of Proteus, and are discussed in the context of models of the evolution of sex chromosomes in amphibians.

  2. Atrazine increases ranavirus susceptibility in the tiger salamander, Ambystoma tigrinum.

    PubMed

    Forson, Diane Denise; Storfer, Andrew

    2006-12-01

    Pathogenic diseases and environmental contaminants are two of the leading hypotheses for global amphibian declines, yet few studies have examined the influence of contaminants on disease susceptibility. In this study, we examined effects of ecologically relevant doses of atrazine (0, 1.6, 16, and 160 microg/L), sodium nitrate (0, 6.8, 68 mg/L), and their interactions on susceptibility of four laboratory-bred tiger salamander families to Ambystoma tigrinum virus (ATV), a pathogen implicated in global amphibian die-offs. Salamanders were from Arizona populations where a coevolutionary history with ATV is supported, and thus cofactors rather than recent introduction may contribute to disease epizootics. Use of atrazine and nitrogenous fertilizers are ubiquitous; therefore, the impact of these cofactors on disease susceptibility is an important consideration. Atrazine and sodium nitrate significantly decreased peripheral leukocyte levels, suggesting an impact of these contaminants on the immune system. As expected from this result, atrazine significantly increased susceptibility of larvae to ATV infection. In contrast, nitrate had a marginally significant main effect and significantly decreased infection rate at the highest level. However, neither atrazine nor sodium nitrate had significant effects on viral copy number per individual. These results suggest that ecologically relevant concentrations of atrazine and nitrates have immunosuppressive effects, and atrazine may contribute to ATV epizootics, raising concerns about the influence of contaminants on diseases in general.

  3. Conservation genetics of the endangered Shenandoah salamander (Plethodon shenandoah, Plethodontidae)

    USGS Publications Warehouse

    Carpenter, D.W.; Jung, R.E.; Sites, J.W.

    2001-01-01

    The Shenandoah salamander (Plethodon shenandoah) is restricted to three isolated talus outcrops in Shenandoah National Park, VA, USA and has one of the smallest ranges of any tetrapod vertebrate. This species was listed as endangered under the US Endangered Species Act in 1989 over concern that direct competition with the red-backed salamander (Plethodon cinereus), successional habitat changes, and human impacts may cause its decline and possible extinction. We address two issues herein: (1) whether extensive introgression (through long-term hybridization) is present between the two species and threatens the survival of P. shenandoah, and (2) the level of population structure within P. shenandoah. We provide evidence from mtDNA haplotypes that shows no genetic differentiation among the three isolates of P. shenandoah, suggesting that their fragmentation is a geologically recent event, and/or that the isolates are still connected by occasional gene flow. There is also no evidence for extensive introgression of alleles in either direction between P. cinereus and P. shenandoah, which suggests that P. shenandoah may not be in danger of being genetically swamped out through hybridization with P. cinereus.

  4. Experimental infection of native north Carolina salamanders with Batrachochytrium dendrobatidis.

    PubMed

    Chinnadurai, Sathya K; Cooper, David; Dombrowski, Daniel S; Poore, Matthew F; Levy, Michael G

    2009-07-01

    Chytridiomycosis is an often fatal fungal disease of amphibians caused by Batrachochytrium dendrobatidis. This disease has been implicated in the worldwide decline of many anuran species, but studies of chytridiomycosis in wild salamanders are limited. Between August 2006 and December 2006, we tested wild amphibians in North Carolina, USA (n=212) by polymerase chain reaction (PCR). We identified three PCR-positive animals: one Rana clamitans and two Plethodontid salamanders. We experimentally infected two species of native North Carolina Plethodontid salamanders, the slimy salamander (Plethodon glutinosus) and the Blue Ridge Mountain dusky salamander (Desmognathus orestes) with 1,000,000 zoospores of B. dendrobatidis per animal. Susceptibility was species dependent; all slimy salamanders developed clinical signs of chytridiomycosis, and one died, whereas dusky salamanders remained unaffected. In a second experiment, we challenged naïve slimy salamanders with either 10,000 or 100,000 motile zoospores per animal. Clinical signs consistent with chytridiomycosis were not observed at either dose or in uninfected controls during the 45 days of this experiment. All animals inoculated with B. dendrobatidis in both experiments, regardless of dose, tested positive by PCR. Our study indicates that slimy salamanders are more susceptible to clinical chytridiomycosis than dusky salamanders, and in a laboratory setting, a dose greater than 100,000 zoospores per animal is required to induce clinical disease. This study also indicates that PCR is a very sensitive tool for detecting B. dendrobatidis infection, even in animals that are clinically unaffected, thus positive results should be interpreted with caution.

  5. Tissue lesions of tiger salamanders (Ambystoma tigrinum): relationship to sewage effluents.

    PubMed

    Rose, F L

    1978-09-29

    A population of facultative neotenous tiger salamanders (A. tigrinum) inhabiting a sewage lagoon at Reese AFB, Hurlwood, Texas, was found to have an exceptionally high rate of spontaneous tissue lesions. The population is composed of an estimated 28,000 large, reproductively mature larvae that are restricted to the lagoon. Only about 17% of the population metamorphoses normally. In contrast, tiger salamanders from uncontaminated lagoons in the same general vicinity metamorphose normally; however, no neoplasms were discovered in larvae sampled from the nonsewage lagoosn. N-nitrosamine analyses of water and tissue samples of larvae were negative. Polycyclic aromatic hydrocarbon analyses revealed traces of benzo[a]pyrene in the sludge; however, perylene, a constituent of jet fuel, was found in high concentration (300 ppb). These results indicate tat preylene, which was previously found not be tumorigenic to mice and rats, should be retested as a possible agent for nonmammalian species.

  6. Interior view of Chapel with marble altar and wall panel ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Interior view of Chapel with marble altar and wall panel carved with crusader's sword design. - Flanders Field American Cemetery & Memorial, Chapel, Wortegemseweg 117, Waregem, West Flanders (Belgium)

  7. Identification of Euryhelmis costaricensis metacercariae in the skin of Tohoku hynobiid salamanders (Hynobius lichenatus), northeastern Honshu, Japan.

    PubMed

    Sato, Hiroshi; Ihara, Sadao; Inaba, Osamu; Une, Yumi

    2010-07-01

    Since 2000, cutaneous nodular lesions were observed in Tohoku hynobiid salamanders (Hynobius lichenatus) in the northern Abukuma Mountains, northeastern Honshu, Japan. The distribution of diseased salamanders has expanded, along with the increasing severity of the disease. Samples (foreleg, hindleg, and tail) from five diseased salamanders caught in the spring of 2009 contained 11 to 383 metacercarial cysts (0.43-0.48 mm in diameter) per individual. Experimental inoculations of the metacercariae into rats (Rattus norvegicus) resulted in the development of pentagonal adults with intrauterine eggs that were collected at 3 days, 2 wk, and 5 wk postinoculation. Although adults obtained from rats were smaller, the flukes were morphologically similar to Euryhelmis costaricensis, recorded from Japanese martens (Martes melampus) in northeastern Honshu. The ribosomal RNA gene sequences of the metacercariae collected from salamanders and the E. costaricensis collected from a Japanese marten were identical, confirming the morphology-based species identification. Environmental changes responsible for the increased frequency of diseased salamanders and the increased parasite load are unknown, although increases in feral populations of introduced raccoons (Procyon lotor) and American minks (Neovison vison) may be associated.

  8. On the ecological role of salamanders

    Treesearch

    Robert D. Davic; Hartwell H. Welsh Jr.

    2004-01-01

    Salamanders are cryptic and, though largely unrecognized as such, extremely abundant vertebrates in a variety of primarily forest and grassland environments, where they regulate food webs and contribute to ecosystem resilience-resistance (= stability) in several ways: (a) As mid-level vertebrate predators, they provide direct and indirect biotic control of species...

  9. Aneides ferreus (clouded salamander): arboreal activity

    Treesearch

    William W. Price; Clinton P. Landon; Eric D. Forsman

    2010-01-01

    Aneides ferreus (clouded salamander) inhabits the forests of western Oregon and extreme northwestern California. Although thought to be primarily terrestrial, A. ferreus has occasionally been found as high as 60 m up in trees and two recent reports suggest that it may be more arboreal than previously believed. However, it is...

  10. Ambient ultraviolet radiation causes mortality in salamander eggs

    SciTech Connect

    Blaustein, A.R.; Edmond, B.; Kiesecker, J.M.

    1995-08-01

    Previous research has shown that amphibian species have differential sensitivity to ultraviolet-B (UV-B) radiation. In some anuran species, ambient levels of UV-B cause mortality in embryonic stages and hatching success is significantly reduced. Projected increases in UV-B may affect an increasing number of species. The adverse effects of UV-B may eventually be manifested at the population level and may ultimately contribute to population declines. Using field experiments, we investigated the effects of ambient UV-B on salamander (Ambystoma gracile) embryos developing at natural oviposition sites. We show that the hatching success of eggs of A. gracile shielded from UV-B is significantly higher than those not shielded from UV-B. 27 refs., 1 fig.

  11. Evaluating Multi-Level Models to Test Occupancy State Responses of Plethodontid Salamanders.

    PubMed

    Kroll, Andrew J; Garcia, Tiffany S; Jones, Jay E; Dugger, Katie; Murden, Blake; Johnson, Josh; Peterman, Summer; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  12. Evaluating multi-level models to test occupancy state responses of Plethodontid salamanders

    USGS Publications Warehouse

    Kroll, Andrew J.; Garcia, Tiffany S.; Jones, Jay E.; Dugger, Catherine; Murden, Blake; Johnson, Josh; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  13. Evaluating Multi-Level Models to Test Occupancy State Responses of Plethodontid Salamanders

    PubMed Central

    Kroll, Andrew J.; Garcia, Tiffany S.; Jones, Jay E.; Dugger, Katie; Murden, Blake; Johnson, Josh; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  14. Dynamic Loading of Carrara Marble in a Heated State

    NASA Astrophysics Data System (ADS)

    Wong, Louis Ngai Yuen; Li, Zhihuan; Kang, Hyeong Min; Teh, Cee Ing

    2017-06-01

    Useable land is a finite space, and with a growing global population, countries have been exploring the use of underground space as a strategic resource to sustain the growth of their society and economy. However, the effects of impact loading on rocks that have been heated, and hence the integrity of the underground structure, are still not fully understood and has not been included in current design standards. Such scenarios include traffic accidents and explosions during an underground fire. This study aims to provide a better understanding of the dynamic load capacity of Carrara marble at elevated temperatures. Dynamic uniaxial compression tests are performed on Carrara marble held at various temperatures using a split-Hopkinson Pressure Bar (SHPB) setup with varying input force. A customized oven is included in the SHPB setup to allow for testing of the marble specimens in a heated state. After the loading test, a three-wave analysis is performed to obtain the dynamic stress-strain curve of the specimen under loading. The fragments of the failed specimens were also collected and dry-sieved to obtain the particle size distribution. The results reveal that the peak stress of specimens that have been heated is negatively correlated with the heating temperature. However, the energy absorbed by the specimens at peak stress at all temperatures is similar, indicating that a significant amount of energy is dissipated via plastic deformation. Generally, fragment size is also found to show a negative correlation with heating temperature and loading pressure. However, in some cases this relationship does not hold true, probably due to the occurrence of stress shadowing. Linear Elastic Fracture Mechanics has been found to be generally applicable to specimens tested at low temperatures; but at higher temperatures, Elastic-Plastic Fracture Mechanics will give a more accurate prediction. Another contribution of this study is to show that other than the peak stress of the

  15. ON ganglion cells are intrinsically photosensitive in the tiger salamander retina.

    PubMed

    Rajaraman, Kaveri

    2012-01-01

    Intrinsically photosensitive retinal ganglion cells (ipRGCs) have been well characterized in mammalian systems, both morphologically and electrophysiologically. They show slow, sustained responses to bright light in the absence of photoreceptor-based input, mediated by the photopigment melanopsin. Only one mammalian melanopsin gene is expressed in a small fraction of the retinal ganglion cell population, but there are two genes for melanopsin among nonmammalian vertebrates that are widely expressed in a variety of retinal and extraretinal cell types, along with other photosensitive pigments. The current study provides an electrophysiological study of ipRGCs in the larval tiger salamander (Ambystoma tigrinum), a nonmammalian vertebrate with a well-characterized retina. The results show that the ipRGC population is equivalent to the ON ganglion cell population in the tiger salamander retina. This sheds light on the evolutionary trajectory and functional significance of intrinsic photosensitivity through the vertebrate lineage and also affects our understanding of ON cell activity and development. We have characterized the nature of the intrinsic responses of the ON cell population, compared intrinsic and synaptically based receptive fields, and quantified the spectrum of the intrinsic activity. A wider action spectrum of intrinsic photosensitivity was obtained than would be expected for a single opsin photopigment, suggesting the expression of multiple photopigments in the salamander ipRGC. J. Comp. Neurol., 2012. © 2011 Wiley Periodials, Inc.

  16. Unexpected Rarity of the Pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957–2011

    PubMed Central

    Muletz, Carly; Caruso, Nicholas M.; Fleischer, Robert C.; McDiarmid, Roy W.; Lips, Karen R.

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957–987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957–2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1–0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection. PMID:25084159

  17. Unexpected rarity of the pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957-2011.

    PubMed

    Muletz, Carly; Caruso, Nicholas M; Fleischer, Robert C; McDiarmid, Roy W; Lips, Karen R

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957-987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957-2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1-0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection.

  18. Distribution of the Sonora Tiger Salamander (Ambystoma mavortium stebbinsi) in Mexico

    USGS Publications Warehouse

    Hossack, Blake R.; Muths, Erin L.; Rorabaugh, James C.; Lemos Espinal, Julio A.; Sigafus, Brent H.; Chambert, Thierry A; Carreon Arroyo, Gerardo; Hurtado Felix, David; Toyos Martinez, Daniel; Jones, Thomas R.

    2016-01-01

    The Sonoran Tiger Salamander (Ambystoma mavortium stebbinsi Lowe, 1954) was listed as federally endangered in the USA in 1997 (USFWS 1997). In the USA, the distribution of A. mavortium stebbinsi is limited to the San Rafael Valley (approximately 567 km2), between the Sierra San Antonio (called the Patagonia Mountains in Arizona) and Huachuca Mountains, and south of the Canelo Hills, Arizona (Fig. 1). The USA listing was triggered by loss of natural wetland habitats, threats from invasive predators, frequent die-offs from disease, introgression with the introduced Barred Tiger Salamander (A. mavortium mavortium), and small range and number of breeding sites that increases susceptibility to stochastic events (USFWS 1997). Small population sizes and limited gene flow have caused inbreeding, which may further reduce population viability and the potential for recovery (Jones et al. 1988; Storfer et al. 2014). 

  19. Intracapsular algae provide fixed carbon to developing embryos of the salamander Ambystoma maculatum.

    PubMed

    Graham, Erin R; Fay, Scott A; Davey, Adam; Sanders, Robert W

    2013-02-01

    Each spring, North American spotted salamander (Ambystoma maculatum) females each lay hundreds of eggs in shallow pools of water. Eggs are surrounded by jelly layers and are deposited as large gelatinous masses. Following deposition, masses are penetrated by a mutualistic green alga, Oophila amblystomatis, which enters individual egg capsules, proliferates and aggregates near the salamander embryo, providing oxygen that enhances development. We examined the effects of population density of intracapsular O. amblystomatis on A. maculatum embryos and show that larger algal populations promote faster embryonic growth and development. Also, we show that carbon fixed by O. amblystomatis is transferred to the embryos, providing the first evidence of direct translocation of photosynthate from a symbiont to a vertebrate host.

  20. Immunocytochemical analysis of cholinergic amacrine cells in the tiger salamander retina.

    PubMed

    Zhang, J; Wu, S M

    2001-05-25

    Cholinergic amacrine cells in the tiger salamander retina were observed for the first time by using antibodies against choline acetyltransferase (ChAT). ChAT-immunoreactive cells were present in the inner nuclear layer (INL) and in the ganglion cell layer (GCL), and the somas of the former population (average diameter = 15.13 microm) were slightly smaller than those of the latter population (average diameter = 16.42 microm). The processes of these cells form two distinct narrow bands in the inner plexiform layer (IPL), one located near 0.2 inner plexiform units (IU) and the other near 0.65-0.7 IU. Soma size, cell density and spatial distribution of ChAT-positive cells were quantitatively analyzed. Our results suggest that cholinergic amacrine cells in the salamander retina are very similar to their counter parts in other species, and they can be used as a model system for studying cholinergic functions in the visual system.

  1. Blue Marble Space Institute essay contest

    NASA Astrophysics Data System (ADS)

    Wendel, JoAnna

    2014-04-01

    The Blue Marble Space Institute of Science, based in Seattle, Wash., is inviting college students to participate in its essay contest. Essays need to address the question, "In the next 100 years, how can human civilization prepare for the long-term changes to the Earth system that will occur over the coming millennium?" According to the institute, the purpose of the contest is "to stimulate creative thinking relating to space exploration and global issues by exploring how changes in the Earth system will affect humanity's future."

  2. Prolonged incubation behavior by a marbled godwit

    USGS Publications Warehouse

    Higgins, K.F.

    1974-01-01

    On 9 May 1972 I flushed a Marbled Godwit (Limosa fedoa) from a nest containing four eggs in a large field of mulched wheat stubble in northwestern Stutsman County, North Dakota. I revisited the nest on 31 May and on 7, 9, 12, 15, 16, 20, and 21 June, and found an incubating adult on the nest during all visits except 21 June. Another adult was seen near the nest site only on 9 May. On 12 June the eggs looked rotten, and the incubating bird seemed to have a crippled leg. On 21 June Ring-billed Gulls (Larus delawarensis) destroyed the eggs.

  3. Color-Biased Dispersal Inferred by Fine-Scale Genetic Spatial Autocorrelation in a Color Polymorphic Salamander.

    PubMed

    Grant, Alexa H; Liebgold, Eric B

    2017-07-01

    Behavioral traits can be influenced by predation rates of color morphs, potentially leading to reduced boldness or increased escape behaviors in one color morph. The red-backed salamander, Plethodon cinereus, is a small terrestrial salamander whose color morphs have different diets and select different microhabitats, but little is known about potential differences in dispersal behaviors. We used fine-scale genetic spatial autocorrelation to examine 122 P. cinereus in a color-polymorphic population at 10 microsatellite loci in order to generate estimates of spatial genetic structure for each color morph. Differences in spatial genetic structure have been used extensively to infer within-population sex-biased dispersal but have never been used to test for dispersal differences between other groups within populations such as color morphs. We found evidence for color-biased dispersal, but not sex-biased dispersal. Striped salamanders had significant positive genetic structure in the shortest distance classes indicating philopatry. In contrast, unstriped salamanders showed a lack of spatial genetic structure at shorter distances and higher than expected genetic similarity at further distances, as expected if they are dispersing from their natal site. These results show that genetic methods typically used for sex-biased dispersal can be used to investigate differences in dispersal between morphs that vary discretely in polymorphic populations, such as color morphs. © The American Genetic Association 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. Homing orientation in salamanders: A mechanism involving chemical cues

    NASA Technical Reports Server (NTRS)

    Madison, D. M.

    1972-01-01

    A detailed description is given of experiments made to determine the senses and chemical cues used by salamanders for homing orientation. Sensory impairment and cue manipulative techniques were used in the investigation. All experiments were carried out at night. Results show that sense impaired animals did not home as readily as those who were blind but retained their sensory mechanism. This fact suggests that the olfactory mechanism is necessary for homing in the salamander. It was determined that after the impaired salamander regenerated its sensory mechanism it too returned home. It was concluded that homing ability in salamanders is direction independent, distant dependent, and vision independent.

  5. [Sexual dimorphism of marbled polecat Vormela peregusna (Carnivora: Mustelidae)].

    PubMed

    Rozhnov, V V; Abramov, A V

    2006-01-01

    Analysis of morphometric variation in 26 cranial characters were studied in 85 individuals of marbled polecat Vormela peregusna from Turkmenistan demonstrated a low level of sexual dimorphism in the species. The properties of sexual dimorphism in marbled polecat are discussed in terms of available hypotheses of sexual dimorphism in carnivores.

  6. On the mechanism of floating and sliding of liquid marbles.

    PubMed

    Bormashenko, Edward; Bormashenko, Yelena; Musin, Albina; Barkay, Zahava

    2009-03-09

    The mechanisms of floating and sliding of liquid marbles are studied. Liquid marbles containing CaCl(2) and marbles containing NaOH water solutions float on water containing Na(2)CO(3) and an alcoholic solution of phenolphthalein with no chemical reaction. Sliding of liquid marbles, consisting of NaOH water solutions, on polymer substrates coated with phenolphthalein is studied as well. No chemical reaction is observed. These observations supply direct experimental evidence for the suggestion that interfaces are separated by an air layer when marbles roll on solid substrates. It is concluded that a liquid marble rests on hydrophobic particles coating the liquid. In contrast, drops containing an NaOH water solution sliding on superhydrophobic surfaces coated with phenolphthalein leave a colored trace. The mechanism of low-friction sliding of drops deposited on superhydrophobic surfaces and liquid marbles turns out to be quite different: there is no direct contact between liquid and solid in the case of marbles' motion.

  7. Chapter 5: Nesting Biology and Behavior of the Marbled Murrelet

    Treesearch

    S. Kim Nelson; Thomas E. Hamer

    1995-01-01

    We summarize courtship, incubation, feeding, fledging, and flight behavior of Marbled Murrelets (Brachyramphus marmoratus) using information collected at 24 nest sites in North America. Chick development, vocalizations given by adults and chicks at the nest, and predator avoidance behaviors are also described. Marbled Murrelets initiate nesting as...

  8. Consolidated waste forms: glass marbles and ceramic pellets

    SciTech Connect

    Treat, R.L.; Rusin, J.M.

    1982-05-01

    Glass marbles and ceramic pellets have been developed at Pacific Northwest Laboratory as part of the multibarrier concept for immobilizing high-level radioactive waste. These consolidated waste forms served as substrates for the application of various inert coatings and as ideal-sized particles for encapsulation in protective matrices. Marble and pellet formulations were based on existing defense wastes at Savannah River Plant and proposed commercial wastes. To produce marbles, glass is poured from a melter in a continuous stream into a marble-making device. Marbles were produced at PNL on a vibratory marble machine at rates as high as 60 kg/h. Other marble-making concepts were also investigated. The marble process, including a lead-encapsulation step, was judged as one of the more feasible processes for immobilizing high-level wastes. To produce ceramic pellets, a series of processing steps are required, which include: spray calcining - to dry liquid wastes to a powder; disc pelletizing - to convert waste powders to spherical pellets; sintering - to densify pellets and cause desired crystal formation. These processing steps are quite complex, and thereby render the ceramic pellet process as one of the least feasible processes for immobilizing high-level wastes.

  9. Lethal effects of water quality on threatened California salamanders but not on co-occurring hybrid salamanders.

    PubMed

    Ryan, Maureen E; Johnson, Jarrett R; Fitzpatrick, Benjamin M; Lowenstine, Linda J; Picco, Angela M; Shaffer, H Bradley

    2013-02-01

    Biological invasions and habitat alteration are often detrimental to native species, but their interactions are difficult to predict. Interbreeding between native and introduced species generates novel genotypes and phenotypes, and human land use alters habitat structure and chemistry. Both invasions and habitat alteration create new biological challenges and opportunities. In the intensively farmed Salinas Valley, California (U.S.A.), threatened California tiger salamanders (Ambystoma californiense) have been replaced by hybrids between California tiger salamander and introduced barred tiger salamanders (Ambystoma tigrinum mavortium). We conducted an enclosure experiment to examine the effects habitat modification and relative frequency of hybrid and native California tiger salamanders have on recruitment of salamanders and their prey, Pacific chorus frogs (Pseudacris regilla). We tested whether recruitment differed among genetic classes of tiger salamanders (hybrid or native) and pond hydroperiod (seasonal or perennial). Roughly 6 weeks into the experiment, 70% (of 378 total) of salamander larvae died in 4 out of 6 ponds. Native salamanders survived (n = 12) in these ponds only if they had metamorphosed prior to the die-offs. During die-offs, all larvae of native salamanders died, whereas 56% of hybrid larvae died. We necropsied native and hybrid salamanders, tested water quality, and queried the California Department of Pesticide Regulation database to investigate possible causes of the die-offs. Salamander die-offs, changes in the abundance of other community members (invertebrates, algae, and cyanobacteria), shifts in salamander sex ratio, and patterns of pesticide application in adjacent fields suggest that pesticide use may have contributed to die-offs. That all survivors were hybrids suggests that environmental stress may promote rapid displacement of native genotypes.

  10. Performance Evaluation of Concrete using Marble Mining Waste

    NASA Astrophysics Data System (ADS)

    Kore, Sudarshan Dattatraya; Vyas, A. K.

    2016-12-01

    A huge amount waste (approximately 60%) is generated during mining and processing in marble industries. Such waste can be best utilized in infrastructure development works. Coarse aggregate 75% by weight was replaced by aggregate obtained from marble mining waste. The impact of marble waste as a partial replacement for conventional coarse aggregate on the properties of concrete mixes such as workability, compressive strength, permeability, abrasion, etc. was evaluated. The test results revealed that the compressive strength was comparable to that of control concrete. Other properties such as workability of concrete increased, water absorption reduced by 17%, and resistance to abrasion was marginally increased by 2% as compared to that of control concrete. Ultrasonic pulse velocity and FTIR results show improvement in quality of concrete with crushed marble waste. From the TGA analysis it was confirmed that, aggregate produced from marble waste shows better performance under elevated temperature than that of conventional aggregates.

  11. Phylogeography of Sardinian cave salamanders (genus Hydromantes) is mainly determined by geomorphology.

    PubMed

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems.

  12. Phylogeography of Sardinian Cave Salamanders (Genus Hydromantes) Is Mainly Determined by Geomorphology

    PubMed Central

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M.; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems. PMID:22427830

  13. Genetic analyses of historic and modern marbled murrelets suggest decoupling of migration and gene flow after habitat fragmentation

    Treesearch

    M. Zachariah Peery; Laurie A. Hall; Sellas. Anna; Steven R. Beissinger; Craig Moritz; Martine Berube; Martin G. Raphael; S. Kim Nelson; Richard T. Golightly; Laura McFarlane-Tranquilla; Scott H. Newman; Per J. Palsboll

    2009-01-01

    The dispersal of individuals among fragmented populations is generally thought to prevent genetic and demographic isolation, and ultimately reduce extinction risk. In this study, we show that a century of reduction in coastal old-growth forests, as well as a number of other environmental factors, has probably resulted in the genetic divergence of marbled murrelets (...

  14. The Marble Experiment: Overview and Simulations

    NASA Astrophysics Data System (ADS)

    Douglas, M. R.; Murphy, T. J.; Cobble, J. A.; Fincke, J. R.; Haines, B. M.; Hamilton, C. E.; Lee, M. N.; Oertel, J. A.; Olson, R. E.; Randolph, R. B.; Schmidt, D. W.; Shah, R. C.; Smidt, J. M.; Tregillis, I. L.

    2015-11-01

    The Marble ICF platform has recently been launched on both OMEGA and NIF with the goal to investigate the influence of heterogeneous mix on fusion burn. The unique separated reactant capsule design consists of an ``engineered'' CH capsule filled with deuterated plastic foam that contains pores or voids that are filled with tritium gas. Initially the deuterium and tritium are separated, but as the implosion proceeds, the D and T mix, producing a DT signature. The results of these experiments will be used to inform a probability density function (PDF) burn modelling approach for un-resolved cell morphology. Initial targets for platform development have consisted of either fine-pore foams or gas mixtures, with the goal to field the engineered foams in 2016. An overview of the Marble experimental campaign will be presented and simulations will be discussed. This work is supported by US DOE/NNSA, performed at LANL, operated by LANS LLC under contract DE-AC52-06NA25396.

  15. Crystalline marble beats limestone for fluegas desulfurization

    SciTech Connect

    1996-05-01

    NovaCon Energy Systems, Inc. (Bedford, NY) has developed an alternative to conventional limestone sorbents. The new process uses a class of marble, selected with a proprietary model. Recent pilot- and full-scale demonstrations in pulverized-coal (PC) and circulating fluidized bed (CFB) boilers suggest that these patented sorbents outperform conventional limestone for the simultaneous control of SOx, NOx, and particulates during the combustion of coal and sulfur-rich fuels, such as oil, mixed municipal waste and used tires. Dubbed thermally active marbles (TAMs), these sorbents are chemically identical to grainy limestone (whose main constituent is calcium carbonate or calcite). However, thanks to the increased pressures and temperatures experienced during their geologic history, these metamorphic minerals have a regular crystalline structure that offers some advantages in the combustion zone. TAMs, on the other hand, enjoy better calcium-utilization rates because upon heating, they cleave along inter- and intra-crystalline faces, continuously exposing fresh surfaces. By minimizing the self-extinguishment suffered by limestone sorbents, TAMs are effective over operating temperatures from 1,200 F to 2,800 F, which is 400 F higher than other calcium-based sorbents. This allows them to be injected closer to the burner or combustion grate to maximize residence time in the unit.

  16. Stream salamanders as indicators of stream quality in Maryland, USA

    USGS Publications Warehouse

    Southerland, M.T.; Jung, R.E.; Baxter, D.P.; Chellman, I.C.; Mercurio, G.; Volstad, J.H.

    2004-01-01

    Biological indicators are critical to the protection of small, headwater streams and the ecological values they provide. Maryland and other state monitoring programs have determined that fish indicators are ineffective in small streams, where stream salamanders may replace fish as top predators. Because of their life history, physiology, abundance, and ubiquity, stream salamanders are likely representative of biological integrity in these streams. The goal of this study was to determine whether stream salamanders are effective indicators of ecological conditions across biogeographic regions and gradients of human disturbance. During the summers of 2001 and 2002, we intensively surveyed for stream salamanders at 76 stream sites located west of the Maryland Coastal Plain, sites also monitored by the Maryland Biological Stream Survey (MBSS) and City of Gaithersburg. We found 1,584 stream salamanders, including all eight species known in Maryland, using two 15 ? 2 m transects and two 4 m2 quadrats that spanned both stream bank and channel. We performed removal sampling on transects to estimate salamander species detection probabilities, which ranged from 0.67-0.85. Stepwise regressions identified 15 of 52 non-salamander variables, representing water quality, physical habitat, land use, and biological conditions, which best predicted salamander metrics. Indicator development involved (1) identifying reference (non-degraded) and degraded sites (using percent forest, shading, riparian buffer width, aesthetic rating, and benthic macroinvertebrate and fish indices of biotic integrity); (2) testing 12 candidate salamander metrics (representing species richness and composition, abundance, species tolerance, and reproductive function) for their ability to distinguish reference from degraded sites; and (3) combining metrics into an index that effectively discriminated sites according to known stream conditions. Final indices for Highlands, Piedmont, and Non-Coastal Plain

  17. In search of critically endangered species: the current situation of two tiny salamander species in the Neotropical mountains of Mexico.

    PubMed

    Sandoval-Comte, Adriana; Pineda, Eduardo; Aguilar-López, José L

    2012-01-01

    Worldwide, one in every three species of amphibian is endangered, 39 species have gone extinct in the last 500 years and another 130 species are suspected to have gone extinct in recent decades. Of the amphibians, salamanders have the highest portion of their species in one of the risk categories, even higher than the frogs. To date there have been few studies that have used recent field data to examine the status of populations of endangered salamanders. In this study we evaluate the current situation of two tiny salamanders, Parvimolge townsendi and Thorius pennatulus, both of which are distributed at intermediate elevations in the mountains of the northern Neotropics and are considered to be critically endangered; the first has been proposed as possibly extinct. By carrying out exhaustive surveys in both historical and potentially suitable sites for these two species, we evaluated their abundance and the characteristics of their habitats, and we estimated their potential geographic distribution. We visited 22 sites, investing 672 person-hours of sampling effort in the surveys, and found 201 P. townsendi salamanders in 11 sites and only 13 T. pennatulus salamanders in 5 sites. Both species were preferentially found in cloud forest fragments that were well conserved or only moderately transformed, and some of the salamanders were found in shade coffee plantations. The potential distribution area of both species is markedly fragmented and we estimate that it has decreased by more than 48%. The results of this study highlight the importance of carrying out exhaustive, systematic field surveys to obtain accurate information about the current situation of critically endangered species, and help us better understand the crisis that amphibians are facing worldwide.

  18. In Search of Critically Endangered Species: The Current Situation of Two Tiny Salamander Species in the Neotropical Mountains of Mexico

    PubMed Central

    Sandoval-Comte, Adriana; Pineda, Eduardo; Aguilar-López, José L.

    2012-01-01

    Worldwide, one in every three species of amphibian is endangered, 39 species have gone extinct in the last 500 years and another 130 species are suspected to have gone extinct in recent decades. Of the amphibians, salamanders have the highest portion of their species in one of the risk categories, even higher than the frogs. To date there have been few studies that have used recent field data to examine the status of populations of endangered salamanders. In this study we evaluate the current situation of two tiny salamanders, Parvimolge townsendi and Thorius pennatulus, both of which are distributed at intermediate elevations in the mountains of the northern Neotropics and are considered to be critically endangered; the first has been proposed as possibly extinct. By carrying out exhaustive surveys in both historical and potentially suitable sites for these two species, we evaluated their abundance and the characteristics of their habitats, and we estimated their potential geographic distribution. We visited 22 sites, investing 672 person-hours of sampling effort in the surveys, and found 201 P. townsendi salamanders in 11 sites and only 13 T. pennatulus salamanders in 5 sites. Both species were preferentially found in cloud forest fragments that were well conserved or only moderately transformed, and some of the salamanders were found in shade coffee plantations. The potential distribution area of both species is markedly fragmented and we estimate that it has decreased by more than 48%. The results of this study highlight the importance of carrying out exhaustive, systematic field surveys to obtain accurate information about the current situation of critically endangered species, and help us better understand the crisis that amphibians are facing worldwide. PMID:22485155

  19. Skeletal muscle dedifferentiation during salamander limb regeneration.

    PubMed

    Wang, Heng; Simon, András

    2016-10-01

    Salamanders can regenerate entire limbs throughout their life. A critical step during limb regeneration is formation of a blastema, which gives rise to the new extremity. Salamander limb regeneration has historically been tightly linked to the term dedifferentiation, however, with refined research tools it is important to revisit the definition of dedifferentiation in the context. To what extent do differentiated cells revert their differentiated phenotypes? To what extent do progeny from differentiated cells cross lineage boundaries during regeneration? How do cell cycle plasticity and lineage plasticity relate to each other? What is the relationship between dedifferentiation of specialized cells and activation of tissue resident stem cells in terms of their contribution to the new limb? Here we highlight these problems through the case of skeletal muscle.

  20. Kinship affects morphogenesis in cannibalistic salamanders.

    PubMed

    Pfennig, D W; Collins, J P

    1993-04-29

    Inclusive fitness theory predicts that organisms can often increase their fitness by helping relatives. Indeed, many animals modify their behaviour towards kin in a fashion consistent with theory. Morphogenesis may also be sensitive to kinship environment, especially in species that facultatively produce distinct morphs that differ in their ability to harm relatives, such as those that produce alternative cannibalistic and non-cannibalistic phenotypes. We tested this hypothesis by examining whether consanguinity affected the probability that structurally distinctive cannibal morphs would develop in larval Arizona tiger salamanders (Ambystoma tigrinum nebulosum). We report here that when tiger salamander larvae are reared in mixed-brood groups they are significantly more likely to develop the cannibal morphology and at an earlier age than siblings reared in pure-sibship groups. In general, morphogenesis may be responsive to kinship in any species that facultatively develops structures that can be used against conspecifics as weaponry.

  1. Sex in unisexual salamanders: discovery of a new sperm donor with ancient affinities.

    PubMed

    Bogart, J P; Bartoszek, J; Noble, D W A; Bi, K

    2009-12-01

    Although bisexual reproduction has considerable evolutionary benefits, several all-female vertebrates exist. Unisexual salamanders in the genus Ambystoma are common around the Great Lakes region in eastern North America. They originated from a hybridization event that involved a female that shared a common ancestor with Ambystoma barbouri 2.4 to 3.9 million years ago but, unexpectedly, A. barbouri nuclear genomes were unknown in unisexuals. Unisexual salamanders steal sperm from donors of normally bisexual species, so their reproductive mode is described as kleptogenesis. Most known unisexuals are polyploid and they all possess at least one A. laterale genome. One or more other genomes are taken from sperm donors that may include A. jeffersonianum, A. laterale, A. texanum and A. tigrinum. We examined unisexual adults and larvae in a southern Ohio pond where unisexual individuals coexist with male A. barbouri. This population provided an opportunity to test hypotheses pertaining to the role of A. barbouri in the evolution of the disparate cytoplasmic and nuclear genomes in unisexual salamanders. Microsatellite DNA loci, mitochondrial DNA sequences and genomic in situ hybridization were used to identify the genomic constitution of individuals. A. barbouri was found to be an acceptable sperm donor for unisexuals but only contributed genomes in ploidy-elevated individuals. In the absence of A. jeffersonianum, this Ohio population is likely experiencing a recent switch in sperm donors from A. jeffersonianum to A. barbouri and demonstrates the evolutionary flexibility and dynamics of kleptogenesis.

  2. Candidate gene analysis of thyroid hormone receptors in metamorphosing vs. nonmetamorphosing salamanders.

    PubMed

    Voss, S R; Shaffer, H B; Taylor, J; Safi, R; Laudet, V

    2000-08-01

    We used two different experimental approaches to test the hypothesis that thyroid hormone receptor (TR) variation is associated with alternate life cycles modes in ambystomatid salamanders. In the first experiment, the inheritance of TRalpha and TRbeta genotypes was determined for metamorphic and non metamorphic offspring from backcrosses between Ambystoma mexicanum (an obligate metamorphic-failure species) and metamorphic F1 hybrids (A. mexicanum x A. tigrinum tigrinum). The segregation of TR genotype was independent of the expression of life cycle mode phenotype, and neither TR locus was linked to DNA markers that flank a major-effect locus for life cycle mode. In the second experiment, a portion of the ligand-binding domain of TRalpha and TRbeta was cloned and sequenced for DNA samples from 14 different ambystomatid salamander populations, including obligate metamorphic, facultative metamorphic, and obligate metamorphic-failure taxa. Nucleotide sequence variation was found for both TRalpha and TRbeta, with several nonsynonomous substitutions that presumably code for nonconservative amino acid replacements. However, no general relationship was found between TR allelic variation and life cycle mode among populations or species. These data do not implicate TRs as candidate loci involved in the current maintenance or past evolution of alternate life cycle modes in members of the tiger salamander complex.

  3. Amphibian chemical defense: antifungal metabolites of the microsymbiont Janthinobacterium lividum on the salamander Plethodon cinereus.

    PubMed

    Brucker, Robert M; Harris, Reid N; Schwantes, Christian R; Gallaher, Thomas N; Flaherty, Devon C; Lam, Brianna A; Minbiole, Kevin P C

    2008-11-01

    Disease has spurred declines in global amphibian populations. In particular, the fungal pathogen Batrachochytrium dendrobatidis has decimated amphibian diversity in some areas unaffected by habitat loss. However, there is little evidence to explain how some amphibian species persist despite infection or even clear the pathogen beyond detection. One hypothesis is that certain bacterial symbionts on the skin of amphibians inhibit the growth of the pathogen. An antifungal strain of Janthinobacterium lividum, isolated from the skin of the red-backed salamander Plethodon cinereus, produces antifungal metabolites at concentrations lethal to B. dendrobatidis. Antifungal metabolites were identified by using reversed phase high performance liquid chromatography, high resolution mass spectrometry, nuclear magnetic resonance, and UV-Vis spectroscopy and tested for efficacy of inhibiting the pathogen. Two metabolites, indole-3-carboxaldehyde and violacein, inhibited the pathogen's growth at relatively low concentrations (68.9 and 1.82 microM, respectively). Analysis of fresh salamander skin confirmed the presence of J. lividum and its metabolites on the skin of host salamanders in concentrations high enough to hinder or kill the pathogen (51 and 207 microM, respectively). These results support the hypothesis that cutaneous, mutualistic bacteria play a role in amphibian resistance to fungal disease. Exploitation of this biological process may provide long-term resistance to B. dendrobatidis for vulnerable amphibians and serve as a model for managing future emerging diseases in wildlife populations.

  4. Pathogens as a factor limiting the spread of cannibalism in tiger salamanders.

    PubMed

    Pfennig, David W; Loeb, Michael L G; Collins, James P

    1991-10-01

    Intraspecific predation is taxonomically widespread, but few species routinely prey on conspecifics. This is surprising as conspecifics could be a valuable resource for animals limited by food. A potential cost of cannibalism that has been largely unexplored is that it may enhance the risk of acquiring debilitating pathogens or toxins from conspecifics. We examined how pathogens affect variation in the incidence of cannibalism in tiger salamander larvae (Ambystoma tigrinum nebulosum), which occur as two environmentally-induced morphs, typicals and cannibals. Salamanders from one population were more likely than those in another to develop into cannibals, even when reared under identical conditions. Variation in the propensity to become a cannibal may be caused by variation in pathogen density. In the population with cannibals at low frequency, bacterial blooms in late summer correlated with massive die-offs of salamanders. The frequency of cannibals correlated significantly negatively with bacterial density in ten different natural lakes. In the laboratory, cannibals exposed to a diseased conspecific always preyed on the sick animal. As a result, cannibals wre more likely to acquire and die from disease than were typicals that were similarly exposed, or cannibals that were exposed to healthy conspecifics. Since conspecifics often share lethal pathogens, enhanced risk of disease may explain why cannibalism is generally infrequent. Pathogens may constrain not only the tendency to be behaviorally cannibalistic, but also the propensity to develop specialized cannibal morphologies.

  5. Bromeliad Selection by Two Salamander Species in a Harsh Environment

    PubMed Central

    Ruano-Fajardo, Gustavo; Rovito, Sean M.; Ladle, Richard J.

    2014-01-01

    Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment. PMID:24892414

  6. Characterization of the ecological requirements for three plethodontid salamander species

    Treesearch

    Jessica A. Wooten; William B. Sutton; Thomas K. Pauley

    2010-01-01

    Increased availability of habitat and climate data has facilitated much research concerning the influence of these characteristics on the structure of salamander communities. We aimed to outline environmental requirements influencing the distribution of three sympatric plethodontid salamander species, including Plethodon cinereus, Desmognathus ochrophaeus...

  7. Predicting variation in microhabitat utilization of terrestrial salamanders

    Treesearch

    Katherine M. O' Donnell; Frank R. Thompson; Raymond D. Semlitsch

    2014-01-01

    Understanding patterns of microhabitat use among terrestrial salamanders is important for predicting their responses to natural and anthropogenic disturbances. The dependence of terrestrial salamanders on cutaneous respiration limits their spatial distribution to moist, humid areas. Although many studies have shown negative effects of canopy removal on terrestrial...

  8. Bromeliad selection by two salamander species in a harsh environment.

    PubMed

    Ruano-Fajardo, Gustavo; Rovito, Sean M; Ladle, Richard J

    2014-01-01

    Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment.

  9. Transcriptome analysis of the endangered Chinese giant salamander (Andrias davidianus): Immune modulation in response to Aeromonas hydrophila infection.

    PubMed

    Qi, Zhitao; Zhang, Qihuan; Wang, Zisheng; Ma, Tianyi; Zhou, Jie; Holland, Jason W; Gao, Qian

    2016-01-01

    The endangered Chinese giant salamander (Andrias davidianus) is the largest extant amphibian species. Disease outbreaks represent one of the major factors threatening A. davidianus populations in the wild and the viability of artificial breeding programmes. Development of future immune therapies to eliminate infectious disease in A. davidianus is dependent on a thorough understanding of the immune mechanisms elicited by pathogen encounters. To this end we have undertaken, for the first time in amphibians, differential transcriptome analysis of the giant salamander response to Aeromonas hydrophila, one of the most devastating pathogens affecting amphibian populations. Out of 87,204 non-redundant consensus unigenes 19,216 were annotated, 6834 of which were upregulated and 906 down-regulated following bacterial infection. 2058 unigenes were involved with immune system processes, including 287 differentially expressed unigenes indicative of the impact of bacterial infection on several innate and adaptive immune pathways in the giant salamander. Other pathways not directly associated with immune-related activity were differentially expressed, including developmental, structural, molecular and growth processes. Overall, this work provides valuable insights into the underlying immune mechanisms elicited during bacterial infection in amphibians that may aid in the future development of disease control measures in protecting the Chinese giant salamander. With the unique position of amphibians in the transition of tetrapods from aquatic to terrestrial habitats, our study will also be invaluable towards the further understanding of the evolution of tetrapod immunity.

  10. The Puzzle of a Marble in a Spinning Pipe

    DTIC Science & Technology

    2015-05-01

    MAY 2015 2. REPORT TYPE 3. DATES COVERED 00-00-2015 to 00-00-2015 4. TITLE AND SUBTITLE The Puzzle of a Marble in a Spinning Pipe 5a. CONTRACT...Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT What trajectory does a marble follow if it is held...298 (Rev. 8-98) Prescribed by ANSI Std Z39-18 Physics Education 50 (3) 279 1. Problem statement A marble is placed one-third of the length along a

  11. Goalpha labels ON bipolar cells in the tiger salamander retina.

    PubMed

    Zhang, Jian; Wu, Samuel M

    2003-06-23

    By using double-label immunocytochemistry and confocal microscopy, we studied rod and cone synaptic contacts, photoreceptor-bipolar cell convergence, and patterns of axon terminal ramification of ON bipolar cells in the tiger salamander retina. An antibody to recoverin, a calcium-binding protein found in photoreceptors and other retinal neurons in various vertebrates, differentially labeled rods and cones by lightly staining rod cell bodies, axons, and synaptic pedicles and heavily staining cone cell bodies and pedicles. An antibody to G(oalpha) labeled most ON bipolar cells, with axon terminals ramified mainly in strata 6-9 and a minor band in stratum 3 of the inner plexiform layer (IPL). Stratum 10 of the IPL was G(oalpha) negative, and previous studies showed that axon terminals of rod-dominated ON bipolar cells are monostratified in that stratum. The axonal morphology of G(oalpha)-positive cells resembled that of the cone-dominated (DBC(C)) or mixed rod and cone ON (DBC(M)) bipolar cells. The G(oalpha)-positive dendritic processes made close contact with all cone pedicles and superficial contact with some rod pedicles, consistent with the idea that G(oalpha) subunits are present in DBC(C)s and DBC(M)s. The size and density of these cells were analyzed, and their spatial distributions were determined. To our knowledge, this is the first study to characterize photoreceptor inputs and axon terminal morphology of a population of ON bipolar cell with the use of a G(oalpha) antibody as an immunomarker in the salamander retina. Copyright 2003 Wiley-Liss, Inc.

  12. Evidence for multiple Pleistocene refugia in the postglacial expansion of the eastern tiger salamander, Ambystoma tigrinum tigrinum.

    PubMed

    Church, Sheri A; Kraus, Johanna M; Mitchell, Joseph C; Church, Don R; Taylor, Douglas R

    2003-02-01

    Pleistocene glaciations were important determinants of historical migration and, hence, current levels of genetic diversity within and among populations. In many cases, these historical migrations led to the existence of disjunct populations of plants and animals. However, the origin and timing of arrival of these disjunct populations is often debated. In the current study, we identify potential refugia and estimate the timing of vicariance events of the eastern tiger salamander, Ambystoma tigrinum tigrinum, using mitochondrial sequence data. The results suggest a vicariant event 0.75-2 million years ago, separating the tiger salamanders to the east and west of the Apalachicola River Basin. East of the Appalachians, there appear to be multiple independent refugia with little migration among the remaining populations. In particular, populations along the Atlantic Coastal Plain were likely isolated in a coastal plain refugium in the Carolinas. Migrants from this refugium were the likely source of colonists for populations occupying previously glaciated areas along the northeastern Atlantic Coast. A second potential refugium occurs in the Blue Ridge Mountains of western Virginia. This refugium contains a disjunct population of the eastern tiger salamander, as well as a community of nearly 70 other disjunct plant and animal species. The tiger salamanders here have been isolated from other populations for 200,000-500,000 years. These results suggest that disjunct mountain populations of Coastal Plain species may have existed in situ throughout the Pleistocene in Appalachian refugia. Therefore, these disjunct populations are not of recent origin, but rather exist as relicts of a warmer, more widespread fauna and flora that is now restricted to the Coastal Plain.

  13. Blue Marble: Remote Characterization of Habitable Planets

    NASA Technical Reports Server (NTRS)

    Woolf, Neville; Lewis, Brian; Chartres, James; Genova, Anthony

    2009-01-01

    The study of the nature and distribution of habitable environments beyond the Solar System is a key area for Astrobiology research. At the present time, our Earth is the only habitable planet that can be characterized in the same way that we might characterize planets beyond the Solar System. Due to limitations in our current and near-future technology, it is likely that extra-solar planets will be observed as single-pixel objects. To understand this data, we must develop skills in analyzing and interpreting the radiation obtained from a single pixel. These skills must include the study of the time variation of the radiation, and the range of its photometric, spectroscopic and polarimetric properties. In addition, to understand whether we are properly analyzing the single pixel data, we need to compare it with a ground truth of modest resolution images in key spectral bands. This paper discusses the concept for a mission called Blue Marble that would obtain data of the Earth using a combination of spectropolarimetry, spectrophotometry, and selected band imaging. To obtain imagery of the proper resolution, it is desirable to place the Blue Marble spacecraft no closer than the outer region of cis-lunar space. This paper explores a conceptual mission design that takes advantage of low-cost launchers, bus designs and mission elements to provide a cost effective observing platform located at one of the stable Earth-moon Lagrangian points (L4, L5). The mission design allows for the development and use of novel technologies, such as a spinning moon sensor for attitude control, and leverages lessons-learned from previous low-cost spacecraft such as Lunar Prospector to yield a low-risk mission concept.

  14. Women's toilet with marble stalls and wooden doors, east end ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Women's toilet with marble stalls and wooden doors, east end of first floor. View to southwest. - San Bernardino Valley College, Life Science Building, 701 South Mount Vernon Avenue, San Bernardino, San Bernardino County, CA

  15. 17. DETAIL OF MAIN CONCOURSE PLASTER AND MARBLE COLUMN CAPITAL. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    17. DETAIL OF MAIN CONCOURSE PLASTER AND MARBLE COLUMN CAP-ITAL. - Newark International Airport, Administration Building, Brewster Road between Route 21 & New Jersey Turnpike Exchange No. 14, Newark, Essex County, NJ

  16. 51. Fourth floor attic, marble cased door opening at entrance ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    51. Fourth floor attic, marble cased door opening at entrance to operating room, view to northeast - Portsmouth Naval Hospital, Hospital Building, Rixey Place, bounded by Williamson Drive, Holcomb Road, & The Circle, Portsmouth, Portsmouth, VA

  17. 7. BASEMENT, REAR WALL OF FRONT HOUSE, DETAIL SHOWING MARBLE ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    7. BASEMENT, REAR WALL OF FRONT HOUSE, DETAIL SHOWING MARBLE SILL AND HEADED JAMB OF FORMER BASEMENT WINDOW. Photo by Theodore F. Dillon, August 1960 - Captain James Abercrombie House, 268-270 South Second Street, Philadelphia, Philadelphia County, PA

  18. FLAT MARBLE MARKER WITH CONCRETE COLLAR – JOHN C. DURBIN ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    FLAT MARBLE MARKER WITH CONCRETE COLLAR – JOHN C. DURBIN (ONLY CONFEDERATE BURIAL IN CEMETERY) IN SECTION 1. VIEW TO EAST. - Danville National Cemetery, 1900 East Main Street, Danville, Vermilion County, IL

  19. Interior view of shower room 216 with original marble surround ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Interior view of shower room 2-16 with original marble surround and double sash windows, facing east. - Marine Barracks, Panama Canal, Barracks Building, 100' North of Thatcher Highway, Balboa, Former Panama Canal Zone, CZ

  20. 35. SECOND FLOOR, SOUTHEAST ROOM, NORTH WALL: BLACK MARBLE MANTLE. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    35. SECOND FLOOR, SOUTHEAST ROOM, NORTH WALL: BLACK MARBLE MANTLE. Grape clusters above columns repeat in upper part of cornice and probably in destroyed ceiling centerpiece - Governor Thomas Bennett House, 1 Lucas Street, Charleston, Charleston County, SC

  1. Escape to Alcatraz: evolutionary history of slender salamanders (Batrachoseps) on the islands of San Francisco Bay

    PubMed Central

    Martínez-Solano, Iñigo; Lawson, Robin

    2009-01-01

    Background Island populations are excellent model systems for studies of phenotypic, ecological and molecular evolution. In this study, molecular markers of mitochondrial and nuclear derivation were used to investigate the evolution, structure and origin of populations of the California slender salamander (Batrachoseps attenuatus) inhabiting the six major islands of San Francisco Bay, formed following the rising of sea level around 9,000 years ago. Results There was a high degree of congruence in the results of analyses of nucleotide and allozyme data, both of which strongly support the hypothesis that, for the majority of the islands, salamanders are descended from hilltop populations that became isolated with the formation of the Bay ca. 9,000 years ago. There are two exceptions (Alcatraz and Yerba Buena) where the evidence suggests that salamander populations are wholly or in part, the result of anthropogenic introductions. Comparison of the molecular data and the interpretations drawn therefrom with an earlier morphological study of many of the same salamander populations show some of the same evolutionary trends. Conclusion In spite of marked differences between the evolutionary rates of the two kinds of molecular markers, both indicate distinctive and similar patterns of population structure for B. attenuatus in the San Francisco Bay Area and its islands. With the two noted exceptions, it is clear that most island populations were established prior to the 9,000 years since the formation of the Bay. Results of coalescence-based analyses suggest that for most island populations the mtDNA lineages from which they were derived date from the Pleistocene. It can be said that, based on observed values of genetic diversity, the last 9,000 years of evolution on these islands have been characterized by relative stability, with the occasional extinction of some haplotypes or alleles that were formerly shared between island and mainland populations but overall

  2. The impact of recreational boat traffic on Marbled Murrelets (Brachyramphus marmoratus).

    PubMed

    Bellefleur, Danielle; Lee, Philip; Ronconi, Robert A

    2009-01-01

    This study evaluated the impact of small boat traffic on reaction distances of Marbled Murrelets (Brachyramphus marmoratus), in the marine waters of Pacific Rim National Park Reserve, British Columbia, Canada. Observers on moving boats recorded the minimum distance the boat came to murrelets on the water, and any disturbance reaction (fly, dive, no reaction). Out of the 7500 interactions 11.7% flew, 30.8% dove and 58.1% exhibited no flushing reaction. Using a product-limit analysis, we developed curves for the proportion of Marbled Murrelets flushing (dive or flight) as a function of reaction distance. Overall, the majority of Marbled Murrelets waited until boats were within 40 m before reacting, with 25% of the population reacting at 29.2m. A stepwise Cox regression indicated that age, boat speed, and boat density (loaded in that order), significantly affected flushing response. More juveniles flushed than adults (70.1 versus 51.7%), but at closer distances. Faster boats caused a greater proportion of birds to flush, and at further distances (25% of birds flushed at 40 m at speeds > 29 kph versus 28m at speeds <12kph). A stepwise logistic regression on diving and flight responses indicated that birds tended to fly completely out of feeding areas at the approach of boats travelling >28.8 kph and later in the season (July and August). Other secondary variables included; boat density and time of day. Discussion focused on possible management actions such as the application of speed limits, set back distances, and exclusion of boat traffic to protect Marbled Murrelets.

  3. Acute toxicity of some hydrazine compounds to salamander larvae, Ambystoma spp

    SciTech Connect

    Slonim, A.R.

    1986-11-01

    Although hydrazine compounds have been used extensively by industry for a very long time, they have become important in recent years as propellants for aerospace operations. The study of hydrazine compounds in this laboratory began about two decades ago and developed into a large pharmacological and toxicological research program that included also environmental considerations. Subsequently, acute toxicity studies were conducted on the common guppy (Lebistes reticulatus Peters) using four hydrazine compounds of interest. The toxicity of these propellants were evaluated next on other species of aquatic organisms such as mosquito fish (Gambusia affinis) and amphibians. Two different studies were conducted on amphibians: One utilized amphibian eggs and the other amphibian larvae. The larvae of spotted and marbled salamanders (Ambystoma maculatum and A. opacum, respectively) were used primarily in numerous static bioassays to determine the acute toxicity of hydrazine, UDMH and Aerozine-50 on these organisms. The remaining larvae were used in other tests mainly to corroborate previous experimental results (e.g., to see whether toxicity is affected by organism size, aeration of test solutions, and water hardness). The results on the larvae are presented in this paper.

  4. Frequency-dependent selection by wild birds promotes polymorphism in model salamanders

    PubMed Central

    Fitzpatrick, Benjamin M; Shook, Kim; Izally, Reuben

    2009-01-01

    Background Co-occurrence of distinct colour forms is a classic paradox in evolutionary ecology because both selection and drift tend to remove variation from populations. Apostatic selection, the primary hypothesis for maintenance of colour polymorphism in cryptic animals, proposes that visual predators focus on common forms of prey, resulting in higher survival of rare forms. Empirical tests of this frequency-dependent foraging hypothesis are rare, and the link between predator behaviour and maintenance of variation in prey has been difficult to confirm. Here, we show that predatory birds can act as agents of frequency-dependent selection on terrestrial salamanders. Polymorphism for presence/absence of a dorsal stripe is widespread in many salamander species and its maintenance is a long-standing mystery. Results We used realistic food-bearing model salamanders to test whether selection by wild birds maintains a stripe/no-stripe polymorphism. In experimental manipulations, whichever form was most common was most likely to be attacked by ground-foraging birds, resulting in a survival advantage for the rare form. Conclusion This experiment demonstrates that frequency-dependent foraging by wild birds can maintain colour polymorphism in cryptic prey. PMID:19426509

  5. Recent divergence with gene flow in Tennessee cave salamanders (Plethodontidae: Gyrinophilus) inferred from gene genealogies.

    PubMed

    Niemiller, Matthew L; Fitzpatrick, Benjamin M; Miller, Brian T

    2008-05-01

    Cave organisms occupy a special place in evolutionary biology because convergent morphologies of many species demonstrate repeatability in evolution even as they obscure phylogenetic relationships. The origin of specialized cave-dwelling species also raises the issue of the relative importance of isolation vs. natural selection in speciation. Two alternative hypotheses describe the origin of subterranean species. The 'climate-relict' model proposes allopatric speciation after populations of cold-adapted species become stranded in caves due to climate change. The 'adaptive-shift' model proposes parapatric speciation driven by divergent selection between subterranean and surface habitats. Our study of the Tennessee cave salamander complex shows that the three nominal forms (Gyrinophilus palleucus palleucus, G. p. necturoides, and G. gulolineatus) arose recently and are genealogically nested within the epigean (surface-dwelling) species, G. porphyriticus. Short branch lengths and discordant gene trees were consistent with a complex history involving gene flow between diverging forms. Results of coalescent-based analysis of the distribution of haplotypes among groups reject the allopatric speciation model and support continuous or recurrent genetic exchange during divergence. These results strongly favour the hypothesis that Tennessee cave salamanders originated from spring salamanders via divergence with gene flow.

  6. Expression of calcium transporters in the retina of the tiger salamander (Ambystoma tigrinum).

    PubMed

    Krizaj, David; Liu, Xiaorong; Copenhagen, David R

    2004-08-02

    Changes in intracellular calcium concentration, [Ca2+]i, modulate the flow of visual signals across all stages of processing in the retina, yet the identities of Ca2+ transporters responsible for these changes are still largely unknown. In the current study, the distribution of plasma membrane and intracellular Ca2+ transporters in the retina of tiger salamander, a model system for physiological studies of retinal function, was determined. Plasma membrane calcium ATPases (PMCAs), responsible for high-affinity Ca2+ extrusion, were highly expressed in the salamander retina. PMCA isoforms 1, 2, and 4 were localized to photoreceptors, whereas the inner retina expressed all four isoforms. PMCA3 was expressed in a sparse population of amacrine and ganglion neurons, whereas PMCA2 was expressed in most amacrine and ganglion cells. Na+/Ca2+ exchangers, a high-capacity Ca2+ extrusion system, were expressed in the outer plexiform layer and in a subset of inner nuclear and ganglion layer cells. Intracellular Ca2+ store transporters were also represented prominently. SERCA2a, a splice variant of the sarcoplasmic-endoplasmic Ca2+ ATPase, was found mostly in photoreceptors, whereas SERCA2b was found in the majority of retinal neurons and in glial cells. The predominant endoplasmic reticulum (ER) Ca2+ channels in the salamander retina are represented by the isoform 2 of the IP3 receptor family and the isoform 2 of the ryanodine receptor family. These results indicate that Ca2+ transporters in the salamander retina are expressed in a cell type-specific manner.

  7. Expression of Calcium Transporters in the Retina of the Tiger Salamander (Ambystoma tigrinum)

    PubMed Central

    KRIŽAJ, DAVID; LIU, XIAORONG; COPENHAGEN, DAVID R.

    2008-01-01

    Changes in intracellular calcium concentration, [Ca2+]i, modulate the flow of visual signals across all stages of processing in the retina, yet the identities of Ca2+ transporters responsible for these changes are still largely unknown. In the current study, the distribution of plasma membrane and intracellular Ca2+ transporters in the retina of tiger salamander, a model system for physiological studies of retinal function, was determined. Plasma membrane calcium ATPases (PMCAs), responsible for high-affinity Ca2+ extrusion, were highly expressed in the salamander retina. PMCA isoforms 1, 2, and 4 were localized to photoreceptors, whereas the inner retina expressed all four isoforms. PMCA3 was expressed in a sparse population of amacrine and ganglion neurons, whereas PMCA2 was expressed in most amacrine and ganglion cells. Na+/Ca2+ exchangers, a high-capacity Ca2+ extrusion system, were expressed in the outer plexiform layer and in a subset of inner nuclear and ganglion layer cells. Intracellular Ca2+ store transporters were also represented prominently. SERCA2a, a splice variant of the sarcoplasmic-endoplasmic Ca2+ ATPase, was found mostly in photoreceptors, whereas SERCA2b was found in the majority of retinal neurons and in glial cells. The predominant endoplasmic reticulum (ER) Ca2+ channels in the salamander retina are represented by the isoform 2 of the IP3 receptor family and the isoform 2 of the ryanodine receptor family. These results indicate that Ca2+ transporters in the salamander retina are expressed in a cell type-specific manner. PMID:15236230

  8. The Marble Types of Thassos Island through the Ages

    NASA Astrophysics Data System (ADS)

    Laskaridis, Kostas; Patronis, Michael; Papatrechas, Christos; Schouenborg, Björn

    2013-04-01

    The first references to the "white whole-grain" marble of Thassos Island, Greece, date back to the 6th century BC when stones were quarried at Alyki peninsula and at Fanari and Vathy capes. Since that time, Thassos marble was exported to Samothraki and other neighbouring islands, Asia Minor coastal cities, Southern Greece and Rome. In ancient times, there were two principal types of marble quarries in Thassos: (a) those producing material for the construction of temples and for the creation of various art pieces, i.e. ornamental stones, and (b) those for extraction of rough blocks for export. This paper aims at describing the Thassos marble, the geological setting in brief, its historic use and future supply possibilities and other reasons why it is a time-enduring ornamental stone. The aesthetical characteristics and the physical mechanical properties of its two main types (i.e. calcitic and dolomitic) are described and evaluated. The relevant results justify the wide application range and the continuous use of Thassos marble from ancient to present times and confirm the ability of this stone to survive over time. Keywords: Thassos, Marble, Ornamental Stones, Physical Mechanical Properties, Historic use

  9. Complications associated with intrauterine glass marbles in five mares.

    PubMed

    de Amorim, Mariana Diel; Chenier, Tracey; Nairn, Dawne; Green, Jodyne; Manning, Stephen; Card, Claire

    2016-11-15

    CASE DESCRIPTION 5 mares were evaluated because of reproductive complications following long-term (> 1 year) use of intrauterine glass marbles for estrus suppression. CLINICAL FINDINGS 3 mares had 1 intrauterine glass marble, and 2 mares had 2 intrauterine glass marbles. On examination, 2 mares had signs of chronic endometritis, and 3 had signs of pyometra. Marbles or glass shards adhered to the endometrium were identified by means of hysteroscopy in 3 of 5 mares. Five of 7 marbles had surface imperfections or were broken. TREATMENT AND OUTCOME All patients were treated with uterine lavage and intrauterine and systemic administration of antimicrobials chosen on the basis of results of bacterial culture and susceptibility testing. Two of 5 mares were treated with intrauterine Tris-EDTA. One mare underwent 3 unsuccessful embryo transfer procedures and was subsequently lost to follow-up. One mare was euthanized because of severe vaginal and cervical adhesions and chronic vaginal discharge. Three mares had no apparent signs of reproductive disease at the time of follow-up but were not rebred. CLINICAL RELEVANCE Results of the present small case series suggested that use of intrauterine glass marbles should be discouraged because of the potential for severe reproductive consequences.

  10. Effects of red-backed salamanders on ecosystem functions.

    PubMed

    Hocking, Daniel J; Babbitt, Kimberly J

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m(2) plots) and small-scale enclosures (2 m(2)) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m(-2)). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types.

  11. Prey detection by vomeronasal chemoreception in a plethodontid salamander.

    PubMed

    Placyk, John S; Graves, Brent M

    2002-05-01

    While chemoreception is involved in a wide variety of salamander behaviors, the chemosensory system that mediates specific behaviors is rarely known. We investigated the role of the vomeronasal system (VNS) in foraging behavior of the red-backed salamander (Plethodon cinereus) by manipulating salamanders' abilities to detect nonvolatile chemical cues emitted by potential prey. Subjects received one of three treatments: (1) impaired vomeronasal system, (2) sham manipulation, and (3) no manipulation. The role of the VNS in mediating foraging on motile prey (Drosophila melanogaster) was investigated under three light conditions (bright, dim, dark). Salamanders with impaired VNSs foraged less efficiently than either of the other experimental groups by displaying the longest latency to attack and the lowest rate of prey capture, especially in the absence of visual cues. A second experiment utilized freshly killed prey to determine whether the VNS takes on added importance in the absence of visual or tactile cues associated with moving prey. Animals with impaired VNSs showed a decreased foraging efficiency on stationary prey under both dark and light conditions. In addition, a mark-recapture study of VNS-impaired and sham salamanders in the field also indicated that salamanders with impaired VNSs consumed fewer stationary prey compared to shams. The study indicates that the VNS plays a substantial role in the foraging behavior of the plethodontid salamander, P. cinereus.

  12. Effects of Red-Backed Salamanders on Ecosystem Functions

    PubMed Central

    Hocking, Daniel J.; Babbitt, Kimberly J.

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m2 plots) and small-scale enclosures (2 m2) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m−2). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types. PMID:24466269

  13. Conservation of the marbled murrelet under the Northwest Forest Plan.

    PubMed

    Raphael, Martin G

    2006-04-01

    The Marbled Murrelet (Brachyramphus marmoratus) was listed as threatened in 1992, primarily because of loss of its old-forest nesting habitat. Monitoring conducted over the first 10 years following implementation of the Northwest Forest Plan shows at-sea murrelet populations appear to be stationary, but recruitment is very low and demographic models project a 4-6% annual rate of decline. Monitoring of nesting habitat indicated there were about 1.6 million ha of higher-suitability nesting habitat on all lands at the start of the plan, about half of which occurred on federal lands. Most (88%) of higher-suitability habitat on federal lands was protected within reserves. Over the past 10 years, losses of habitat due primarily to fire have totaled about 2% on federal lands. Losses have been much greater (12%) on nonfederal lands, due primarily to timber harvest. Habitat is expected to accrue within reserves as younger forest matures and attains sufficient diameter to support nesting sites. At-sea estimates of population size are strongly and positively correlated with amounts of adjacent nesting habitat at a broad scale, supporting the idea that amounts of nesting habitat are a primary driver in wide-scale murrelet population distribution. Conditions at sea, however such as temperature regimes, prey availability, and pollutants, continue to affect murrelet populations. The system of large reserves seems to have achieved the short-term objective of conserving much of the remaining nesting habitat on federal lands. These reserves are also likely to contribute to the long-term objective of creating large, contiguous blocks of nesting habitat. The plan has a primary role in conserving and restoring nesting habitat on federal land but will succeed in this role only if land allocations calling for such protection are in place for many decades.

  14. Convergent evolutionary reduction of atrial septation in lungless salamanders.

    PubMed

    Lewis, Zachary R; Hanken, James

    2017-01-01

    Nearly two thirds of the approximately 700 species of living salamanders are lungless. These species respire entirely through the skin and buccopharyngeal mucosa. Lung loss dramatically impacts the configuration of the circulatory system but the effects of evolutionary lung loss on cardiac morphology have long been controversial. For example, there is presumably little need for an atrial septum in lungless salamanders due to the absence of pulmonary veins and the presence of a single source of mixed blood flowing into the heart, but whether lungless salamanders possess an atrial septum and whether the sinoatrial aperture is located in the left or right atrium are unresolved; authors have stated opposing claims since the late 1800s. Here, we use micro-computed tomography (μ-CT) imaging, gross dissection and histological reconstruction to compare cardiac morphology among lungless plethodontid salamanders (Plethodontidae), salamanders with lungs, and the convergently lungless species Onychodactylus japonicus (Hynobiidae). Plethodontid salamanders have partial atrial septa and incomplete separation of the atrium into left and right halves. Partial septation is also seen in O. japonicus. Hence, lungless salamanders from two lineages convergently evolved similar morphology of the atrial septum. The partial septum in lungless salamanders can make it appear that the sinoatrial aperture is in the left atrium, but this interpretation is incorrect. Outgroup comparisons demonstrate that the aperture is located in a posterodorsal extension of the right atrium into the left side of the heart. Independent evolutionary losses of the atrial septum may have a similar developmental basis. In mammals, the lungs induce formation of the atrial septum by secreting morphogens to neighboring mesenchyme. We hypothesize that the lungs induce atrial septum development in amphibians in a similar fashion to mammals, and that atrial septum reduction in lungless salamanders is a direct result

  15. Generation of aneurogenic larvae by parabiosis of salamander embryos.

    PubMed

    Kumar, Anoop; Delgado, Jean Paul

    2015-01-01

    Limb regeneration of salamanders is nerve dependent, and the removal of the nerves in early stages of limb regeneration severely curtails the proliferation of the blastemal cells and growth of the regenerate. The removal of the neural tube from a developing salamander embryo results in an aneurogenic larva and the aneurogenic limb (ANL) develops independently without innervation. Paradoxically, the limb in an ANL is capable of regeneration in a nerve-independent manner. Here, we describe a detailed method for the generation of ANL in the spotted salamander, Ambystoma maculatum, for regeneration studies.

  16. Locomotion and visually guided behavior in salamander: a neuromechanical study

    NASA Astrophysics Data System (ADS)

    Ijspeert, Auke J.; Arbib, Michael A.

    2000-10-01

    This article investigates the neural mechanisms underlying locomotion and visually-guided behavior in a lower vertebrate: the salamander. We develop connectionist models of the salamander's locomotor circuitry and visual system, and analyze their functioning by embedding them into a biomechanical simulation of the salamander's body. This work is therefore an experiment in computational neuroethology which aims at investigating how behavior results from the coupling of a central nervous system (CNS) and a body, and from the interactions of the CNS-body pair with the environment. We believe that understanding these mechanisms is not only relevant for neurobiology but also for potential applications in robotics.

  17. Could we also be regenerative superheroes, like salamanders?

    PubMed

    Dall'Agnese, Alessandra; Puri, Pier Lorenzo

    2016-09-01

    Development of methods to reawaken the semi-dormant regenerative potential that lies within adult human tissues would hold promise for the restoration of diseased or damaged organs and tissues. While most of the regeneration potential is suppressed in many vertebrates, including humans, during adult life, urodele amphibians (salamanders) retain their regenerative ability throughout adulthood. Studies in newts and axolotls, two salamander models, have provided significant knowledge about adult limb regeneration. In this review, we present a comparative analysis of salamander and mammalian regeneration and discuss how evolutionarily altered properties of the regenerative environment can be exploited to restore full regenerative potential in the human body.

  18. Salamander chytrid fungus (Batrachochytrium salamandrivorans) in the United States—Developing research, monitoring, and management strategies

    USGS Publications Warehouse

    Grant, Evan H. Campbell; Muths, Erin L.; Katz, Rachel A.; Canessa, Stefano; Adams, Michael J.; Ballard, Jennifer R.; Berger, Lee; Briggs, Cheryl J.; Coleman, Jeremy; Gray, Matthew J.; Harris, M. Camille; Harris, Reid N.; Hossack, Blake R.; Huyvaert, Kathryn P.; Kolby, Jonathan E.; Lips, Karen R.; Lovich, Robert E.; McCallum, Hamish I.; Mendelson, Joseph R.; Nanjappa, Priya; Olson, Deanna H.; Powers, Jenny G.; Richgels, Katherine L.D.; Russell, Robin E.; Schmidt, Benedikt R.; Spitzen-van der Sluijs, Annemarieke; Watry, Mary Kay; Woodhams, Douglas C.; White, C. LeAnn

    2016-01-20

    The recently (2013) identified pathogenic chytrid fungus, Batrachochytrium salamandrivorans (Bsal), poses a severe threat to the distribution and abundance of salamanders within the United States and Europe. Development of a response strategy for the potential, and likely, invasion of Bsal into the United States is crucial to protect global salamander biodiversity. A formal working group, led by Amphibian Research and Monitoring Initiative (ARMI) scientists from the U.S. Geological Survey (USGS) Patuxent Wildlife Research Center, Fort Collins Science Center, and Forest and Rangeland Ecosystem Science Center, was held at the USGS Powell Center for Analysis and Synthesis in Fort Collins, Colorado, United States from June 23 to June 25, 2015, to identify crucial Bsal research and monitoring needs that could inform conservation and management strategies for salamanders in the United States. Key findings of the workshop included the following: (1) the introduction of Bsal into the United States is highly probable, if not inevitable, thus requiring development of immediate short-term and long-term intervention strategies to prevent Bsal establishment and biodiversity decline; (2) management actions targeted towards pathogen containment may be ineffective in reducing the long-term spread of Bsal throughout the United States; and (3) early detection of Bsal through surveillance at key amphibian import locations, among high-risk wild populations, and through analysis of archived samples is necessary for developing management responses. Top research priorities during the preinvasion stage included the following: (1) deployment of qualified diagnostic methods for Bsal and establishment of standardized laboratory practices, (2) assessment of susceptibility for amphibian hosts (including anurans), and (3) development and evaluation of short- and long-term pathogen intervention and management strategies. Several outcomes were achieved during the workshop, including development

  19. Toxicity and immune system effects of dietary deltamethrin exposure in tiger salamanders (Ambystoma tigrinum).

    PubMed

    Froese, Jennifer M W; Smits, Judit E G; Forsyth, Douglas J; Wickstrom, Mark L

    2009-01-01

    One theory proposed to explain the global declines in amphibian populations involves contaminant-induced immune alteration and subsequent increased susceptibility to infectious disease. The goal of this study was twofold, to (1) study acute oral toxicity of deltamethrin (cyclopropanecarboxylic acid, 3-(2,2-dibromoethenyl)-2,2-dimethyl cyano(3-phenoxyphenyl)methyl ester) in tiger salamanders (Ambystoma tigrinum), and (2) evaluate whether the insecticide deltamethrin produces immunosuppression in these animals. In the acute toxicity study, tiger salamanders receiving single doses of deltamethrin ranging from 1 to 35 mg/kg displayed intention tremors, hypersalivation, ataxia, choreoathetosis (writhing), severe depression (immobility with minimal response to stimuli), and death. For acute effects, based on clinical signs, the median lethal dose (LD(50)) and lowest observed adverse effect level (LOAEL) were estimated to be 5 to 10 mg/kg and 1 mg/kg, respectively. The LOAEL in animals dosed 3 times per week for 4 wk was 400 microg/kg/d. The endpoints for the immunotoxicity study included lymphoid organ mass and histopathology, hematological variables, and functional assays of phagocytosis, oxidative burst, and lymphoblastic transformation. Tiger salamanders in 4 treatment groups (0, 4, 40, or 400 microg/kg/d) were dosed with deltamethrin via the diet 3 times per week for 4 wk. Deltamethrin exposure resulted in increased liver mass, packed cell volume, and total plasma protein concentration, but these effects were not dose dependent. The relative mass of kidney and spleen, plasma albumin and globulin concentrations, and circulating leukocyte numbers were not affected by deltamethrin exposure, nor were phagocytosis, oxidative burst, and lymphoblastic transformation. This study shows that at moderate levels of exposure, deltamethrin may be neurotoxic to tiger salamanders. However, based on the immune assays considered in this study there was no evidence of immunosuppression

  20. Status Review of the Marbled Murrelet (Brachyramphus marmoratus) in Alaska and British Columbia

    USGS Publications Warehouse

    Piatt, J.F.; Kuletz, K.J.; Burger, A.E.; Hatch, Shyla A.; Friesen, V.L.; Birt, T.P.; Arimitsu, M.L.; Drew, G.S.; Harding, A.M.A.; Bixler, K.S.

    2007-01-01

    The Marbled Murrelet (Brachyramphus marmoratus) is a small, diving seabird inhabiting inshore waters of the Northeastern Pacific Ocean. This species feeds on small, schooling fishes and zooplankton, and nests primarily on the moss-covered branches of large, old-growth conifers, and also, in some parts of its range, on the ground. We reviewed existing information on this species to evaluate its current status in the northern part of its range-Alaska (U.S.) and British Columbia (Canada). Within the southern part of its range (Washington, Oregon, and California, U.S.), the Marbled Murrelet was listed as a threatened species under the Endangered Species Act (ESA) in 1993, and the U.S. Fish and Wildlife Service (USFWS) needed information on the species throughout its range for ESA deliberations. We compiled published information on the conservation status, population biology, foraging ecology, population genetics, population status and trends, demography, marine and nesting habitat characteristics, threats, and ongoing conservation efforts for Marbled Murrelets in Alaska and British Columbia. We conducted a new genetic study using samples from a segment of the range that had not been included in previous studies (Washington, Oregon) and additional nuclear intron and microsatellite markers. We also analyzed available at-sea survey data from several locations for trend. To understand the reasonableness of the empirical trend data, we developed demographic models incorporating stochasticity to discern what population trends were possible by chance. The genetic studies substantially confirmed previous findings on population structure in the Marbled Murrelet. Our present work finds three populations: (1) one comprising birds in the central and western Aleutian Islands; (2) one comprising birds in central California; and (3) one comprising birds within the center of the range from the eastern Aleutians to northern California. Our knowledge of genetic structure within this

  1. Sexual dimorphism and age of Mediterranean salamanders.

    PubMed

    Reinhard, Sandy; Renner, Sandra; Kupfer, Alexander

    2015-02-01

    We analysed sexual size dimorphism (SSD) for two Mediterranean species of the "true" salamander clade possessing distinct life histories (Salamandra algira and Mertensiella caucasica) and equilibrated the morphometric approach to individual age by using skeletochronology. For species that have a short breeding season and live at high altitudes, such as Mediterranean amphibians, the fecundity advantage hypothesis predicts female-biased SSD to maximise reproductive success. Our results showed no SSD in either species; however, morphometric data indicated a male-biased dimorphism in limb (arm and leg) dimensions in both species when compared to body size. Limb dimorphisms are likely related to the particular mating system, which involves an amplexus during spermatophore transfer. Arm length appeared sexually dimorphic during ontogeny both in viviparous S. algira and oviparous M. caucasica. A review on SSD indicated monomorphy of body size as a common lineage-specific pattern among the "true" salamander clade, but also the common presence of other traits such as sexually dimorphic limb proportions.

  2. Habitat requirements of New Mexico’s endangered salamanders

    USGS Publications Warehouse

    Ramotnik, Cindy A.; Scott, N.J.

    1988-01-01

    We measured habitat components for two state-listed endangered salamanders in New Mexico in 1986 and 1987. Both species are restricted to mesic environments within high-elevation, mixed coniferous forests. Steep slope and high elevation were the most useful variables for predicting the occurrence of Jemez Mountains salamanders and Sacramento Mountain salamanders, respectively. Although the discriminant models show some predictive value in detecting salamanders based on habitat variables, we believe that the best survey technique is ground-truth surveys in wet weather. A better fit of the discriminant models might be obtained by including variables not measured e.g., fire and logging history, and soil characteristics. We offer interim management guidelines as a result of our analysis.

  3. Salamander-like development in a seymouriamorph revealed by palaeohistology.

    PubMed

    Sanchez, Sophie; Klembara, Jozef; Castanet, Jacques; Steyer, J Sébastien

    2008-08-23

    The amniotes generally lay eggs on land and are thereby differentiated from lissamphibians (salamanders, frogs and caecilians) by their developmental pattern. Although a number of 330-300-Myr old fossils are regarded as early tetrapods placed close to amniotes on the basis of anatomical data, we still do not know whether their developmental pattern was more similar to those of lissamphibians or amniotes. Here we report palaeohistological and skeletochronological evidence supporting a salamander-like development in the seymouriamorph Discosauriscus. Its long-bone growth pattern, slow diaphyseal growth rate and delayed sexual maturity (at more than 10 years old) are more comparable with growth features of extant salamanders rather than extant amniotes, even though they are mostly hypothesized to be phylogenetically closer to living amniotes than salamanders.

  4. Defining evolutionary boundaries across parapatric ecomorphs of Black Salamanders (Aneides flavipunctatus) with conservation implications.

    PubMed

    Reilly, Sean B; Marks, Sharyn B; Jennings, W Bryan

    2012-12-01

    The accurate delimitation of evolutionary population units represents an important component in phylogeographic and conservation genetic studies. Here, we used a combined population assignment and historical demographic approach to study a complex of ecomorphologically distinctive populations of Black Salamanders (Aneides flavipunctatus) that are parapatrically distributed and meet at a three-way contact zone in north-western California. We used mitochondrial tree-based and multilocus clustering methods to evaluate a priori two- (Northern and Southern) and three (Northern, Coast and Inland) population hypotheses derived from previous studies. Mitochondrial results were consistent with the two- and three-population hypotheses, while the nDNA clustering results supported only the two-population hypothesis. Historical demographic analyses and mtDNA gene divergence estimates revealed that the Northern and Southern populations split during the Pliocene (2-5 Ma). Subdivision of the Southern population into Coast and Inland populations was estimated to be late Pleistocene (0.24 Ma), although our mtDNA results suggested a Pliocene divergence. Effective gene flow estimates (2N(e)m) suggest that either the two- or three-population hypotheses remain valid. However, our results unexpectedly revealed that the Northern population might instead represent two parapatric populations that separated nearly 4 Ma. These results are surprising because the Pliocene divergence between these ecomorphologically conservative forms is similar or older than for the ecomorphologically divergent Coast and Inland sister populations. We conclude that Black Salamanders in north-western California belong to at least three or four populations or species, and these all meet criteria for being Evolutionary Significant Units or 'ESUs' and therefore warrant conservation consideration.

  5. Reduced effects of thyroid hormone on gene expression and metamorphosis in a paedomorphic plethodontid salamander.

    PubMed

    Aran, Robert P; Steffen, Michael A; Martin, Samuel D; Lopez, Olivia I; Bonett, Ronald M

    2014-07-01

    It has been over a century since Gudernatsch (1912, Wilhelm Roux Arch Entwickl Mech Org 35:457-483) demonstrated that mammalian thyroid gland extracts can stimulate tadpole metamorphosis. Despite the tremendous developmental diversity of amphibians, mechanisms of metamorphosis have mostly been studied in a few model systems. This limits our understanding of the processes that influence the evolution of developmental aberrations. Here we isolated thyroid hormone receptors alpha (TRα) and beta (TRβ) from Oklahoma salamanders (Eurycea tynerensis), which exhibit permanently aquatic (paedomorphic) or biphasic (metamorphic) developmental modes in different populations. We found that TRα and TRβ were upregulated by thyroid hormone (T3 ) in tail tissues of larvae from metamorphic populations, but basal levels of TR expression and T3 responsiveness were reduced in larvae from paedomorphic populations. Likewise, we found that T3 treatment resulted in complete loss of larval epibranchials in larvae from metamorphic populations, but little to no epibranchial remodeling occurred in larvae from paedomorphic populations over the same duration. This is the first study to directly demonstrate reduced gene expression and metamorphic responses to T3 in a paedomorphic plethodontid compared to metamorphic conspecifics, and the first salamander system to show differential expression of thyroid hormone receptors associated with alternative developmental patterns.

  6. Maintaining plethodontid salamanders in the laboratory for regeneration studies.

    PubMed

    Arenas, Claudia Marcela; Gómez-Molina, Andrea; Delgado, Jean Paul

    2015-01-01

    Limb regeneration studies have been extensively carried out in species of Ambystomatidae and Salamandridae families. So far limited research has been conducted in species belonging to the Plethodontidae family, where some of the species differs from other salamander families due to their direct development, thus absence of a larval life. Here, we describe a protocol to maintain the plethodontid salamanders of genus Bolitoglossa species under laboratory conditions to perform regeneration studies.

  7. A portable detection instrument based on DSP for beef marbling

    NASA Astrophysics Data System (ADS)

    Zhou, Tong; Peng, Yankun

    2014-05-01

    Beef marbling is one of the most important indices to assess beef quality. Beef marbling is graded by the measurement of the fat distribution density in the rib-eye region. However quality grades of beef in most of the beef slaughtering houses and businesses depend on trainees using their visual senses or comparing the beef slice to the Chinese standard sample cards. Manual grading demands not only great labor but it also lacks objectivity and accuracy. Aiming at the necessity of beef slaughtering houses and businesses, a beef marbling detection instrument was designed. The instrument employs Charge-coupled Device (CCD) imaging techniques, digital image processing, Digital Signal Processor (DSP) control and processing techniques and Liquid Crystal Display (LCD) screen display techniques. The TMS320DM642 digital signal processor of Texas Instruments (TI) is the core that combines high-speed data processing capabilities and real-time processing features. All processes such as image acquisition, data transmission, image processing algorithms and display were implemented on this instrument for a quick, efficient, and non-invasive detection of beef marbling. Structure of the system, working principle, hardware and software are introduced in detail. The device is compact and easy to transport. The instrument can determine the grade of beef marbling reliably and correctly.

  8. Habitat utilization, density, and growth of steelhead trout, coho salmon, and Pacific giant salamander in relation to habitat types in a small coastal redwood stream

    Treesearch

    Michael Roy Lau

    1994-01-01

    Abstract - Small Pacific northwestern coastal streams are nurseries for populations of young of the year coho salmon, steelhead trout, and the Pacific giant salamander larvae. Previous field studies suggest that the habitats of the juveniles of these species were similar to one another. Few habitat utilization studies focus on the juvenile stages of these species...

  9. Site-level habitat models for the endemic, threatened Cheat Mountain salamander (Plethodon nettingi): the importance of geophysical and biotic attributes for predicting occurrence

    Treesearch

    Lester O. Dillard; Kevin R. Russell; W. Mark Ford

    2008-01-01

    The federally threatened Cheat Mountain salamander (Plethodon nettingi; hereafter CMS) is known to occur in approximately 70 small, scattered populations in the Allegheny Mountains of eastern West Virginia, USA. Current conservation and management efforts on federal, state, and private lands involving CMS largely rely on small scale, largely...

  10. Erasmus syndrome in a marble worker.

    PubMed

    Bello, S; Rinaldi, A; Trabucco, S; Serafino, L; Bonali, C; Lapadula, G

    2015-12-30

    Erasmus syndrome is defined as the association of silica exposure and subsequent development of systemic sclerosis. The limited number of cases reported in the literature mainly involves miners and only sporadically other professionals. We describe a case of Erasmus syndrome in a marble worker. A 68 year old man came to our observation complaining pelvic and scapular girdle pain, evening fever, intense weakness and emaciation for about 1 month. He also reported to have had Raynaud's phenomenon in his hands for the last 13 years. Also, his occupational history revealed a chronic exposure to silica dust. The patient presented pain in his shoulders and hips, moderate skin thickening and sclerosis in his hands and fingers extending proximally to his wrists. The diagnosis of systemic sclerosis was determined according to his clinical and medical history, the positivity of anti-Scl 70 antibodies, the nailfold capillaroscopy suggestive of an active scleroderma pattern and the detection of a mild restrictive pulmonary syndrome. The evaluation of the organbased complications excluded a gastroenterological and cardiovascular involvement, while the chest computed tomography (CT) detected multiple small nodules with a mantle distribution and enlarged lymph nodes with no signs of interstitial lung disease and fibrosis. Additional tests (positron emission tomography-CT, flexible bronchoscopy and broncho-alveolar lavage) excluded infectious diseases and cancer. However, given the pulmonary involvement, we performed a histological examination of the parenchyma and lymph nodes, which revealed a picture of pneumoconiosis. In the end, the occupational history and the findings from the diagnostic procedures led to the diagnosis of pulmonary silicosis. The precise definition of the pulmonary involvement was essential to the therapeutic approach to this patient.

  11. Life history plasticity does not confer resilience to environmental change in the mole salamander (Ambystoma talpoideum)

    USGS Publications Warehouse

    Courtney L. Davis,; David A.W. Miller,; Walls, Susan; Barichivich, William J.; Riley, Jeffrey W.; Brown, Mary E.

    2017-01-01

    Plasticity in life history strategies can be advantageous for species that occupy spatially or temporally variable environments. We examined how phenotypic plasticity influences responses of the mole salamander, Ambystoma talpoideum, to disturbance events at the St. Marks National Wildlife Refuge (SMNWR), FL, USA from 2009 to 2014. We observed periods of extensive drought early in the study, in contrast to high rainfall and expansive flooding events in later years. Flooding facilitated colonization of predatory fishes to isolated wetlands across the refuge. We employed multistate occupancy models to determine how this natural experiment influenced the occurrence of aquatic larvae and paedomorphic adults and what implications this may have for the population. We found that, in terms of occurrence, responses to environmental variation differed between larvae and paedomorphs, but plasticity (i.e. the ability to metamorphose rather than remain in aquatic environment) was not sufficient to buffer populations from declining as a result of environmental perturbations. Drought and fish presence negatively influenced occurrence dynamics of larval and paedomorphic mole salamanders and, consequently, contributed to observed short-term declines of this species. Overall occurrence of larval salamanders decreased from 0.611 in 2009 to 0.075 in 2014 and paedomorph occurrence decreased from 0.311 in 2009 to 0.121 in 2014. Although variation in selection pressures has likely maintained this polyphenism previously, our results suggest that continued changes in environmental variability and the persistence of fish in isolated wetlands could lead to a loss of paedomorphosis in the SMNWR population and, ultimately, impact regional persistence in the future.

  12. Life history plasticity does not confer resilience to environmental change in the mole salamander (Ambystoma talpoideum).

    PubMed

    Davis, Courtney L; Miller, David A W; Walls, Susan C; Barichivich, William J; Riley, Jeffrey; Brown, Mary E

    2017-03-01

    Plasticity in life history strategies can be advantageous for species that occupy spatially or temporally variable environments. We examined how phenotypic plasticity influences responses of the mole salamander, Ambystoma talpoideum, to disturbance events at the St. Marks National Wildlife Refuge (SMNWR), FL, USA from 2009 to 2014. We observed periods of extensive drought early in the study, in contrast to high rainfall and expansive flooding events in later years. Flooding facilitated colonization of predatory fishes to isolated wetlands across the refuge. We employed multistate occupancy models to determine how this natural experiment influenced the occurrence of aquatic larvae and paedomorphic adults and what implications this may have for the population. We found that, in terms of occurrence, responses to environmental variation differed between larvae and paedomorphs, but plasticity (i.e. the ability to metamorphose rather than remain in aquatic environment) was not sufficient to buffer populations from declining as a result of environmental perturbations. Drought and fish presence negatively influenced occurrence dynamics of larval and paedomorphic mole salamanders and, consequently, contributed to observed short-term declines of this species. Overall occurrence of larval salamanders decreased from 0.611 in 2009 to 0.075 in 2014 and paedomorph occurrence decreased from 0.311 in 2009 to 0.121 in 2014. Although variation in selection pressures has likely maintained this polyphenism previously, our results suggest that continued changes in environmental variability and the persistence of fish in isolated wetlands could lead to a loss of paedomorphosis in the SMNWR population and, ultimately, impact regional persistence in the future.

  13. Using stable isotopes to test for trophic niche partitioning: a case study with stream salamanders and fish

    USGS Publications Warehouse

    Sepulveda, Adam; Lowe, Winsor H.; Marra, Peter P.

    2012-01-01

    5. Although we did not identify mechanisms that facilitate salamander and fish coexistence, our empirical data and use of novel approaches to describe the trophic niche did yield important insights on the role of predator–prey interactions and cannibalism as alternative coexistence mechanisms. In addition, we found that 95% kernel estimators are a simple and robust method to describe population-level measure of trophic structure.

  14. Utilisation of Waste Marble Dust as Fine Aggregate in Concrete

    NASA Astrophysics Data System (ADS)

    Vigneshpandian, G. V.; Aparna Shruthi, E.; Venkatasubramanian, C.; Muthu, D.

    2017-07-01

    Concrete is the important construction material and it is used in the construction industry due to its high compressive strength and its durability. Now a day’s various studies have been conducted to make concrete with waste material with the intention of reducing cost and unavailability of conventional materials. This paper investigates the strength properties of concrete specimens cast using waste marble dust as replacement of fine aggregate. The marble pieces are finely crushed to powdered and the gradation is compared with conventional fine aggregate. Concrete specimen were cast using wmd in the laboratory with different proportion (25%, 50% and 100%) by weight of cement and from the studies it reveals that addition of waste marble dust as a replacement of fine aggregate marginally improves compressive, tensile and flexural strength in concrete.

  15. Petrology of UHP calcite marble from the Kokchetav Massif

    NASA Astrophysics Data System (ADS)

    Aoki, K.; Adachi, T.; Kikuchi, M.; Ogasawara, Y.

    2004-12-01

    In the Kumdy-kol area, Kokchetav Massif, northern Kazakhstan, three types of UHP marbles have been described: diamond-bearing dolomite marble, Ti-clinohumite-bearing dolomitic marble (Ogasawara et al., 2000) and titanite-bearing calcite marble (Ogasawara et al., 2002). UHP calcite marble is distinguished from other types of UHP marbles by pure calcite (after aragonite) as a dominant carbonate phase. This calcite marble has unique evidence of UHP metamorphism; titanite with coesite exsolution and its precursor compositions indicated that the peak P-T conditions was > 6 GPa and 980-1250 C (Ogasawara et al., 2000; 2002). This rock shows typical granoblastic texture consisting of calcite, diopside, K-feldspar, titanite and symplectite (diopside + zoisite) after garnet. The peak assemblage was aragonite + diopside + K-feldspar + garnet + titanite. Based on the phase relations in the system CaO-MgO-TiO2-SiO2-CO2-H2O, aragonite + diopside + rutile tie-triangle is stable under UHP conditions and divides the compositional space into dolomite-bearing or dolomite-free tetrahedrons (Kikuchi et al., 2003). The presence of titanite in calcite marble means that P-T condition was located at the right-hand side of the reaction rutile + aragonite + coesite = titanite + CO2. Previously described titanite-bearing calcite marble is diamond-free (A-type) and is characterized by titanite with coesite exsolution (Ogasawara et al., 2002). Recently, we found a small amount of diamond in calcite marble (B-type) that is characterized by microdiamond in diopside, and by the lack of K-feldspar and low amount of titanite. No diamond occurs in titanite. Rutile, aragonite and calcite inclusions in titanite were found in titanite of B-type calcite marble. These three inclusion phases in titanite that were confirmed by laser Raman spectroscopy are the evidence for titanite formation reaction described above. This titanite forming reaction occurs at extremely low XCO2 conditions as 0.02. In B

  16. Scale-dependent genetic structure of the Idaho giant salamander (Dicamptodon aterrimus) in stream networks.

    PubMed

    Mullen, Lindy B; Arthur Woods, H; Schwartz, Michael K; Sepulveda, Adam J; Lowe, Winsor H

    2010-03-01

    The network architecture of streams and rivers constrains evolutionary, demographic and ecological processes of freshwater organisms. This consistent architecture also makes stream networks useful for testing general models of population genetic structure and the scaling of gene flow. We examined genetic structure and gene flow in the facultatively paedomorphic Idaho giant salamander, Dicamptodon aterrimus, in stream networks of Idaho and Montana, USA. We used microsatellite data to test population structure models by (i) examining hierarchical partitioning of genetic variation in stream networks; and (ii) testing for genetic isolation by distance along stream corridors vs. overland pathways. Replicated sampling of streams within catchments within three river basins revealed that hierarchical scale had strong effects on genetic structure and gene flow. amova identified significant structure at all hierarchical scales (among streams, among catchments, among basins), but divergence among catchments had the greatest structural influence. Isolation by distance was detected within catchments, and in-stream distance was a strong predictor of genetic divergence. Patterns of genetic divergence suggest that differentiation among streams within catchments was driven by limited migration, consistent with a stream hierarchy model of population structure. However, there was no evidence of migration among catchments within basins, or among basins, indicating that gene flow only counters the effects of genetic drift at smaller scales (within rather than among catchments). These results show the strong influence of stream networks on population structure and genetic divergence of a salamander, with contrasting effects at different hierarchical scales.

  17. Liquid marbles stabilized by charged polymer latexes: how does the drying of the latex particles affect the properties of liquid marbles?

    PubMed

    Sun, Guanqing; Sheng, Yifeng; Wu, Jie; Ma, Guanghui; Ngai, To

    2014-10-28

    The coating of solid particles on the surface of liquid in air makes liquid marbles a promising approach in the transportation of a small amount of liquid. The stabilization of liquid marbles by polymeric latex particles imparts extra triggers such as pH and temperature, leading to the remote manipulation of droplets for many potential applications. Because the functionalized polymeric latexes can exist either as colloidally stable latex or as flocculated latex in a dispersion, the drying of latex dispersions under different conditions may play a significant role in the stabilization of subsequent liquid marbles. This article presents the investigation of liquid marbles stabilized by poly(styrene-co-methacrylic acid) (PS-co-MAA) particles drying under varied conditions. Protonation of the particles before freeze drying makes the particles excellent liquid marble stabilizers, but it is hard to stabilize liquid marbles for particles dried in their deprotonated states. The static properties of liquid marbles with increasing concentrations of protonating reagent revealed that the liquid marbles are gradually undermined by protonating the stabilizers. Furthermore, the liquid marbles stabilized by different particles showed distinct behaviors in separation and merging manipulated by tweezers. This study shows that the initial state of the particles should be carefully taken into account in formulating liquid marbles.

  18. Evolutionary response to global change: Climate and land use interact to shape color polymorphism in a woodland salamander.

    PubMed

    Cosentino, Bradley J; Moore, Jean-David; Karraker, Nancy E; Ouellet, Martin; Gibbs, James P

    2017-07-01

    Evolutionary change has been demonstrated to occur rapidly in human-modified systems, yet understanding how multiple components of global change interact to affect adaptive evolution remains a critical knowledge gap. Climate change is predicted to impose directional selection on traits to reduce thermal stress, but the strength of directional selection may be mediated by changes in the thermal environment driven by land use. We examined how regional climatic conditions and land use interact to affect genetically based color polymorphism in the eastern red-backed salamander (Plethodon cinereus). P. cinereus is a woodland salamander with two primary discrete color morphs (striped, unstriped) that have been associated with macroclimatic conditions. Striped individuals are most common in colder regions, but morph frequencies can be variable within climate zones. We used path analysis to analyze morph frequencies among 238,591 individual salamanders across 1,170 sites in North America. Frequency of striped individuals was positively related to forest cover in populations occurring in warmer regions (>7°C annually), a relationship that was weak to nonexistent in populations located in colder regions (≤7°C annually). Our results suggest that directional selection imposed by climate warming at a regional scale may be amplified by forest loss and suppressed by forest persistence, with a mediating effect of land use that varies geographically. Our work highlights how the complex interaction of selection pressures imposed by different components of global change may lead to divergent evolutionary trajectories among populations.

  19. 75 FR 64303 - Vermont Marble Power, Division of Omya Inc.; Central Vermont Public Service Corporation; Notice...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-10-19

    ... Energy Regulatory Commission Vermont Marble Power, Division of Omya Inc.; Central Vermont Public Service... Soliciting Comments and Motions To Intervene October 12, 2010. On August 31, 2010, Vermont Marble Power... relicensing. Applicant Contacts: For transferor: Todd Allard, Operations Engineer Omya, Inc., Vermont Marble...

  20. Effects of acid rain and sulfur dioxide on marble dissolution

    USGS Publications Warehouse

    Schuster, Paul F.; Reddy, Michael M.; Sherwood, Susan I.

    1994-01-01

    Acid precipitation and the dry deposition of sulfur dioxide (SO2) accelerate damage to carbonate-stone monuments and building materials. This study identified and quantified environmental damage to a sample of Vermont marble during storms and their preceding dry periods. Results from field experiments indicated the deposition of SO2 gas to the stone surface during dry periods and a twofold increase in marble dissolution during coincident episodes of low rain rate and decreased rainfall pH. The study is widely applicable to the analysis of carbonate-stone damage at locations affected by acid rain and air pollution.

  1. 16. CELLAR, UNDER WEST MEETING ROOM, LOOKING SOUTHEAST. Discarded marble ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    16. CELLAR, UNDER WEST MEETING ROOM, LOOKING SOUTHEAST. Discarded marble range top incorporated into a low brick partition. It is possible the range originally stood between the two brick walls beyond to the right. There appears to be a bricked-up fire box opening in the far wall. The fragments of the marble range top have been catalogued into the Architectural Study Collection of Independence National Historical Park. Dimensions recorded in Field Records. - Twelfth Street Meeting House, 20 South Twelfth Street, Philadelphia, Philadelphia County, PA

  2. Effects of acid rain and sulfur dioxide on marble dissolution

    SciTech Connect

    Schuster, P.F.; Reddy, M.M. ); Sherwood, S.I. )

    1994-01-01

    Acid precipitation and the dry deposition of sulfur dioxide (SO[sub 2]) accelerate damage to carbonate-stone monuments and building materials. This study identified and quantified environmental damage to a sample of Vermont marble during storms and their preceding dry periods. Results from field experiments indicated the deposition of SO[sub 2] gas to the stone surface during dry periods and a twofold increase in marble dissolution during coincident episodes of low rain rate and decreased rainfall pH. The study is widely applicable to the analysis of carbonate-stone damage at locations affected by acid rain and air pollution.

  3. Batrachochytrium salamandrivorans is the predominant chytrid fungus in Vietnamese salamanders

    PubMed Central

    Laking, Alexandra E.; Ngo, Hai Ngoc; Pasmans, Frank; Martel, An; Nguyen, Tao Thien

    2017-01-01

    The amphibian chytrid fungi, Batrachochytrium dendrobatidis (Bd) and B. salamandrivorans (Bsal), pose a major threat to amphibian biodiversity. Recent evidence suggests Southeast Asia as a potential cradle for both fungi, which likely resulted in widespread host-pathogen co-existence. We sampled 583 salamanders from 8 species across Vietnam in 55 locations for Bsal and Bd, determined scaled mass index as a proxy for fitness and collected environmental data. Bsal was found within 14 of the 55 habitats (2 of which it was detected in 2013), in 5 salamandrid species, with a prevalence of 2.92%. The globalized pandemic lineage of Bd was found within one pond on one species with a prevalence of 0.69%. Combined with a complete lack of correlation between infection and individual body condition and absence of indication of associated disease, this suggests low level pathogen endemism and Bsal and Bd co-existence with Vietnamese salamandrid populations. Bsal was more widespread than Bd, and occurs at temperatures higher than tolerated by the type strain, suggesting a wider thermal niche than currently known. Therefore, this study provides support for the hypothesis that these chytrid fungi may be endemic to Asia and that species within this region may act as a disease reservoir. PMID:28287614

  4. Multiple paternity in a salamander with socially monogamous behaviour.

    PubMed

    Liebgold, Eric B; Cabe, Paul R; Jaeger, Robert G; Leberg, Paul L

    2006-11-01

    In the majority of birds and mammals, social monogamy is not congruent with genetic monogamy. No research to date has compared social and genetic monogamy in amphibians. We analysed paternity in clutches of red-backed salamanders (Plethodon cinereus), a species in which social monogamy has been demonstrated in the laboratory, and 28% of individuals in the forest are found in male-female pairs in the noncourtship season. We collected 16 clutches of eggs of P. cinereus in the southern Appalachian Mountains of Virginia and collected tail clippings from attending mothers. We genotyped embryos and adults at five microsatellite loci in order to analyse paternity of clutches. Most clutches (84.6%) had multiple sires, with two to three sires per clutch. In this study, 25% of clutches had males in addition to females attending eggs. None of the mothers of these clutches were genetically monogamous. All attending males sired some of the offspring in the clutch that they attended (between 9% and 50%) but never sired a majority in that clutch. We conclude that, at least in this population, social monogamy in P. cinereus is not concomitant with genetic monogamy.

  5. Olfactory receptor gene expression in tiger salamander olfactory epithelium.

    PubMed

    Marchand, James E; Yang, Xinhai; Chikaraishi, Dona; Krieger, Jurgen; Breer, Heinz; Kauer, John S

    2004-06-28

    Physiological studies of odor-elicited responses from the olfactory epithelium and bulb in the tiger salamander, Ambystoma tigrinum, have elucidated a number of features of olfactory coding that appear to be conserved across several vertebrate species. This animal model has provided an accessible in vivo system for observing individual and ensemble olfactory responses to odorant stimulation using biochemical, neurophysiological, and behavioral assays. In this paper we have complemented these studies by characterizing 35 candidate odorant receptor genes. These receptor sequences are similar to those of the large families of olfactory receptors found in mammals and fish. In situ hybridization, using RNA probes to 20 of these sequences, demonstrates differential distributions of labeled cells across the extent and within the depth of the olfactory epithelium. The distributions of cells labeled with probes to different receptors show spatially restricted patterns that are generally localized to different degrees in medial-lateral and anterior-posterior directions. The patterns of receptor expression in the ventral olfactory epithelium (OE) are mirrored in the dorsal OE. We present a hypothesis as to how the sensory neuron populations expressing different receptor types responding to a particular odorant may relate to the distribution patterns of epithelial and bulbar responses previously characterized using single-unit and voltage-sensitive dye recording methods. Copyright 2004 Wiley-Liss, Inc.

  6. Life History of a Unique Asian Plethodontid Salamander, Karsenia koreana.

    PubMed

    Song, Jae-Young; Matsui, Masafumi; Matsuki, Takashi; Nishikawa, Kanto; Koo, Kyo-Soung; Oh, Hong-Shik

    2017-04-01

    Using preserved specimens, we studied the basic life history of the topotypic population of the unique Asian plethodontid salamander, Karsenia koreana. Of 51 individuals examined, 11 males and 13 females were judged as mature from the development of gonads. The ovarian eggs were large (diameter 3.7-4.8 mm) and yellow to orange in color, and the clutch size was about 8-10. These values approximate those of actually spawned eggs recently reported. Skeletochronological analyses revealed the average age of males (5.3 years) to be lower than females (7.3 years). The age at maturity and maximum observed longevity were four and nine years in males and five and 10 years in females, respectively. In the growth curves estimated by a von Bertalanffy growth model, the growth coefficient and asymptotic SVL did not differ between the sexes, although males (40.6 mm) were smaller than females (45.3 mm) in the average snout-vent length. The time and place of courtship behavior, oval development, hatching, and especially, whether the species shows aquatic larval stage or direct development, are important topics to be resolved in future.

  7. Influence of headwater site conditions and riparian buffers on terrestrial salamander response to forest thinning.

    Treesearch

    D.E. Rundio; D.H. Olson

    2007-01-01

    We examined the effect of forest thinning and riparian buffers along headwater streams on terrestrial salamanders at two sites in western Oregon. Salamander numbers were reduced postthinning at one site with lower down-wood volume. Terrestrial salamander distributions along stream-to-upslope transects suggest benefits of one and two site-potential tree-height stream...

  8. Hellbender genome sequences shed light on genomic expansion at the base of crown salamanders.

    PubMed

    Sun, Cheng; Mueller, Rachel Lockridge

    2014-07-01

    Among animals, genome sizes range from 20 Mb to 130 Gb, with 380-fold variation across vertebrates. Most of the largest vertebrate genomes are found in salamanders, an amphibian clade of 660 species. Thus, salamanders are an important system for studying causes and consequences of genomic gigantism. Previously, we showed that plethodontid salamander genomes accumulate higher levels of long terminal repeat (LTR) retrotransposons than do other vertebrates, although the evolutionary origins of such sequences remained unexplored. We also showed that some salamanders in the family Plethodontidae have relatively slow rates of DNA loss through small insertions and deletions. Here, we present new data from Cryptobranchus alleganiensis, the hellbender. Cryptobranchus and Plethodontidae span the basal phylogenetic split within salamanders; thus, analyses incorporating these taxa can shed light on the genome of the ancestral crown salamander lineage, which underwent expansion. We show that high levels of LTR retrotransposons likely characterize all crown salamanders, suggesting that disproportionate expansion of this transposable element (TE) class contributed to genomic expansion. Phylogenetic and age distribution analyses of salamander LTR retrotransposons indicate that salamanders' high TE levels reflect persistence and diversification of ancestral TEs rather than horizontal transfer events. Finally, we show that relatively slow DNA loss rates through small indels likely characterize all crown salamanders, suggesting that a decreased DNA loss rate contributed to genomic expansion at the clade's base. Our identification of shared genomic features across phylogenetically distant salamanders is a first step toward identifying the evolutionary processes underlying accumulation and persistence of high levels of repetitive sequence in salamander genomes.

  9. Using counts to simultaneously estimate abundance and detection probabilities in a salamander community

    USGS Publications Warehouse

    Dodd, C.K.; Dorazio, R.M.

    2004-01-01

    A critical variable in both ecological and conservation field studies is determining how many individuals of a species are present within a defined sampling area. Labor intensive techniques such as capture-mark-recapture and removal sampling may provide estimates of abundance, but there are many logistical constraints to their widespread application. Many studies on terrestrial and aquatic salamanders use counts as an index of abundance, assuming that detection remains constant while sampling. If this constancy is violated, determination of detection probabilities is critical to the accurate estimation of abundance. Recently, a model was developed that provides a statistical approach that allows abundance and detection to be estimated simultaneously from spatially and temporally replicated counts. We adapted this model to estimate these parameters for salamanders sampled over a six vear period in area-constrained plots in Great Smoky Mountains National Park. Estimates of salamander abundance varied among years, but annual changes in abundance did not vary uniformly among species. Except for one species, abundance estimates were not correlated with site covariates (elevation/soil and water pH, conductivity, air and water temperature). The uncertainty in the estimates was so large as to make correlations ineffectual in predicting which covariates might influence abundance. Detection probabilities also varied among species and sometimes among years for the six species examined. We found such a high degree of variation in our counts and in estimates of detection among species, sites, and years as to cast doubt upon the appropriateness of using count data to monitor population trends using a small number of area-constrained survey plots. Still, the model provided reasonable estimates of abundance that could make it useful in estimating population size from count surveys.

  10. Coprophagy in a cave-adapted salamander; the importance of bat guano examined through nutritional and stable isotope analyses.

    PubMed

    Fenolio, Danté B; Graening, G O; Collier, Bret A; Stout, Jim F

    2006-02-22

    During a two year population ecology study in a cave environment, 15 Eurycea (= Typhlotriton) spelaea were observed ingesting bat guano. Furthermore, E. spelaea capture numbers increased significantly during the time that grey bats (Myotis grisescens) deposited fresh guano. We investigated the hypothesis that this behaviour was not incidental to the capture of invertebrate prey, but a diet switch to an energy-rich detritus in an oligotrophic environment. Stable isotope assays determined that guano may be assimilated into salamander muscle tissue, and nutritional analyses revealed that guano is a comparable food source to potential invertebrate prey items. This is the first report of coprophagy in a salamander and in any amphibian for reasons other than intestinal inoculation. Because many temperate subterranean environments are often energy poor and this limitation is thought to select for increased diet breadth, we predict that coprophagy may be common in subterranean vertebrates where it is not currently recognized.

  11. Coprophagy in a cave-adapted salamander; the importance of bat guano examined through nutritional and stable isotope analyses

    PubMed Central

    Fenolio, Danté B; Graening, G.O; Collier, Bret A; Stout, Jim F

    2005-01-01

    During a two year population ecology study in a cave environment, 15 Eurycea (=Typhlotriton) spelaea were observed ingesting bat guano. Furthermore, E. spelaea capture numbers increased significantly during the time that grey bats (Myotis grisescens) deposited fresh guano. We investigated the hypothesis that this behaviour was not incidental to the capture of invertebrate prey, but a diet switch to an energy-rich detritus in an oligotrophic environment. Stable isotope assays determined that guano may be assimilated into salamander muscle tissue, and nutritional analyses revealed that guano is a comparable food source to potential invertebrate prey items. This is the first report of coprophagy in a salamander and in any amphibian for reasons other than intestinal inoculation. Because many temperate subterranean environments are often energy poor and this limitation is thought to select for increased diet breadth, we predict that coprophagy may be common in subterranean vertebrates where it is not currently recognized. PMID:16615210

  12. Landscape genetics of the blotched tiger salamander (Ambystoma tigrinum melanostictum).

    PubMed

    Spear, Stephen F; Peterson, Charles R; Matocq, Marjorie D; Storfer, Andrew

    2005-07-01

    The field of landscape genetics has great potential to identify habitat features that influence population genetic structure. To identify landscape correlates of genetic differentiation in a quantitative fashion, we developed a novel approach using geographical information systems analysis. We present data on blotched tiger salamanders (Ambystoma tigrinum melanostictum) from 10 sites across the northern range of Yellowstone National Park in Montana and Wyoming, USA. We used eight microsatellite loci to analyse population genetic structure. We tested whether landscape variables, including topographical distance, elevation, wetland likelihood, cover type and number of river and stream crossings, were correlated with genetic subdivision (F(ST)). We then compared five hypothetical dispersal routes with a straight-line distance model using two approaches: (i) partial Mantel tests using Akaike's information criterion scores to evaluate model robustness and (ii) the BIOENV procedure, which uses a Spearman rank correlation to determine the combination of environmental variables that best fits the genetic data. Overall, gene flow appears highly restricted among sites, with a global F(ST) of 0.24. While there is a significant isolation-by-distance pattern, incorporating landscape variables substantially improved the fit of the model (from an r2 of 0.3 to 0.8) explaining genetic differentiation. It appears that gene flow follows a straight-line topographic route, with river crossings and open shrub habitat correlated with lower F(ST) and thus, decreased differentiation, while distance and elevation difference appear to increase differentiation. This study demonstrates a general approach that can be used to determine the influence of landscape variables on population genetic structure.

  13. Response of the green alga Oophila sp., a salamander endosymbiont, to a PSII-inhibitor under laboratory conditions.

    PubMed

    Baxter, Leilan; Brain, Richard; Rodriguez-Gil, Jose Luis; Hosmer, Alan; Solomon, Keith; Hanson, Mark

    2014-08-01

    In a rare example of autotroph-vertebrate endosymbiosis, eggs of the yellow-spotted salamander (Ambystoma maculatum) are colonized by a green alga (Oophila sp.) that significantly enhances salamander development. Previous studies have demonstrated the potential for impacts to the salamander embryo when growth of the algae is impaired by exposure to herbicides. To further investigate this relationship, the authors characterized the response of the symbiotic algae (Oophila sp.) alone to the photosystem II (PSII) inhibitor atrazine under controlled laboratory conditions. After extraction of the alga from A. maculatum eggs and optimization of culturing conditions, 4 toxicity assays (96 h each) were conducted. Recovery of the algal population was also assessed after a further 96 h in untreated media. Average median effective concentration (EC50) values of 123 µg L(-1) (PSII yield), 169 µg L(-1) (optical density), and 299 µg L(-1) (growth rate) were obtained after the 96-h exposure. Full recovery of exposed algal populations after 96 h in untreated media was observed for all endpoints, except for optical density at the greatest concentration tested (300 µg L(-1) ). Our results show that, under laboratory conditions, Oophila sp. is generally less sensitive to atrazine than standard test species. Although conditions of growth in standard toxicity tests are not identical to those in the natural environment, these results provide an understanding of the tolerance of this alga to PSII inhibitors as compared with other species. © 2014 SETAC.

  14. Chapter 19: Marbled Murrelet Habitat Associations in Oregon

    Treesearch

    Jeffrey J. Grenier; S. Kim Nelson

    1995-01-01

    We described habitat associations of Marbled Murrelet (Brachyramphus marmoratus) nesting (n = 10) and occupied (n = 184) sites in Oregon. We compared habitat characteristics of 177 occupied sites to a random sample of 9,625 sites (n = 531) of unknown murrelet status. In addition, we briefly...

  15. Chapter 22: Marbled Murrelet Food Habits and Prey Ecology

    Treesearch

    Esther E. Burkett

    1995-01-01

    Information on food habits of the Marbled Murrelet (Brachyramphus marmoratus) was compiled from systematic studies and anecdotal reports from Alaska to California. Major differences between the winter and summer diets were apparent, with euphausiids and mysids becoming more dominant during winter and spring. The primary invertebrate prey items were...

  16. 69. (Credit JTL) View beneath marble meter bench showing hydraulic ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    69. (Credit JTL) View beneath marble meter bench showing hydraulic lines leading to water valve hydraulic control cylinders from control handles in bench; strings and pulleys activate meters. - McNeil Street Pumping Station, McNeil Street & Cross Bayou, Shreveport, Caddo Parish, LA

  17. Liquid marble: A novel liquid nanofoam structure for energy absorption

    NASA Astrophysics Data System (ADS)

    Li, Mingzhe; Lu, Weiyi

    2017-05-01

    The liquid nanofoam (LN), a system composed of liquid and hydrophobic nanoporous particles, is a promising energy absorbing material. Despite its excellent energy absorbing capabilities under quasi-static conditions, the LN's performance is limited under dynamic impacts due to its heterogeneity. We hypothesize that the energy absorption capacity of the LN can be increased by reconfiguration of the material into a liquid marble form. To test this hypothesis, we have prepared the LN sample in two different configurations, one with the heterogeneous layered structure and the other with a macroscopically homogeneous liquid marble structure. The mechanical behavior of these two types of LN was examined by quasi-static compression tests and dynamic impact tests. We demonstrated that although both types of LN exhibited comparable quasi-static energy absorption capacity, the liquid marble form of LN showed better performance under dynamic impacts. These findings suggest that the liquid marble form is the preferred LN structure under blunt impact and shed lights on the design of next-generation energy absorbing materials and structures.

  18. Chapter 4: Nesting Chronology of the Marbled Murrelet

    Treesearch

    Thomas E. Hamer; S. Kim Nelson

    1995-01-01

    We compiled 86 breeding records of eggs, downy young,and fledgling Marbled Murrelets (Brachyramphus marmoratus) for which the fledging date could be estimated. Records were collected from California (n = 25), Oregon (n = 13), Washington (n = 13), British Columbia (n = 23), and Alaska (n = 12). The number of young fledging increased rapidly from 6...

  19. Chapter 2: The Asian Race of the Marbled Murrelet

    Treesearch

    Nikolai B. Konyukhov; Alexander S. Kitaysky

    1995-01-01

    We present here an overview of the ecology, abundance, and distribution of the subspecies of the Marbled Murrelet inhabiting the coasts of Asia. In most regards, the species is similar to the North American race with respect to its feeding, breeding, molt, and habitat ecology. It is, however, a migratory species, moving into southern parts of its range in the Sea of...

  20. An Unusual Case of Marble Intraocular Foreign Body

    PubMed Central

    Omoti, Afekhide E.; Dawodu, Oseluese A.; Ogbeide, Osesogie U.

    2008-01-01

    This report presents a case of marble intraocular foreign body that developed toxic complications during surgery. The patient is a 25 years old male who presented to the University of Benin Teaching Hospital with a history of trauma to the right eye while cutting marble. He was examined, had an ocular ultrasound scan and subsequently had an extracapsular cataract extraction. His visual acuity in the right eye was light perception. There was an entry point on the cornea, the lens was opaque, there was vitreous haemorrhage and the intraocular foreign body was localized in the posterior part of the posterior segment by ultrasound scan. He had extracapsular cataract extraction. During anterior capsulotomy, the cornea suddenly and rapidly became cloudy with a brownish tinge and the corneal epithelium started desquamating.Marble on its own may not be toxic but the other chemicals including cement, used in the processing of the marble were responsible for this delayed toxicity. Ultrasound scan is valuable in localisation of intraocular foreign bodies. PMID:20379429

  1. Measuring Marbles: Demonstrating the Basic Tenets of Measurement Theory

    ERIC Educational Resources Information Center

    Wininger, Steven R.

    2007-01-01

    A hands-on activity is described in which students attempt to measure something that they cannot see. In small groups, students estimate the number of marbles in sealed boxes. Next, students' estimates are compared with the actual numbers. Last, values from both the students' estimates and actual numbers are used to explain measurement theory and…

  2. Chapter 36: Status of Forest Habitat of the Marbled Murrelet

    Treesearch

    David A. Perry

    1995-01-01

    Marbled Murrelets (Brachyramphus marmoratus) have been shown to be dependant upon old-growth forests for nesting habitat. These forests have declined over the last century as they are cut for human use. This paper reviews the current status of old-growth forests along the west coast, in both the United States and Canada.

  3. The MARBLE Project: A Collaborative Framework for Educational Courseware Design.

    ERIC Educational Resources Information Center

    Price, Sarah; McAndrew, Patrick; Rist, Roger; Mayes, Terry; Bonharme, Eric; Land, Ray; Cuttle, Mary; Haywood, Jeff; MacLeod, Hamish

    The MARBLE Project is a collaborative venture that provides on-line resource-based learning materials to students at three higher education institutions in Scotland. As per capita funding from central government decreases without a decline in graduate quality, new methods are sought in universities to cope with this challenge. This paper discusses…

  4. A Unit Cell Laboratory Experiment: Marbles, Magnets, and Stacking Arrangements

    ERIC Educational Resources Information Center

    Collins, David C.

    2011-01-01

    An undergraduate first-semester general chemistry laboratory experiment introducing face-centered, body-centered, and simple cubic unit cells is presented. Emphasis is placed on the stacking arrangement of solid spheres used to produce a particular unit cell. Marbles and spherical magnets are employed to prepare each stacking arrangement. Packing…

  5. Surveying marbled murrelets at inland forested sites: a guide

    Treesearch

    Peter W.C. Paton; C. John Ralph; Harry R. Carter; S. Kim Nelson

    1990-01-01

    The marbled murrelet (Brachyramphus marmoratus), a seabird, nests in forested stands from southeast Alaska south to Santa Cruz, California. Because of this species' close association with old-growth forests, researchers and land managers need a method to assess murrelet distribution and use patterns throughout its range. This guide describes a...

  6. A Unit Cell Laboratory Experiment: Marbles, Magnets, and Stacking Arrangements

    ERIC Educational Resources Information Center

    Collins, David C.

    2011-01-01

    An undergraduate first-semester general chemistry laboratory experiment introducing face-centered, body-centered, and simple cubic unit cells is presented. Emphasis is placed on the stacking arrangement of solid spheres used to produce a particular unit cell. Marbles and spherical magnets are employed to prepare each stacking arrangement. Packing…

  7. Chapter 25: Pollution and Fishing Threats to Marbled Murrelets

    Treesearch

    D. Michael Fry

    1995-01-01

    The principal pollutant threats to Marbled Murrelets are chlorinated organic effluent discharges from chlorine bleach pulp mills located in California, Washington, and British Columbia. The distribution of murrelets away from riverine input of agricultural chemicals reduces the threat from these pollutants. Plastic ingestion does not appear to pose a serious threat to...

  8. 10. MARBLE BRIDGE MIDSPAN OF EAST ARCH. THE PLATE READS ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    10. MARBLE BRIDGE MIDSPAN OF EAST ARCH. THE PLATE READS MORRIS RUN BRIDGE, 1908, C.F. MOYER, C.Y. STRADLINGS, S.M. FITE, COMMRR'S, S.B. TWINING CO. CONTR, W. CADWALLADER CLERK. - Morris Run Bridge, Rickert Road (TR 417) spanning Morris Run in Hilltown Township, Dublin, Bucks County, PA

  9. Measuring stone weathering in cities: Surface reduction on marble monuments

    SciTech Connect

    Dragovich, D. )

    1987-01-01

    The purpose of this study was to establish whether measurements of stone weathering recorded by different observers could be aggregated into a simple data base for evaluating pollution effects on calcareous building stone. Apparent differences in recorded weathering rates on marble tombstones were here found to be partly a result of lettering size measured, measuring devices used, and individual observers.

  10. Measuring Marbles: Demonstrating the Basic Tenets of Measurement Theory

    ERIC Educational Resources Information Center

    Wininger, Steven R.

    2007-01-01

    A hands-on activity is described in which students attempt to measure something that they cannot see. In small groups, students estimate the number of marbles in sealed boxes. Next, students' estimates are compared with the actual numbers. Last, values from both the students' estimates and actual numbers are used to explain measurement theory and…

  11. Study of marble deterioration at City Hall, Schenectady, New York

    SciTech Connect

    Cheng, R.J.; Castillo, R.

    1984-01-01

    Constructed in 1930 at a cost of over one million dollars, the City Hall in Schenectady, New York, is listed in the U.S. Register of Historical Buildings. The masonry materials were the finest available at the time of construction; granite, fire hardened exterior brick and Vermont marble - Imperical Danby, an equivalent to Carrara marble from Italy. It is known today that the lack of impurities in the Imperial Danby leads to weak crystalline properties. Cleaned with water, sponges and stiff brushes upon completion of construction, the exterior was not cleaned over a fifty-year period. The research indicated that the marble grains are being structurally weakened by a chemical conversion process of marble to gypsum crystals. The surface zone of chemical activity (2-5 mm) shows the presence of fly ash and iron particles and points to the possibility of a catalytic mechanism for the conversion of sulfur dioxide to sulfate. This research has established symptoms which are consistent with prior reported research into building material deterioration. However, the results presented are not supportive of one mechanism over another.

  12. Chapter 23: Marbled Murrelet At-Sea and Foraging Behavior

    Treesearch

    Gary Strachan; Michael McAllister; C. John Ralph

    1995-01-01

    The behavior of Marbled Murrelets (Brachyramphus marmoratus) at sea while foraging for small fish and invertebrates is poorly known. This murrelet forages by pursuit diving in relatively shallow waters, usually between 20 and 80 meters in depth. We have also observed it diving in waters less than 1 meter and more than 100 meters deep. The majority of...

  13. Transcriptomic Analysis of Endangered Chinese Salamander: Identification of Immune, Sex and Reproduction-Related Genes and Genetic Markers

    PubMed Central

    Che, Rongbo; Sun, Yuena; Wang, Rixin; Xu, Tianjun

    2014-01-01

    Background The Chinese salamander (Hynobius chinensis), an endangered amphibian species of salamander endemic to China, has attracted much attention because of its value of studying paleontology evolutionary history and decreasing population size. Despite increasing interest in the Hynobius chinensis genome, genomic resources for the species are still very limited. A comprehensive transcriptome of Hynobius chinensis, which will provide a resource for genome annotation, candidate genes identification and molecular marker development should be generated to supplement it. Principal Findings We performed a de novo assembly of Hynobius chinensis transcriptome by Illumina sequencing. A total of 148,510 nonredundant unigenes with an average length of approximately 580 bp were obtained. In all, 60,388 (40.66%) unigenes showed homologous matches in at least one database and 33,537 (22.58%) unigenes were annotated by all four databases. In total, 41,553 unigenes were categorized into 62 sub-categories by BLAST2GO search, and 19,468 transcripts were assigned to 140 KEGG pathways. A large number of unigenes involved in immune system, local adaptation, reproduction and sex determination were identified, as well as 31,982 simple sequence repeats (SSRs) and 460,923 putative single nucleotide polymorphisms (SNPs). Conclusion This dataset represents the first transcriptome analysis of the Chinese salamander (Hynobius chinensis), an endangered species, to be also the first time of hynobiidae. The transcriptome will provide valuable resource for further research in discovery of new genes, protection of population, adaptive evolution and survey of various pathways, as well as development of molecule markers in Chinese salamander; and reference information for closely related species. PMID:24498226

  14. Landscape influences on dispersal behaviour: a theoretical model and empirical test using the fire salamander, Salamandra infraimmaculata.

    PubMed

    Kershenbaum, Arik; Blank, Lior; Sinai, Iftach; Merilä, Juha; Blaustein, Leon; Templeton, Alan R

    2014-06-01

    When populations reside within a heterogeneous landscape, isolation by distance may not be a good predictor of genetic divergence if dispersal behaviour and therefore gene flow depend on landscape features. Commonly used approaches linking landscape features to gene flow include the least cost path (LCP), random walk (RW), and isolation by resistance (IBR) models. However, none of these models is likely to be the most appropriate for all species and in all environments. We compared the performance of LCP, RW and IBR models of dispersal with the aid of simulations conducted on artificially generated landscapes. We also applied each model to empirical data on the landscape genetics of the endangered fire salamander, Salamandra infraimmaculata, in northern Israel, where conservation planning requires an understanding of the dispersal corridors. Our simulations demonstrate that wide dispersal corridors of the low-cost environment facilitate dispersal in the IBR model, but inhibit dispersal in the RW model. In our empirical study, IBR explained the genetic divergence better than the LCP and RW models (partial Mantel correlation 0.413 for IBR, compared to 0.212 for LCP, and 0.340 for RW). Overall dispersal cost in salamanders was also well predicted by landscape feature slope steepness (76%), and elevation (24%). We conclude that fire salamander dispersal is well characterised by IBR predictions. Together with our simulation findings, these results indicate that wide dispersal corridors facilitate, rather than hinder, salamander dispersal. Comparison of genetic data to dispersal model outputs can be a useful technique in inferring dispersal behaviour from population genetic data.

  15. 77 FR 70159 - Marble River, LLC v. Noble Clinton Windpark I, LLC, Noble Ellenburg Windpark, LLC, Noble...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-11-23

    ... Energy Regulatory Commission Marble River, LLC v. Noble Clinton Windpark I, LLC, Noble Ellenburg Windpark..., Marble River, LLC (Marble River or Complainant) filed a formal complaint against Noble Clinton Windpark I... pay Marble River for headroom created by common system upgrade facilities that benefit Noble and...

  16. Maintenance of the Adh polymorphism in Ambystoma tigrinum nebulosum (tiger salamanders). I. Genotypic differences in time to metamorphosis in extreme oxygen environments.

    PubMed

    Carter, P A

    1997-01-01

    Populations of gilled tiger salamanders (Ambystoma tigrinum nebulosum) living in ephemeral ponds were studied in order to determine what evolutionary processes might be affecting genetic variation at the alcohol dehydrogenase (Adh) locus. Ponds frequently dried in late summer; salamanders that did not metamorphose and leave drying ponds died of desiccation. Low levels of water oxygen significantly slowed metamorphosis of tiger salamanders in both natural and laboratory populations. Adh- SS frequency was significantly positively correlated with daily oxygen maxima in ponds, Adh-FF frequency demonstrated a nonsignificant trend to be negatively correlated with this measure, and Adh-SF frequency was unrelated to pond oxygen. Genotype frequency changes across the season in hypoxic and supersaturated ponds suggested that differential mortality of genotypes might explain the relationships with pond oxygen, although other mechanisms cannot be ruled out. Individuals of the Adh-SS genotype metamorphosed more slowly in hypoxic water than in normoxic water in the laboratory, and Adh-FF individuals metamorphosed more slowly in supersaturated water in the field, and in hypoxic water in the laboratory, than they did in normoxic water. Adh-SF individuals metamorphosed at the same rate in all oxygen environments. These data suggest that the Adh polymorphism in tiger salamanders is being maintained by selection for Adh or for a linked locus through differential metamorphosis in extreme oxygen environments.

  17. A potential wound-healing-promoting peptide from salamander skin.

    PubMed

    Mu, Lixian; Tang, Jing; Liu, Han; Shen, Chuanbin; Rong, Mingqiang; Zhang, Zhiye; Lai, Ren

    2014-09-01

    Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

  18. Thyroid hormone responsive QTL and the evolution of paedomorphic salamanders

    PubMed Central

    Voss, S R; Kump, D K; Walker, J A; Shaffer, H B; Voss, G J

    2012-01-01

    The transformation of ancestral phenotypes into novel traits is poorly understood for many examples of evolutionary novelty. Ancestrally, salamanders have a biphasic life cycle with an aquatic larval stage, a brief and pronounced metamorphosis, followed by a terrestrial adult stage. Repeatedly during evolution, metamorphic timing has been delayed to exploit growth-permissive environments, resulting in paedomorphic salamanders that retain larval traits as adults. We used thyroid hormone (TH) to rescue metamorphic phenotypes in paedomorphic salamanders and then identified quantitative trait loci (QTL) for life history traits that are associated with amphibian life cycle evolution: metamorphic timing and adult body size. We demonstrate that paedomorphic tiger salamanders (Ambystoma tigrinum complex) carry alleles at three moderate effect QTL (met1–3) that vary in responsiveness to TH and additively affect metamorphic timing. Salamanders that delay metamorphosis attain significantly larger body sizes as adults and met2 explains a significant portion of this variation. Thus, substitution of alleles at TH-responsive loci suggests an adaptive pleiotropic basis for two key life-history traits in amphibians: body size and metamorphic timing. Our study demonstrates a likely pathway for the evolution of novel paedomorphic species from metamorphic ancestors via selection of TH-response alleles that delay metamorphic timing and increase adult body size. PMID:22850698

  19. Variation in salamanders: an essay on genomes, development, and evolution.

    PubMed

    Brockes, Jeremy P

    2015-01-01

    Regeneration is studied in a few model species of salamanders, but the ten families of salamanders show considerable variation, and this has implications for our understanding of salamander biology. The most recent classification of the families identifies the cryptobranchoidea as the basal group which diverged in the early Jurassic. Variation in the sizes of genomes is particularly obvious, and reflects a major contribution from transposable elements which is already present in the basal group.Limb development has been a focus for evodevo studies, in part because of the variable property of pre-axial dominance which distinguishes salamanders from other tetrapods. This is thought to reflect the selective pressures that operate on a free-living aquatic larva, and might also be relevant for the evolution of limb regeneration. Recent fossil evidence suggests that both pre-axial dominance and limb regeneration were present 300 million years ago in larval temnospondyl amphibians that lived in mountain lakes. A satisfying account of regeneration in salamanders may need to address all these different aspects in the future.

  20. Are Salamanders Useful Indicators of Hydrologic Permanence in Headwater Streams?

    NASA Astrophysics Data System (ADS)

    Johnson, B.; Fritz, K.

    2005-05-01

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collected in spring and summer 2003 from 59 sites located longitudinally along 17 forested streams in KY, IN, and OH. Larval Eurycea bislineata/cirrigera dominated all forests, and their abundances were highly correlated with drainage areas and channel dimensions. Appalachian streams were more diverse and had intermittent sites with more Desmognathus and Gyrinophilus spp. Of 22 sites where larvae were collected in spring, 9 sites subsequently dried in summer, suggesting salamanders either emigrated or died. We therefore only used taxa with multi-year larval stages as indicators of perennial water. Salamander larvae >1 yr old were collected from each locality in drainage areas <0.17 km2. However, these older larvae were often found in isolated pools that serve as refugia during dry periods. Findings suggest salamanders with multi-year larval periods can indicate perennial waters and that their use is more effective in Appalachia where abundance and diversity are high. Although this work was reviewed by EPA and approved for publication, it may not necessarily reflect official Agency policy.

  1. Thyroid hormone responsive QTL and the evolution of paedomorphic salamanders.

    PubMed

    Voss, S R; Kump, D K; Walker, J A; Shaffer, H B; Voss, G J

    2012-11-01

    The transformation of ancestral phenotypes into novel traits is poorly understood for many examples of evolutionary novelty. Ancestrally, salamanders have a biphasic life cycle with an aquatic larval stage, a brief and pronounced metamorphosis, followed by a terrestrial adult stage. Repeatedly during evolution, metamorphic timing has been delayed to exploit growth-permissive environments, resulting in paedomorphic salamanders that retain larval traits as adults. We used thyroid hormone (TH) to rescue metamorphic phenotypes in paedomorphic salamanders and then identified quantitative trait loci (QTL) for life history traits that are associated with amphibian life cycle evolution: metamorphic timing and adult body size. We demonstrate that paedomorphic tiger salamanders (Ambystoma tigrinum complex) carry alleles at three moderate effect QTL (met1-3) that vary in responsiveness to TH and additively affect metamorphic timing. Salamanders that delay metamorphosis attain significantly larger body sizes as adults and met2 explains a significant portion of this variation. Thus, substitution of alleles at TH-responsive loci suggests an adaptive pleiotropic basis for two key life-history traits in amphibians: body size and metamorphic timing. Our study demonstrates a likely pathway for the evolution of novel paedomorphic species from metamorphic ancestors via selection of TH-response alleles that delay metamorphic timing and increase adult body size.

  2. Invasive hybrid tiger salamander genotypes impact native amphibians.

    PubMed

    Ryan, Maureen E; Johnson, Jarrett R; Fitzpatrick, Benjamin M

    2009-07-07

    Although the ecological consequences of species invasions are well studied, the ecological impacts of genetic introgression through hybridization are less understood. This is particularly true of the impacts of hybridization on "third party" community members not genetically involved in hybridization. We also know little about how direct interactions between hybrid and parental individuals influence fitness. Here, we examined the ecological effects of hybridization between the native, threatened California Tiger Salamander (Ambystoma californiense) and the introduced Barred Tiger Salamander (Ambystoma tigrinum mavortium). Native x introduced hybrids are widespread in California, where they are top predators in seasonal ponds. We examined the impacts of early generation hybrids (first 2 generations of parental crosses) and contemporary hybrids derived from ponds where hybrids have been under selection in the wild for 20 generations. We found that most classes of hybrid tiger salamander larvae dramatically reduced survival of 2 native community members, the Pacific Chorus Frog (Pseudacris regilla) and the California Newt (Taricha torosa). We also found that native A. californiense larvae were negatively impacted by the presence of hybrid larvae: Native survival and size at metamorphosis were reduced and time to metamorphosis was extended. We also observed a large influence of Mendelian dominance on size, metamorphic timing and predation rate of hybrid tiger salamanders. These results suggest that both genetic and ecological factors are likely to influence the dynamics of admixture, and that tiger salamander hybridization might constitute a threat to additional pond-breeding species of concern in the region.

  3. Invasive hybrid tiger salamander genotypes impact native amphibians

    PubMed Central

    Ryan, Maureen E.; Johnson, Jarrett R.; Fitzpatrick, Benjamin M.

    2009-01-01

    Although the ecological consequences of species invasions are well studied, the ecological impacts of genetic introgression through hybridization are less understood. This is particularly true of the impacts of hybridization on “third party” community members not genetically involved in hybridization. We also know little about how direct interactions between hybrid and parental individuals influence fitness. Here, we examined the ecological effects of hybridization between the native, threatened California Tiger Salamander (Ambystoma californiense) and the introduced Barred Tiger Salamander (Ambystoma tigrinum mavortium). Native x introduced hybrids are widespread in California, where they are top predators in seasonal ponds. We examined the impacts of early generation hybrids (first 2 generations of parental crosses) and contemporary hybrids derived from ponds where hybrids have been under selection in the wild for 20 generations. We found that most classes of hybrid tiger salamander larvae dramatically reduced survival of 2 native community members, the Pacific Chorus Frog (Pseudacris regilla) and the California Newt (Taricha torosa). We also found that native A. californiense larvae were negatively impacted by the presence of hybrid larvae: Native survival and size at metamorphosis were reduced and time to metamorphosis was extended. We also observed a large influence of Mendelian dominance on size, metamorphic timing and predation rate of hybrid tiger salamanders. These results suggest that both genetic and ecological factors are likely to influence the dynamics of admixture, and that tiger salamander hybridization might constitute a threat to additional pond-breeding species of concern in the region. PMID:19564601

  4. Novel Hydroxyapatite Coatings for the Conservation of Marble and Limestone

    NASA Astrophysics Data System (ADS)

    Naidu, Sonia

    Marble and limestone are calcite-based materials used in the construction of various structures, many of which have significant artistic and architectural value. Unfortunately, due to calcite's high dissolution rate, these stones are susceptible to chemically-induced weathering in nature. Limestone, due to its inherent porosity, also faces other environmental weathering processes that cause weakening from disintegration at grain boundaries. The treatments presently available are all deficient in one way or another. The aim of this work is to examine the feasibility of using hydroxyapatite (HAP) as a novel protective coating for marble and limestone, with two goals: i) to reduce acid corrosion of marble and ii) to consolidate physically weathered limestone. The motivation for using HAP is its low dissolution rate and structural compatibility with calcite. Mild, wet chemical synthesis routes, in which inorganic phosphate-based solutions were reacted with marble and limestone, alone and with other precursors, were used to produce HAP films. Film nucleation, growth and phase evolution were studied on marble to understand film formation and determine the optimal synthesis route. An acid resistance test was developed to investigate the attack mechanism on marble and quantify the efficacy of HAP-based coatings. Film nucleation and growth were dependent on substrate surface roughness and increased with calcium and carbonate salt additions during synthesis. Acid attack on marble occurred via simultaneous dissolution at grain boundaries, twin boundaries and grain surfaces. HAP provided intermediate protection against acid attack, when compared to two conventional treatments. Its ability to protect the stone from acid was not as significant as predicted from dissolution kinetics and this was attributed to incomplete coverage and residual porosity within the film, arising from its flake-like crystal growth habit, which enabled acid to access the underlying substrate. The

  5. Black Marble - City Lights 2012 [hd animation

    NASA Image and Video Library

    2017-09-27

    The night side of Earth twinkles with light, and the first thing to stand out is the cities. “Nothing tells us more about the spread of humans across the Earth than city lights,” asserts Chris Elvidge, a NOAA scientist who has studied them for 20 years. This new global view and animation of Earth’s city lights is a composite assembled from data acquired by the Suomi National Polar-orbiting Partnership (Suomi NPP) satellite. The data was acquired over nine days in April 2012 and thirteen days in October 2012. It took satellite 312 orbits and 2.5 terabytes of data to get a clear shot of every parcel of Earth’s land surface and islands. This new data was then mapped over existing Blue Marble imagery of Earth to provide a realistic view of the planet. The nighttime view in visible light was made possible by the new “day-night band” of Suomi NPP’s Visible Infrared Imaging Radiometer Suite. VIIRS detects light in a range of wavelengths from green to near-infrared and uses filtering techniques to observe dim signals such as city lights, auroras, wildfires, and reflected moonlight. This low-light sensor can distinguish night lights with ten to hundreds of times better light detection capability than scientists had before. Named for satellite meteorology pioneer Verner Suomi, NPP flies over any given point on Earth&rsquos surface twice each day at roughly 1:30 a.m. and 1:30 p.m. The polar-orbiting satellite flies 824 kilometers (512 miles) above the surface as it circles the planet 14 times a day. Data is sent once per orbit to a ground station in Svalbard, Norway, and continuously to local direct broadcast users around the world. The mission is managed by NASA with operational support from NOAA and its Joint Polar Satellite System, which manages the satellite's ground system. NASA Earth Observatory image and animation by Robert Simmon, using Suomi NPP VIIRS data provided courtesy of Chris Elvidge (NOAA National Geophysical Data Center). Suomi NPP is the

  6. Morphology and Distribution of Microdiamonds in Dolomite Marble From Kokchetav UHP Massif

    NASA Astrophysics Data System (ADS)

    Imamura, K.; Yoshioka, N.; Ogasawara, Y.

    2002-12-01

    The detailed morphology of microdiamonds combined with its distribution was examined for dolomite marble from the Kokchetav massif, northern Kazakhstan. In the dolomite marble, abundant microdiamonds are included mainly in garnet and somewhat in diopside. The concentration of microdiamonds is heterogeneous and the morphologies of microdiamonds are varied. In the highest concentration domain of dolomite marble (sample no. ZW46), a single garnet grain includes several thousands of microdiamonds. We chose a sample, no. C43 as a typical one that has an average diamond concentration to investigate the relations between the distribution and the morphologies of microdiamonds. In this sample, each garnet grain includes several tens of microdiamonds. The microdiamonds in the Kokchetav UHP marble are classified into 4 major types by the morphology and other characters; S, R, RS, T-types (Ishida et al., 2003, in press; this study). S-type diamond, which is most abundant one, consists of the translucent single crystal core and the transparent polycrystalline overgrown rim. R-type diamond is the translucent crystal with rugged surface and has very thin rims on the core. RS-type diamond is a transitional type between R-type and S-type. T-type diamond is the transparent crystal with smooth surfaces and its size is smaller than the other types. In the sample no. C43, the distribution of microdiamonds is heterogeneous in garnet and diopside. The distribution maps of microdiamonds including morphological information were made by marking the location and the morphologies of microdiamonds for each host mineral. Four grains of garnets and one grain of diopside was examined by this method. These maps for garnet hosts show that microdiamonds concentrate in the mantle and/or the rim of the host whereas the core of host garnet lacks microdiamond and graphite. In the host diopside, most of microdiamonds occur in the mantle and rim and rare in the core. The deviations by domains from the

  7. Phylogeography and spatial genetic structure of the Southern torrent salamander: Implications for conservation and management

    USGS Publications Warehouse

    Miller, M.P.; Haig, S.M.; Wagner, R.S.

    2006-01-01

    The Southern torrent salamander (Rhyacotriton variegatus) was recently found not warranted for listing under the US Endangered Species Act due to lack of information regarding population fragmentation and gene flow. Found in small-order streams associated with late-successional coniferous forests of the US Pacific Northwest, threats to their persistence include disturbance related to timber harvest activities. We conducted a study of genetic diversity throughout this species' range to 1) identify major phylogenetic lineages and phylogeographic barriers and 2) elucidate regional patterns of population genetic and spatial phylogeographic structure. Cytochrome b sequence variation was examined for 189 individuals from 72 localities. We identified 3 major lineages corresponding to nonoverlapping geographic regions: a northern California clade, a central Oregon clade, and a northern Oregon clade. The Yaquina River may be a phylogeographic barrier between the northern Oregon and central Oregon clades, whereas the Smith River in northern California appears to correspond to the discontinuity between the central Oregon and northern California clades. Spatial analyses of genetic variation within regions encompassing major clades indicated that the extent of genetic structure is comparable among regions. We discuss our results in the context of conservation efforts for Southern torrent salamanders. ?? The American Genetic Association. 2006. All rights reserved.

  8. Spatial genetic structure and regional demography in the southern torrent salamander: Implications for conservation and management

    USGS Publications Warehouse

    Miller, Mark P.; Haig, Susan M.; Wagner, R.S.

    2006-01-01

    The Southern torrent salamander (Rhyacotriton variegatus) was recently found not warranted for listing under the US Endangered Species Act due to lack of information regarding population fragmentation and gene flow. Found in small-order streams associated with late-successional coniferous forests of the US Pacific Northwest, threats to their persistence include disturbance related to timber harvest activities. We conducted a study of genetic diversity throughout this species' range to 1) identify major phylogenetic lineages and phylogeographic barriers and 2) elucidate regional patterns of population genetic and spatial phylogeographic structure. Cytochrome b sequence variation was examined for 189 individuals from 72 localities. We identified 3 major lineages corresponding to nonoverlapping geographic regions: a northern California clade, a central Oregon clade, and a northern Oregon clade. The Yaquina River may be a phylogeographic barrier between the northern Oregon and central Oregon clades, whereas the Smith River in northern California appears to correspond to the discontinuity between the central Oregon and northern California clades. Spatial analyses of genetic variation within regions encompassing major clades indicated that the extent of genetic structure is comparable among regions. We discuss our results in the context of conservation efforts for Southern torrent salamanders.

  9. Coalescence patterns of endemic Tibetan species of stream salamanders (Hynobiidae: Batrachuperus).

    PubMed

    Lu, Bin; Zheng, Yuchi; Murphy, Robert W; Zeng, Xiaomao

    2012-07-01

    Orogenesis of topographically diverse montane regions often drives complex evolutionary histories of species. The extensive biodiversity of the eastern edge of the Tibetan Plateau, which gradually decreases eastwardly, facilitates a comparison of historical patterns. We use coalescence methods to compare species of stream salamanders (Batrachuperus) that occur at high and low elevations. Coalescent simulations reveal that closely related species are likely to have been influenced by different drivers of diversification. Species living in the western high-elevation region with its northsouth extending mountains appear to have experienced colonization via dispersal followed by isolation and divergence. In contrast, species on the eastern low-elevation region, which has many discontinuous mountain ranges, appear to have experienced fragmentation, sometimes staged, of wide-ranging ancestral populations. The two groups of species appear to have been affected differently by glaciation. High-elevation species, which are more resistant to cooler temperatures, appear to have experienced population declines as recently as the last glaciation (0.016-0.032Ma). In contrast, salamanders dwelling in the warmer and wetter habitats at low-elevation environs appear to have been affected less by the relatively recent, milder glaciation, and more so by harsher, extensive glaciations (0.5-0.175 Ma). Thus, elevation, topography and cold tolerance appear to drive evolutionary patterns of diversification and demography even among closely related taxa. The comparison of multiple species in genealogical analyses can lead to an understanding of the evolutionary drivers.

  10. Introduction history and habitat variation explain the landscape genetics of hybrid tiger salamanders.

    PubMed

    Fitzpatrick, Benjamin M; Shaffer, H Bradley

    2007-03-01

    Genetic introgression from introduced species into native populations is a growing challenge for biological conservation, and one that raises unique practical and ethical issues. Here, we describe the extent of introgression between native California tiger salamanders (Ambystoma californiense) and introduced barred tiger salamanders (A. tigrinum mavortium) relative to habitat, distance from introduction sites, and watershed boundaries. We used ancestry informative markers (AIMs) to characterize the degree of introgression at 85 sites within the range of A. californiense. Eight unlinked markers showed concordant patterns, indicating that different chromosomal segments are introgressing at similar rates. The current distribution of introduced alleles is largely contained in the Salinas Valley, California. Within it, the distribution of nonnative alleles was best explained at a broad geographic scale by the history of introductions, with limited introgression beyond 12 km from multiple independent release sites. The spatial transition from highly admixed to nearly pure native populations was abrupt, suggesting either cryptic barriers to dispersal or locally rapid displacement of natives by an advancing hybrid swarm. At a more ecological level, highly modified perennial breeding ponds had higher introduced allele frequencies than more natural seasonal ponds, suggesting greater invasion success in perennial breeding ponds. Management favoring natural habitat characteristics may substantially decrease the rate of spread of introduced alleles.

  11. Larval growth in polyphenic salamanders: making the best of a bad lot.

    PubMed

    Whiteman, H H; Wissinger, S A; Denoël, M; Mecklin, C J; Gerlanc, N M; Gutrich, J J

    2012-01-01

    Polyphenisms are excellent models for studying phenotypic variation, yet few studies have focused on natural populations. Facultative paedomorphosis is a polyphenism in which salamanders either metamorphose or retain their larval morphology and eventually become paedomorphic. Paedomorphosis can result from selection for capitalizing on favorable aquatic habitats (paedomorph advantage), but could also be a default strategy under poor aquatic conditions (best of a bad lot). We tested these alternatives by quantifying how the developmental environment influences the ontogeny of wild Arizona tiger salamanders (Ambystoma tigrinum nebulosum). Most paedomorphs in our study population arose from slow-growing larvae that developed under high density and size-structured conditions (best of a bad lot), although a few faster-growing larvae also became paedomorphic (paedomorph advantage). Males were more likely to become paedomorphs than females and did so under a greater range of body sizes than females, signifying a critical role for gender in this polyphenism. Our results emphasize that the same phenotype can be adaptive under different environmental and genetic contexts and that studies of phenotypic variation should consider multiple mechanisms of morph production.

  12. Phenotypic variation in metamorphosis and paedomorphosis in the salamander Ambystoma talpoideum

    SciTech Connect

    Semlitsch, R.D.; Gibbons, J.W.

    1985-08-01

    Phenotypic variation in metamorphosis and paedomorphosis in the salamander Ambystoma talpoideum was examined to determine its environmental or genetic basis. Eight artificial ponds were maintained, four at each of two environmental treatments: constant water level, to simulate fish-free permanent breeding ponds, and gradual drying out, to simulate temporary breeding ponds. Two populations of salamanders were used, derived from two breeding ponds having different frequencies of paedomorphosis. The water level in the drying treatment was lowered during the last 10 wk of the experimental period with no apparent differences in water chemistry parameters between treatments and only a slight change in water temperature during the last 2 wk. The effects of water level were potentially confounded by those of water temperature, density of larvae, and amount food. Population differences in the frequency of metamorphosis and paedomorphosis could potentially represent genetic differences resulting from the different selective regimes that individuals encounter in breeding ponds varying in drying frequency. 35 references, 3 figures, 4 tables.

  13. Reduced genetic variation in the Japanese giant salamander, Andrias japonicus (Amphibia: Caudata).

    PubMed

    Matsui, Masafumi; Tominaga, Atsushi; Liu, Wan-zhao; Tanaka-Ueno, Tomoko

    2008-10-01

    The phylogenetic relationships among 46 samples from 27 populations of the Japanese giant salamander, Andriasjaponicus and its congener, A. davidianus from China was investigated, using 3664 bp sequences of the mitochondrial genes NADH1, NADH3, cyt b and CR, partial NADH6 and intervening genes. In phylogenetic trees constructed by MP, ML, and Bayesian methods, the family Cryptobranchidae and the genus Andrias both form monophyletic groups. Japanese A. japonicus and Chinese A. davidianus are sister taxa and can be regarded as separate species despite a small degree of genetic differentiation. Andriasjaponicus is divided into central and western clades, but the phylogenetic relationships within the latter clade are unresolved. As previously reported from allozyme analyses, A. japonicus exhibits little genetic differentiation, in strong contrast to salamanders of the genus Hynobius with which their distributions overlap. This reduced genetic variability in A. japonicus is attributable to a unique mating system of polygyny, delayed sexual maturity, notable longevity, life in a stable aquatic environment, and gigantism, as well as bottleneck effects following habitat fragmentation and extinction of local populations during Quaternary glaciations. The species is thus susceptible to extinction by potential environmental fluctuations, and requires extensive conservation measures.

  14. Non-additive response of larval ringed salamanders to intraspecific density.

    PubMed

    Ousterhout, Brittany H; Semlitsch, Raymond D

    2016-04-01

    Conditions experienced in early developmental stages can have long-term consequences for individual fitness. High intraspecific density during the natal period can affect juvenile and eventually adult growth rates, metabolism, immune function, survival, and fecundity. Despite the important ecological and evolutionary effects of early developmental density, the form of the relationship between natal density and resulting juvenile phenotype is poorly understood. To test competing hypotheses explaining responses to intraspecific density, we experimentally manipulated the initial larval density of ringed salamanders (Ambystoma annulatum), a pond-breeding amphibian, over 11 densities. We modeled the functional form of the relationship between natal density and juvenile traits, and compared the relative support for the various hypotheses based on their goodness of fit. These functional form models were then used to parameterize a simple simulation model of population growth. Our data support non-additive density dependence and presents an alternate hypothesis to additive density dependence, self-thinning and Allee effects in larval amphibians. We posit that ringed salamander larvae may be under selective pressure for tolerance to high density and increased efficiency in resource utilization. Additionally, we demonstrate that models of population dynamics are sensitive to assumptions of the functional form of density dependence.

  15. Effects of mercury on behavior and performance of northern two-lined salamanders (Eurycea bislineata).

    PubMed

    Burke, John N; Bergeron, Christine M; Todd, Brian D; Hopkins, William A

    2010-12-01

    Mercury (Hg) causes a range of deleterious effects in wildlife, but little is known about its effects on amphibians. Our objective was to determine whether Hg affects performance and behavior in two-lined salamanders (Eurycea bislineata). We collected salamanders from Hg-contaminated and reference sites and assessed speed, responsiveness, and prey capture ability. Mercury concentrations were >17× higher in salamanders from the contaminated sites and were among the highest documented in amphibians. In the first, but not in the second, locomotion trial, we found a significant effect of Hg on speed and responsiveness. In the prey capture experiment, reference salamanders ate approximately twice as many prey items as the contaminated salamanders. Together, our results suggest that sublethal Hg concentrations may negatively affect salamanders by reducing their ability to successfully execute tasks critical to survival. Future work is warranted to determine whether Hg has other sublethal effects on salamanders and whether other amphibians are similarly affected.

  16. Fine-Scale Genetic Differentiation in a Salamander Hynobius tokyoensis Living in Fragmented Urban Habitats in and Around Tokyo, Japan.

    PubMed

    Sugawara, Hirotaka; Kusano, Tamotsu; Hayashi, Fumio

    2016-10-01

    Salamanders are expected to differentiate genetically among local populations due to their low dispersal ability, and are potentially susceptible to loss of genetic diversity if the population is isolated by habitat fragmentation. The salamander Hynobius tokyoensis is a lowland lentic breeder and endemic to a narrow area of central Japan. In this urban area, H. tokyoensis habitats are extensively fragmented and several populations are threatened with extinction, but information on genetic divergence and loss of genetic diversity is scarce. We performed mitochondrial (cyt b) and microsatellite (five loci) DNA analyses of 815 individuals from 46 populations in 12 regions across their entire distribution range. As a result, populations were clearly separated into northern and southern groups, and genetic differentiation among the 12 regions was also evident. Regional differentiation appears to be affected by a complex geographical history, but the genetic diversity of each population may have also been affected by recent habitat fragmentation. There were positive correlations between the mitochondrial and microsatellite DNA diversities. Some populations have lost genetic diversity in both mitochondrial and microsatellite DNAs; all such populations were at the peripheral edges of the species distribution range. Thus, even in attempts to restore genetic diversity in a small population by the transfer of outside individuals, efforts must be made to avoid genetic pollution.

  17. Salamander limb development: integrating genes, morphology, and fossils.

    PubMed

    Fröbisch, Nadia B; Shubin, Neil H

    2011-05-01

    The development of the tetrapod limb during skeletogenesis follows a highly conservative pattern characterized by a general proximo-distal progression in the establishment of skeletal elements and a postaxial polarity in digit development. Salamanders represent the only exception to this pattern and display an early establishment of distal autopodial structures, specifically the basale commune, an amalgamation of distal carpal and tarsal 1 and 2, and a distinct preaxial polarity in digit development. This deviance from the conserved tetrapod pattern has resulted in a number of hypotheses to explain its developmental basis and evolutionary history. Here we summarize the current knowledge of salamander limb development under consideration of the fossil record to provide a deep time perspective of this evolutionary pathway and highlight what data will be needed in the future to gain a better understanding of salamander limb development specifically and tetrapod limb development and evolution more broadly.

  18. Duration of immobility in salamanders, genus Plethodon (Caudata: Plethodontidae)

    USGS Publications Warehouse

    Dodd, C. Kenneth

    1989-01-01

    Immobility is a potentially important antipredator behavior in salamanders, especially for those posessing noxious skin secretions. The duration of immobility in 15 species of terrestrial salamanders (Plethodon) varied among species. Most salamanders (78.8%) became immobile when initially contacted under field conditions, and remained immobile from 1-180 s. Immobility duration was inversely correlated with substrate temperature and covaried with air temperature, but snout-vent level (SVL) had no effect on duration. Only immobility times of Plethodon shenandoah were significantly different from any other species. Substrate temperature, air temperature, SVL, and species accounted for only a small percentage of the variance (r2=0.09). The degree of disturbance received during a predator-prey encounter is probably more important than the subtle effects of temperature and SVL in determining immobility duration.

  19. Banding differences between tiger salamander and axolotl chromosomes.

    PubMed

    Cuny, R; Malacinski, G M

    1985-10-01

    The Hoechst 33258 - Giemsa banding patterns were compared on axolotl (Ambystoma mexicanum Shaw) and axolotl - tiger salamander (Ambystoma tigrinum Green) species hybrid prophase chromosomes. Approximately 369 bands per haploid chromosome set were seen in the axolotl and about 344 bands in the tiger salamander. In the haploid set of 14 chromosomes, chromosome 3 has a constant short or q-arm terminal constriction at the location of the nucleolar organizer. Chromosomes 14 Z and W carry the sex determinants, the female being the heterogametic sex (ZW). The banding patterns of chromosomes 1, 6, 11, and 14 Z of the two species are apparently indistinguishable by our banding method. In the axolotl, chromosome 9 has a small long or p-arm terminal deletion. In the tiger salamander, the remaining 10 chromosomes have terminal or internal deletions. No translocations or inversions seem to have occurred since the gene pool separation of the two closely related species.

  20. Perceived predation risk as a function of predator dietary cues in terrestrial salamanders.

    PubMed

    Murray; Jenkins

    1999-01-01

    Prey often avoid predator chemical cues, and in aquatic systems, prey may even appraise predation risk via cues associated with the predator's diet. However, this relationship has not been shown for terrestrial predator-prey systems, where the proximity of predators and prey, and the intensity of predator chemical cues in the environment, may be less than in aquatic systems. In the laboratory, we tested behavioural responses (avoidance, habituation and activity) of terrestrial red-backed salamanders, Plethodon cinereus, to chemical cues from garter snakes, Thamnophis sirtalis, fed either red-backed salamanders or earthworms (Lumbricus spp.). We placed salamanders in arenas lined with paper towels pretreated with snake chemicals, and monitored salamander movements during 120 min. Salamanders avoided substrates preconditioned by earthworm-fed (avoidanceX+/-SE=91.1+/-2.5%, N=25) and salamander-fed (95.2+/-2.5%, N=25) snakes, when tested against untreated substrate (control). Salamanders avoided cues from salamander-fed snakes more strongly (75.2+/-5.5%, N=25) than earthworm-fed snakes when subjected to both treatments simultaneously, implying that salamanders were sensitive to predator diet. Salamanders tended to avoid snake substrate more strongly during the last 60 min of a trial, but activity patterns were similar between salamanders exposed exclusively to control substrate versus those subject to snake cues. In another experiment, salamanders failed to avoid cues from dead conspecifics, suggesting that the stronger avoidance of salamander-fed snakes in the previous experiment was not directly due to chemical cues emitted by predator-killed salamanders. Salamanders also did not discriminate between cues from a salamander-fed snake versus a salamander-fed snake that was recently switched (i.e. <14 days) to an earthworm diet. Our results imply that terrestrial salamanders are sensitive to perceived predation risk via by-products of predator diet, and that snake

  1. Ontogenetic evidence for the Paleozoic ancestry of salamanders.

    PubMed

    Schoch, Rainer R; Carroll, Robert L

    2003-01-01

    The phylogenetic positions of frogs, salamanders, and caecilians have been difficult to establish. Data matrices based primarily on Paleozoic taxa support a monophyletic origin of all Lissamphibia but have resulted in widely divergent hypotheses of the nature of their common ancestor. Analysis that concentrates on the character states of the stem taxa of the extant orders, in contrast, suggests a polyphyletic origin from divergent Paleozoic clades. Comparison of patterns of larval development in Paleozoic and modern amphibians provides a means to test previous phylogenies based primarily on adult characteristics. This proves to be highly informative in the case of the origin of salamanders. Putative ancestors of salamanders are recognized from the Permo-Carboniferous boundary of Germany on the basis of ontogenetic changes observed in fossil remains of larval growth series. The entire developmental sequence from hatching to metamorphosis is revealed in an assemblage of over 600 specimens from a single locality, all belonging to the genus Apateon. Apateon forms the most speciose genus of the neotenic temnospondyl family Branchiosauridae. The sequence of ossification of individual bones and the changing configuration of the skull closely parallel those observed in the development of primitive living salamanders. These fossils provide a model of how derived features of the salamander skull may have evolved in the context of feeding specializations that appeared in early larval stages of members of the Branchiosauridae. Larvae of Apateon share many unique derived characters with salamanders of the families Hynobiidae, Salamandridae, and Ambystomatidae, which have not been recognized in any other group of Paleozoic amphibians.

  2. Ecological implications of metabolic compensation at low temperatures in salamanders

    PubMed Central

    2016-01-01

    Global warming is influencing the biology of the world’s biota. Temperature increases are occurring at a faster pace than that experienced by organisms in their evolutionary histories, limiting the organisms’ response to new conditions. Mechanistic models that include physiological traits can help predict species’ responses to warming. Changes in metabolism at high temperatures are often examined; yet many species are behaviorally shielded from high temperatures. Salamanders generally favor cold temperatures and are one of few groups of metazoans to be most species-rich in temperate regions. I examined variation in body temperature, behavioral activity, and temperature dependence of resting heart rate, used as a proxy for standard metabolic rate, in fire salamanders (Salamandra salamandra). Over 26 years, I found that salamanders are behaviorally active at temperatures as low as 1 °C, and aestivate at temperatures above 16 °C. Infrared thermography indicates limited thermoregulation opportunities for these nocturnal amphibians. Temperature affects resting heart rate, causing metabolic depression above 11 °C, and metabolic compensation below 8 °C: heart rate at 3 °C is 224% the expected heart rate. Thus, salamanders operating at low temperatures during periods of peak behavioral activity are able to maintain a higher metabolic rate than the rate expected in absence of compensation. This compensatory mechanism has important ecological implications, because it increases estimated seasonal heart rates. Increased heart rate, and thus metabolism, will require higher caloric intake for field-active salamanders. Thus, it is important to consider a species performance breadth over the entire temperature range, and particularly low temperatures that are ecologically relevant for cold tolerant species such as salamanders. PMID:27257549

  3. Historical Demography of an Endangered Salamander, Ranodon sibiricus (Amphibia, Urodela, Hynobiidae): A Reassessment.

    PubMed

    Nishikawa, Kanto; Dujsebayeva, Tatjana; Matsui, Masafumi; Yoshikawa, Natsuhiko; Tominaga, Atsushi

    2017-02-01

    Chinese populations of the endangered Siberian salamander Ranodon sibiricus are reported to have diverged only about 120 years ago, and to have the lowest genetic diversity of any amphibian. However, these conclusions require verification, as the main range of the species is in Kazakhstan. Moreover, the generation time used for estimating divergence time has a weak ground. In order to clarify these problems, we investigated the molecular phylogenetic relationship and historical demography of the species covering its whole distribution range using the mitochondrial DNA region reported for Chinese population (1072 bp sequences of the control region), while conducting skeletochronological analysis to estimate accurate generation time. As a result, the range expansion was estimated at 88,000-50,000 YA, based on the generation time of 6-10 years. Degree of intraspecific genetic differentiation is actually very small, but, as a single species, is not so small as had been reported for Chinese population alone.

  4. Nitric oxide synthase in tiger salamander retina.

    PubMed

    Kurenni, D E; Thurlow, G A; Turner, R W; Moroz, L L; Sharkey, K A; Barnes, S

    1995-10-23

    Previous studies have indicated that nitric oxide, a labile freely diffusible biological messenger synthesized by nitric oxide synthase, may modulate light transduction and signal transmission in the retina. In the present work, the large size of retinal cells in tiger salamander (Ambystoma tigrinum) allowed the utilization of nicotinamide adenine dinucleotide phosphate (NADPH)-diaphorase histochemistry and nitric oxide synthase immunocytochemistry to delineate the cell-specific intracellular localization of nitric oxide synthase. NADPH-diaphorase activity was highly concentrated in the outer retina, in rod and cone inner segment ellipsoids, and between and adjacent to the photoreceptor cell bodies in the outer nuclear layer. Examination of enzymatically isolated retinal cells indicated that outer nuclear layer NADPH-diaphorase activity was localized to the distal processes of the retinal glial (Müller) cells and to putative bipolar cell Landolt clubs. Less intense NADPH-diaphorase activity was seen in the photoreceptor inner segment myoid region, in a small number of inner nuclear layer cells, in cap-like configurations at the distal poles of cells in the ganglion cell layer and surrounding ganglion cell layer somata, and in punctate form within both plexiform layers, the pigment epithelium, and the optic nerve. Nitric oxide synthase-like immunoreactivity was similarly localized, but was also concentrated along a thin sublamina centered within the inner plexiform layer. The potential for nitric oxide generation at multiple retinal sites suggests that this molecule may play a number of roles in the processing of visual information in the retina.

  5. Modular functional organisation of the axial locomotor system in salamanders.

    PubMed

    Cabelguen, Jean-Marie; Charrier, Vanessa; Mathou, Alexia

    2014-02-01

    Most investigations on tetrapod locomotion have been concerned with limb movements. However, there is compelling evidence that the axial musculoskeletal system contributes to important functions during locomotion. Adult salamanders offer a remarkable opportunity to examine these functions because these amphibians use axial undulations to propel themselves in both aquatic and terrestrial environments. In this article, we review the currently available biological data on axial functions during various locomotor modes in salamanders. We also present data showing the modular organisation of the neural networks that generate axial synergies during locomotion. The functional implication of this modular organisation is discussed.

  6. Biochemical plasticity in the Arizona tiger salamander (Ambystoma tigrinum nebulosum).

    PubMed

    Begun, D J; Collins, J P

    1992-01-01

    The Arizona tiger salamander, Ambystoma tigrinum nebulosum, is a developmentally polymorphic species. Some individuals become sexually mature while retaining some larval traits (paedomorphs), while other individuals mature as metamorphosed salamanders. In this study, relative enzyme activities of the products of two duplicate loci in each of three enzyme systems (aconitase, malate dehydrogenase, and isocitrate dehydrogenase) were measured in paedomorphs and in paedomorphs forced to metamorphose by treatment with thyroxine. We found that thyroxine and laboratory conditions affect enzyme activities of four of the six enzymes examined and that activities of products of duplicate loci are altered to different degrees.

  7. Insights into the mating habits of the tiger salamander (Ambystoma tigrinum tigrinum) as revealed by genetic parentage analyses.

    PubMed

    Gopurenko, David; Williams, Rod N; McCormick, Cory R; DeWoody, J Andrew

    2006-06-01

    Among urodeles, ambystomatid salamanders are particularly amenable to genetic parentage analyses because they are explosive aggregate breeders that typically have large progeny arrays. Such analyses can lead to direct inferences about otherwise cryptic aspects of salamander natural history, including the rate of multiple mating, individual reproductive success, and the spatial distribution of clutches. In 2002, we collected eastern tiger salamander (Ambystoma tigrinum tigrinum) egg masses (> 1000 embryos) from a approximately 80 m linear transect in Indiana, USA. Embryos were genotyped at four variable microsatellite loci and the resulting progeny array data were used to reconstruct multilocus genotypes of the parental dams and sires for each egg mass. UPGMA analysis of genetic distances among embryos resolved four instances of egg mass admixture, where two or more females had oviposited at exactly the same site resulting in the mixing of independent cohorts. In total, 41 discrete egg masses were available for parentage analyses. Twenty-three egg masses (56%) consisted exclusively of full-siblings (i.e. were singly sired) and 18 (44%) were multiply sired (mean 2.6 males/clutch). Parentage could be genetically assigned to one of 17 distinct parent pairs involving at least 15 females and 14 different males. Reproductive skew was evident among males who sired multiply sired clutches. Additional evidence of the effects of sexual selection on male reproductive success was apparent via significant positive correlations between male mating and reproductive success. Females frequently partitioned their clutches into multiple discrete egg masses that were separated from one another by as many as 43 m. Collectively, these data provide the first direct evidence for polygynandry in a wild population of tiger salamanders.

  8. Consumer sensory acceptance and value for beef steaks of similar tenderness, but differing in marbling level.

    PubMed

    Killinger, K M; Calkins, C R; Umberger, W J; Feuz, D M; Eskridge, K M

    2004-11-01

    To determine consumer sensory acceptance and value of beef steaks differing in marbling level (high = upper USDA Choice and low = USDA Select), but similar in Warner-Bratzler shear value, consumers in Chicago and San Francisco (n = 124 per city) evaluated two matched pairs of high- and low-marbled strip steaks, and had the opportunity to participate in a silent, sealed-bid auction to purchase steaks from the same strip loins as the samples. Consumers who purchased steaks also evaluated the steaks when prepared in their homes. Based on overall acceptability ratings, consumers were categorized into three groups: 1) those who consistently found high marbling more acceptable, 2) those who consistently found low marbling more acceptable, and 3) those who were indifferent. Consumers who evaluated at least one high-marbled and one low-marbled sample in their home were included in an evaluation environment analysis (n = 50). High-marbled steaks were rated higher (P < 0.01) in juiciness, flavor, and overall acceptability than low-marbled steaks. In Chicago, consumers tended to bid more (P < 0.10) for high-marbled steaks, whereas consumers in San Francisco did not. Consumers who found high-marbled steaks more acceptable and those who found low-marbled steaks more acceptable were willing to pay more (P < 0.01) for the more acceptable product. Consumers who evaluated high- and low-marbled samples in both the laboratory and home environments rated high- and low-marbled samples similar (P > 0.10) in flavor, juiciness, tenderness and overall acceptability when evaluating the steaks in their homes. In addition, these consumers were willing to pay similar (P > 0.10) amounts for high- and low-marbled samples in both environments. Overall, consumers found high-marbled steaks to be more acceptable than low-marbled steaks in flavor and overall acceptability when tenderness differences were minimized in the laboratory environment. Consumers were willing to pay more for their preference

  9. Marble bowing: comparative studies of three different public building facades

    NASA Astrophysics Data System (ADS)

    Siegesmund, S.; Ruedrich, J.; Koch, A.

    2008-12-01

    The veneer cladding of the Oeconomicum (OEC, Göttingen), the State Theatre of Darmstadt (STD, Darmstadt) and of the State and University Library (SUB, Göttingen) is characterised by pronounced bowing after a short time of exposure. Direct comparison of bowing data related to measurements from 2000 to 2003 at the SUB clearly show that the amplitude in bowing had significantly increased. The bowing is different in intensity and orientation (concave, convex). The cladding material (Peccia marble, Rosa Estremoz marble and Carrara marble) are different in lattice preferred orientation, grain size distribution and grain interlocking. Depending on the bowing, panels may show cracks mostly initiated at the dowels. The percentage of visible cracks and breakouts increases with the amplitude of bowing except for the STD. Repetitive heating-cooling under dry conditions leads to considerable inelastic residual strain only after the first or second thermal cycle. The residual strain continuously increases again if water is present, whereby the moisture content after a thermal cycle has a certain impact on the decay rate. The water-enhanced thermal dilatation strongly correlates with the deterioration rate obtained from the laboratory bow test. Detailed petrophysical investigations provide evidence that with increasing bowing a decrease of mechanical properties (flexural strength or breaking load at dowel hole) occur. Marble degradation is also connected with the increase in porosity and a general shift of the maximum pore radii to larger pore sizes. On-site damage analyses were combined with laboratory tests of the bowing potential to constrain factors that may influence the risk failure. The experimental bowing data clearly demonstrate that after 40 heating cycles combined with the effect of moisture a certain impact on the decay rate is observed. In the case of demounted panels the bowing tests show that already strongly deformed panels from the building exhibit a lower

  10. The romanesque marble portals of Schloss Tirol/Italy

    NASA Astrophysics Data System (ADS)

    Recheis, A.; Bidner, Th.; Hauser, W.; Mirwald, P. W.

    2003-04-01

    Marble artifacts are confronted with two kinds of problems: i) weathering, which is a task for material conservation research, ii) unclear provenance which creates problems with respect to historical interpretations. An art historically very prominent example are the two romanesque marble portals of Schloß Tyrol/ South Tyrol/Italy, the Palas portal at the entrance sheltered by a canopy and the Chapel portal leading directly from the palas hall into the chapel. Stilistic criteria and historical sources date them into the 12th century (1). The performed study concerned a detailed macroscopic mapping and ultrasonic work (2) as well as petrographical and chemical investigations on some very small drill core samples. The map-ping and ultrasonic work revealed that the Palas portal is significantly more weathered and damaged than the chapel portal. At first glance this finding seems consistent with the location of the objects. However, even if a reported period of some 120 years of unsheltered free exposure of the Palas portal after its construction is taken into account, the weathering impacts are too severe (5). A fire catastrophy documented around 1300 might be considered the relevant damage event. This again sheds some light on the specific history of the well preserved Chapel portal: stylistically both portals are contemporaneous, so one may assume that it had been taken from another locality and was built in later. A potential candidate for this is a karolingian church (7-8th century) outside the castle-complex of which the relics have been excavated recently. This picture is substantiated by the results of the material investigations (grain size, chemistry and C, O isotopes (3)) suggesting different provenance of the marbles of the two portals. Comparative studies on the regional marbles speak in favour for Laas Marble for the Palas portal and Sterzing Marble for the Chapel portal (4). The study is continued with a detailed investigation on the supposed fire

  11. Black Marble - Africa, Europe, and the Middle East

    NASA Image and Video Library

    2017-09-27

    NASA image acquired April 18 - October 23, 2012 This new image of Europe, Africa, and the Middle East at night is a composite assembled from data acquired by the Suomi NPP satellite in April and October 2012. The new data was mapped over existing Blue Marble imagery of Earth to provide a realistic view of the planet. The nighttime view was made possible by the new satellite’s “day-night band” of the Visible Infrared Imaging Radiometer Suite. VIIRS detects light in a range of wavelengths from green to near-infrared and uses filtering techniques to observe dim signals such as gas flares, auroras, wildfires, city lights, and reflected moonlight. In this case, auroras, fires, and other stray light have been removed to emphasize the city lights. “Night time imagery provides an intuitively graspable view of our planet,” says William Stefanov, senior remote sensing scientist for the International Space Station program office. “They provide a fairly straightforward means to map urban versus rural areas, and to show where the major population centers are and where they are not.” Named for satellite meteorology pioneer Verner Suomi, NPP flies over any given point on Earth's surface twice each day at roughly 1:30 a.m. and p.m. The polar-orbiting satellite flies 824 kilometers (512 miles) above the surface, sending its data once per orbit to a ground station in Svalbard, Norway, and continuously to local direct broadcast users distributed around the world. The mission is managed by NASA with operational support from NOAA and its Joint Polar Satellite System, which manages the satellite's ground system. NASA Earth Observatory image by Robert Simmon, using Suomi NPP VIIRS data provided courtesy of Chris Elvidge (NOAA National Geophysical Data Center). Suomi NPP is the result of a partnership between NASA, NOAA, and the Department of Defense. Caption by Mike Carlowicz. Instrument: Suomi NPP - VIIRS Credit: NASA Earth Observatory Click here to view all of the Earth

  12. Structured decision making as a conservation tool for recovery planning of two endangered salamanders

    USGS Publications Warehouse

    O'Donnell, Katherine; Messerman, Arianne F; Barichivich, William J.; Semlitsch, Raymond D.; Gorman, Thomas A.; Mitchell, Harold G; Allan, Nathan; Fenolio, Dante B.; Green, Adam; Johnson, Fred A.; Keever, Allison; Mandica, Mark; Martin, Julien; Mott, Jana; Peacock, Terry; Reinman, Joseph; Romanach, Stephanie; Titus, Greg; McGowan, Conor; Walls, Susan

    2017-01-01

    At least one-third of all amphibian species face the threat of extinction, and current amphibian extinction rates are four orders of magnitude greater than background rates. Preventing extirpation often requires both ex situ (i.e., conservation breeding programs) and in situ strategies (i.e., protecting natural habitats). Flatwoods salamanders (Ambystoma bishopi and A. cingulatum) are protected under the U.S. Endangered Species Act. The two species have decreased from 476 historical locations to 63 recently extant locations (86.8% loss). We suggest that recovery efforts are needed to increase populations and prevent extinction, but uncertainty regarding optimal actions in both ex situ and in situ realms hinders recovery planning. We used structured decision making (SDM) to address key uncertainties regarding both captive breeding and habitat restoration, and we developed short-, medium-, and long-term goals to achieve recovery objectives. By promoting a transparent, logical approach, SDM has proven vital to recovery plan development for flatwoods salamanders. The SDM approach has clear advantages over other previous approaches to recovery efforts, and we suggest that it should be considered for other complex decisions regarding endangered species.

  13. Environmental correlates of species and genetic richness in lungless salamanders (family plethodontidae)

    NASA Astrophysics Data System (ADS)

    Marshall, Jeremy L.; Camp, Carlos D.

    2006-01-01

    Biological diversity is distributed across the planet in non-random, organised ways. At the species level, numerous environmental variables have been proposed to explain this non-random distribution with available energy and habitat heterogeneity receiving the most empirical support. With regard to genetic organisation, environmental stress and habitat heterogeneity have been widely supported. However, few studies have addressed if these two scales of biological organisation are structured via similar processes. Here, we tested whether or not the distributional organisation of genetic and species richness were driven by similar environmental variables for salamanders of the family Plethodontidae across North America. In general, we found that those environmental variables related to energy, particularly energy made accessible to salamanders via the actions of available moisture, were the primary determinants of both genetic and species richness. This finding is consistent with both the "more individuals hypothesis" of species richness and neutral-theory expectations for genetic richness. Additionally, greater habitat heterogeneity, as measured by increased topographic variance, was of secondary importance in positively influencing species richness, although its effects on genetic richness were far more variable. In total, our results suggest that both of these scales of biological organisation are influenced by similar environmental variables, even though increased genetic richness at the population-level does not always translate into greater species richness.

  14. GEOGRAPHIC DISTRIBUTION OF MITOCHONDRIAL DNA VARIANTS AND THE HISTORICAL BIOGEOGRAPHY OF THE SPOTTED SALAMANDER, AMBYSTOMA MACULATUM.

    PubMed

    Phillips, Christopher A

    1994-06-01

    I analyzed geographic partitioning of mitochondrial DNA (mtDNA) restriction-site variants in the spotted salamander, Ambystoma maculatum. Two highly divergent and geographically separate genetic lineages were identified that differed by a minimum of 19 restriction sites (6% sequence divergence). One of the lineages has a disjunct distribution with very closely related haplotypes occurring in Missouri, Arkansas, North Carolina, and Virginia. The other lineage is found in Michigan, Illinois, and Alabama. The geographic separation of highly divergent mtDNA haplotypes, a pattern that was predicted based on the sedentary nature of these salamanders, is evidence for long-term barriers to gene flow. In contrast, the large-scale disjunction of very similar haplotypes suggests recent, long-distance gene flow and does not match the phylogeographic expectation for a small terrestrial vertebrate. I explain this potential contradiction in the level of importance assigned to gene flow by a scenario in which historical barriers to gene flow account for the two divergent mtDNA assemblages, but stochastic sorting of ancestral polymorphism is responsible for the large-scale geographic disjunction. Ten of 16 populations collected in the Ozark Highlands were fixed for the same haplotype. I attribute this lack of detectable variation to recent colonization of this area, a hypothesis that is supported by paleoecological data and demonstrates the potential benefits of combining data from paleobotany, geology, and other disciplines to reconstruct the historical biogeography of a species. © 1994 The Society for the Study of Evolution.

  15. Identification of Mutant Genes and Introgressed Tiger Salamander DNA in the Laboratory Axolotl, Ambystoma mexicanum.

    PubMed

    Woodcock, M Ryan; Vaughn-Wolfe, Jennifer; Elias, Alexandra; Kump, D Kevin; Kendall, Katharina Denise; Timoshevskaya, Nataliya; Timoshevskiy, Vladimir; Perry, Dustin W; Smith, Jeramiah J; Spiewak, Jessica E; Parichy, David M; Voss, S Randal

    2017-01-31

    The molecular genetic toolkit of the Mexican axolotl, a classic model organism, has matured to the point where it is now possible to identify genes for mutant phenotypes. We used a positional cloning-candidate gene approach to identify molecular bases for two historic axolotl pigment phenotypes: white and albino. White (d/d) mutants have defects in pigment cell morphogenesis and differentiation, whereas albino (a/a) mutants lack melanin. We identified in white mutants a transcriptional defect in endothelin 3 (edn3), encoding a peptide factor that promotes pigment cell migration and differentiation in other vertebrates. Transgenic restoration of Edn3 expression rescued the homozygous white mutant phenotype. We mapped the albino locus to tyrosinase (tyr) and identified polymorphisms shared between the albino allele (tyr (a) ) and tyr alleles in a Minnesota population of tiger salamanders from which the albino trait was introgressed. tyr (a) has a 142 bp deletion and similar engineered alleles recapitulated the albino phenotype. Finally, we show that historical introgression of tyr (a) significantly altered genomic composition of the laboratory axolotl, yielding a distinct, hybrid strain of ambystomatid salamander. Our results demonstrate the feasibility of identifying genes for traits in the laboratory Mexican axolotl.

  16. Computer-Assisted Photo Identification Outperforms Visible Implant Elastomers in an Endangered Salamander, Eurycea tonkawae

    PubMed Central

    Bendik, Nathan F.; Morrison, Thomas A.; Gluesenkamp, Andrew G.; Sanders, Mark S.; O’Donnell, Lisa J.

    2013-01-01

    Despite recognition that nearly one-third of the 6300 amphibian species are threatened with extinction, our understanding of the general ecology and population status of many amphibians is relatively poor. A widely-used method for monitoring amphibians involves injecting captured individuals with unique combinations of colored visible implant elastomer (VIE). We compared VIE identification to a less-invasive method – computer-assisted photographic identification (photoID) – in endangered Jollyville Plateau salamanders (Eurycea tonkawae), a species with a known range limited to eight stream drainages in central Texas. We based photoID on the unique pigmentation patterns on the dorsal head region of 1215 individual salamanders using identification software Wild-ID. We compared the performance of photoID methods to VIEs using both ‘high-quality’ and ‘low-quality’ images, which were taken using two different camera types and technologies. For high-quality images, the photoID method had a false rejection rate of 0.76% compared to 1.90% for VIEs. Using a comparable dataset of lower-quality images, the false rejection rate was much higher (15.9%). Photo matching scores were negatively correlated with time between captures, suggesting that evolving natural marks could increase misidentification rates in longer term capture-recapture studies. Our study demonstrates the utility of large-scale capture-recapture using photo identification methods for Eurycea and other species with stable natural marks that can be reliably photographed. PMID:23555669

  17. Polymorphism of alternative splicing of major histocompatibility complex transcripts in wild tiger salamanders.

    PubMed

    Bulut, Zafer; McCormick, Cory R; Bos, David H; DeWoody, J Andrew

    2008-07-01

    Alternative splicing (AS) of mRNA transcripts is increasingly recognized as a source of transcriptome diversity. To date, most AS studies have focused either on comparisons across taxa or on intragenomic comparisons across gene families. We generated a novel data set that represents one of the first population genetic comparisons of AS across individuals. In ambystomatid salamanders, AS of the major histocompatibility complex (MHC) class IIbeta gene (Amti-DAB) produces two transcripts, one full-length and one truncated. The full-length transcript is functional, but the truncated transcript is missing the critical beta1 domain that forms half of the peptide binding region in the intact MHC class II molecule. We captured wild salamander larvae (Ambystoma tigrinum tigrinum) and genotyped them at Amti-DAB via DNA sequencing. From these same larvae, we extracted RNA from gill and spleen and evaluated the relative expression level of Amti-DAB in each tissue. Across individuals, 21% of the transcripts were truncated (alternatively spliced), and the absolute level of alternative transcript expression was higher in gill. The high level of nucleotide variation among seven Amti-DAB alleles provides the ability to detect substitutions (or linked DNA polymorphisms) that might have influenced AS. The data reveal no correlation between AS and haplotype, allele, or zygosity. However, indirect evidence (comparative expression patterns across 3 million years of evolution) suggests that the truncated Amti-DAB transcript may be functional and maintained by natural selection.

  18. Laboratory testing of sealants with a marble substrate

    SciTech Connect

    Farmer, M.C.; Cechner, R.A.

    1996-12-31

    Polyurethane and silicone sealants are widely specified for installations with porous substrates such as some stones. However, when a sealant is used against such surfaces, there is a potential for a lack of adequate adhesion, or staining of the tone by misapplication or migration of the liquid components of the sealant system, such as primers or plasticizers in the formulation. Some varieties of marble in particular have been reported to be susceptible to staining and discoloration over time from sealants. Application of new sealant over existing sealants is also of great concern for remedial applications. Determining the level of substrate preparation necessary to achieve adequate bond is critical to the success of the remedial construction project. This paper discusses the development and results of a test program conducted to determine the relative performance of sealants installed on a white marble substrate. The tests performed included wet adhesion tests, accelerated weathering studies, and staining due to plasticizer migration.

  19. Radiation Shielding Properties of Some Marbles in Turkey

    SciTech Connect

    Guenoglu, K.; Akkurt, I.

    2011-12-26

    Especially after development of technology, radiation started to be used in a large fields such as medicine, industry and energy. Using radiation in those fields bring hazardous effect of radiation into humancell. Thus radiation protection becomes important in physics. Although there are three ways for radiation protection, shielding of the radiation is the most commonly used method. Natural Stones such as marble is used as construction material especially in critical building and thus its radiation shielding capability should be determined.In this study, gamma ray shielding properties of some different types of marble mined in Turkey, have been measured using a NaI(Tl) scintillator detector. The measured results were also compared with the theoretical calculations XCOM.

  20. Calculating biologically accurate mitigation credits: insights from the California tiger salamander.

    PubMed

    Searcy, Christopher A; Shaffer, H Bradley

    2008-08-01

    Current conservation mitigation plans often fail to ensure full in-kind habitat replacement for endangered species, which suggests the need for improved methods for calculating mitigation credits. A simple, yet biologically meaningful method for calculating mitigation credits would be to let the number of mitigation credits assigned to a parcel of land scale with the reproductive value of the individuals occupying that parcel. This can be accomplished by dividing the population into 2 or more subdivisions with different reproductive values, calculating the densities of these subdivisions as a function of one or more habitat parameters, and then forming a weighted sum of these densities such that each density distribution is weighted by the reproductive value of its respective subdivision of the population. This weighted sum is the density distribution of reproductive value, and by integrating it over a particular parcel, one can determine the mitigation value of that parcel. We carried out this procedure for a population of California tiger salamanders (Ambystoma californiense), with distance from breeding site as our habitat parameter and the 3 visually identifiable age classes (adults, juveniles, and metamorphs) as our population subdivisions. This led to a density distribution of reproductive value that decreased exponentially with increasing distance from a breeding site. Mitigation strategies derived from this function will be more likely to ensure the persistence of California tiger salamander populations than current approaches, which assign all land within 1.6 km of a breeding site the same mitigation value. Use of the density distribution of reproductive value as a basis for mitigation plans is a procedure that can be applied to all endangered species, and it should improve the quality of mitigation decisions.

  1. Genetic drift and rapid evolution of viviparity in insular fire salamanders (Salamandra salamandra)

    PubMed Central

    Velo-Antón, G; Zamudio, K R; Cordero-Rivera, A

    2012-01-01

    Continental islands offer an excellent opportunity to investigate adaptive processes and to time microevolutionary changes that precede macroevolutionary events. We performed a population genetic study of the fire salamander (Salamandra salamandra), a species that displays unique intraspecific diversity of reproductive strategies, to address the microevolutionary processes leading to phenotypic and genetic differentiation of island, coastal and interior populations. We used eight microsatellite markers to estimate genetic diversity, population structure and demographic parameters in viviparous insular populations and ovoviviparous coastal and interior populations. Our results show considerable genetic differentiation (FST range: 0.06–0.27), and no clear signs of gene flow among populations, except between the large and admixed interior populations. We find no support for island colonization by rafting or intentional/accidental anthropogenic introductions, indicating that rising sea levels were responsible for isolation of the island populations approximately 9000 years ago. Our study provides evidence of rapid genetic differentiation between island and coastal populations, and rapid evolution of viviparity driven by climatic selective pressures on island populations, geographic isolation with genetic drift, or a combination of these factors. Studies of these viviparous island populations in early stages of divergence help us better understand the microevolutionary processes involved in rapid phenotypic shifts. PMID:22086081

  2. Genetic drift and rapid evolution of viviparity in insular fire salamanders (Salamandra salamandra).

    PubMed

    Velo-Antón, G; Zamudio, K R; Cordero-Rivera, A

    2012-04-01

    Continental islands offer an excellent opportunity to investigate adaptive processes and to time microevolutionary changes that precede macroevolutionary events. We performed a population genetic study of the fire salamander (Salamandra salamandra), a species that displays unique intraspecific diversity of reproductive strategies, to address the microevolutionary processes leading to phenotypic and genetic differentiation of island, coastal and interior populations. We used eight microsatellite markers to estimate genetic diversity, population structure and demographic parameters in viviparous insular populations and ovoviviparous coastal and interior populations. Our results show considerable genetic differentiation (F(ST) range: 0.06-0.27), and no clear signs of gene flow among populations, except between the large and admixed interior populations. We find no support for island colonization by rafting or intentional/accidental anthropogenic introductions, indicating that rising sea levels were responsible for isolation of the island populations approximately 9000 years ago. Our study provides evidence of rapid genetic differentiation between island and coastal populations, and rapid evolution of viviparity driven by climatic selective pressures on island populations, geographic isolation with genetic drift, or a combination of these factors. Studies of these viviparous island populations in early stages of divergence help us better understand the microevolutionary processes involved in rapid phenotypic shifts.

  3. Levitation-free vibrated droplets: resonant oscillations of liquid marbles.

    PubMed

    McHale, G; Elliott, S J; Newton, M I; Herbertson, D L; Esmer, K

    2009-01-06

    A spherical conducting droplet in an alternating electric field is known to undergo shape oscillations. When the droplet is supported by a substrate, the shape is no longer a complete sphere, but shape resonances are still observed. To obtain a completely spherical droplet, some kind of levitation is needed, unless the droplet is in microgravity, and this has previously been provided by gas films or magnetic or other external forces. In this work, we report observations of shape oscillations of a hydrophobic-powder-coated droplet of water. A droplet of water rolled on a hydrophobic powder self-coats such that the water becomes encapsulated as a liquid marble. When the powder is a spherical hydrophobic grain with a contact angle greater than 90 degrees , it adheres to the solid-water interface with more than half of its diameter projecting from the liquid, thus ensuring the encapsulated water does not come into contact with any substrate. These liquid marbles are highly mobile and can be regarded as completely nonwetting droplets possessing contact angles of 180 degrees . In this work, we show that they also provide a new mechanism equivalent to levitating droplets and provide droplets with small contact areas and completely mobile contact lines for studies of shape oscillations. Liquid marbles were created using hydrophobic lycopodium and droplets of water containing potassium chloride and were excited into motion using an electrowetting-on-dielectric configuration with applied frequency swept from 1 to 250 Hz. Both an up-and-down motion and an oscillation involving multiple nodes were observed and recorded using a high-speed camera. The resonant oscillation modes of small liquid marbles were fitted to the theory for vibrations of a free spherical volume of fluid. This work demonstrates the principle that oscillation modes of completely nonwetting droplets can be studied using a simple powder coating approach without the need for an active mechanism for levitation.

  4. Phylogeography and evolution of the Red Salamander (Pseudotriton ruber).

    PubMed

    Folt, Brian; Garrison, Nicole; Guyer, Craig; Rodriguez, Juanita; Bond, Jason E

    2016-05-01

    Phylogeographic studies frequently result in the elevation of subspecific taxa to species given monophyly, or the synonymy of subspecies that are not monophyletic. However, given limited or incongruent datasets, retention of subspecies can be useful to describe hypothesized incipient species or to illustrate interesting biological phenomena driving morphological diversity. Four subspecific taxa have been used to describe largely allopatric geographic variation within the species Pseudotriton ruber, a plethodontid salamander occupying stream and spring habitats across eastern North America: P. r. vioscai occurs in lowland Coastal Plain habitats, while P. r. ruber, P. r. nitidus, and P. r. schencki occupy upland regions in and around the Appalachian Mountains. Pseudotriton ruber co-occurs through its distribution with the aposematic newt Notophthalmus viridescens, and both species are hypothesized to be part of a Müllerian mimicry complex. In this study, we sequenced regions of two mitochondrial (cytochrome b, NADH dehydrogenase subunit 2) and one single copy nuclear protein-coding gene (pro-opiomelanocortin) from individuals sampled across much of the distribution of P. ruber and then used maximum-likelihood and Bayesian phylogenetic inference to test the monophyly of subspecies, reconstruct biogeographic history, and make inferences about morphological evolution. Phylogeographic hypotheses from mitochondrial and nuclear datasets described structure among populations of P. ruber which separated Coastal Plain and upland Appalachian populations, but subspecies were not monophyletic. Biogeographic reconstruction estimated the ancestor of all populations to have occupied and initially diverged in the Coastal Plain during the Pliocene (∼3.6mya), before one lineage subsequently invaded upland areas of Appalachia. Bold bright coloration of high elevation subspecies P. r. nitidus and P. r. schencki appears to have evolved twice. We hypothesize that the Müllerian mimicry

  5. On trajectories of rolling marbles in cones and other funnels

    NASA Astrophysics Data System (ADS)

    White, Gary D.

    2013-12-01

    We report on theoretical and experimental results for a ball that rolls without slipping on a surface of revolution, whose symmetry axis is aligned with a uniform gravitational field, particularly investigating both near-circular orbits and scattering-type orbits in cones. The experimental data give support for the theoretical treatment, a non-trivial application of Newton's second law that expands on our previous work and related work of others. Our findings refine those from a recent article in this journal, and largely replicate those obtained from an earlier Lagrangian approach, adding some new details and commentary. While the orbits of marbles rolling in cones do not match inverse-square-law orbits quantitatively (e.g., instead of Kepler's 3rd law, we have T2∝R), we argue that students should experience these qualitative phenomena—precession of orbits, escape velocity behavior, spin-orbit coupling, conservation laws for angular momentum, energy, and spin projection—as much for the fun and kinesthetic impressions as for the raw learning. We also report on a heretofore largely ignored variable in the exploration of rolling orbits in a gravity well: the marble's spin about its own axis as it rolls. Experimenters can, intentionally or not, vary this initial condition and produce different orbital periods for a given orbital radius—a distinctly non-celestial behavior. Careful selection of the initial spin direction and speed for a particular cone can result in marble orbits that mimic the planetary ellipses.

  6. MARBLE: A system for executing expert systems in parallel

    NASA Technical Reports Server (NTRS)

    Myers, Leonard; Johnson, Coe; Johnson, Dean

    1990-01-01

    This paper details the MARBLE 2.0 system which provides a parallel environment for cooperating expert systems. The work has been done in conjunction with the development of an intelligent computer-aided design system, ICADS, by the CAD Research Unit of the Design Institute at California Polytechnic State University. MARBLE (Multiple Accessed Rete Blackboard Linked Experts) is a system of C Language Production Systems (CLIPS) expert system tool. A copied blackboard is used for communication between the shells to establish an architecture which supports cooperating expert systems that execute in parallel. The design of MARBLE is simple, but it provides support for a rich variety of configurations, while making it relatively easy to demonstrate the correctness of its parallel execution features. In its most elementary configuration, individual CLIPS expert systems execute on their own processors and communicate with each other through a modified blackboard. Control of the system as a whole, and specifically of writing to the blackboard is provided by one of the CLIPS expert systems, an expert control system.

  7. Weathering rates of marble in laboratory and outdoor conditions

    SciTech Connect

    Yerrapragada, S.S.; Chirra, S.R.; Jaynes, J.H.; Bandyopadhyay, J.K.; Gauri, K.L.; Li, S.

    1996-09-01

    In the modern urban atmosphere SO{sub 2} and NO{sub 2} attack calcite (CaCO{sub 3}) in marble exposed at rain-sheltered surfaces creating largely gypsum (CaSO{sub 4}{center_dot}2H{sub 2}O) crusts that eventually exfoliate. In combination with CO{sub 2} these gases erode the marble at unsheltered surfaces. the authors report the development of mathematical models to predict the rate of growth of crust and the rate of surface recession. To determine the rate of growth of crust the kinetic rate constant, diffusion rate, and the order of reaction were determined by the application of the shrinking-core model applied to data generated in laboratory experiments. Based on these parameters /and average ambient levels of 10 parts per billion (ppb) SO{sub 2} and 25 ppb NO{sub 2} in Louisville, Ky., the rate of crust formation for this metro area was calculated to be 1.8 {micro}m in the first year. However, the rate of recession was modeled from data obtained by exposing marble slabs to rainfalls. A surface recession of 15 {micro}m/yr was calculated. The models predicted well the rate of growth of crust observed at several sites in Louisville and the predicted surface recession compared well with values reported in the literature.

  8. Development of gypsum alteration on marble and limestone

    USGS Publications Warehouse

    McGee, E.S.

    1996-01-01

    Blackened alteration crusts of gypsum plus particulates that form on sheltered areas on marble and limestone buildings pose a challenge for rehabilitation and cleaning. Fresh marble and limestone samples exposed at monitored exposure sites present conditions of simple geometry and well-documented exposures but have short exposure histories (one to five years). The gypsum alteration crusts that develop on these samples provide insight into the early stages and rate of alteration crust formation. Alteration crusts from buildings give a longer, but less well known exposure history and present much more complex surfaces for gypsum accumulation. Integrated observations and measurements of alteration crusts from exposure samples and from buildings identify four factors that are important in the formation and development of alteration crusts on marble and limestone: (1) pollution levels, (2) exposure to rain or washing, (3) geometry of exposure of the stone surface, and (4) permeability of the stone. The combination of these factors contributes to both the distribution and the physical characteristics of the gypsum crusts which may affect cleaning decisions.

  9. Acid precipitation and reproductive success of Ambystoma salamanders

    Treesearch

    F. Harvey Pough; Richard E. Wilson

    1976-01-01

    The two species of mole salamander that occur in the Ithaca, New York, region (Ambystoma maculatum and A. jeffersonianum) breed in temporary ponds that are formed by accumulation of melted snow and spring rains. Water in many of these pools during the breeding season is acid; pH values as low as 3.5 have been measured. In...

  10. Digit reduction, body size, and paedomorphosis in salamanders.

    PubMed

    Wiens, John J; Hoverman, Jason T

    2008-01-01

    The loss of digits is a widespread evolutionary trend in tetrapods which occurs in nearly every major clade. Alberch and Gale showed that the order in which digits are evolutionarily lost in salamanders versus frogs corresponds to the order in which they develop in each group, providing a classic example of developmental constraint. However, what actually drives the loss of digits in salamanders has remained unclear. Alberch and Gale suggested that loss of digits might be associated with paedomorphosis or with reduced body size. We test these hypotheses by combining morphometric and phylogenetic information for 98 species of salamanders. We find that digit loss is associated with both paedomorphosis and reduction in body size. However, these trends are surprisingly contradictory, in that paedomorphosis is significantly associated with an increase in body size in salamanders. Thus, much of the extreme digit reduction is found in the smaller species within paedomorphic clades that have, on average, unusually large body size. Our results show that the consequences of changes in body size on morphology are highly context dependent. We also show (possibly for the first time) a significant association between paedomorphosis and increased body size, rather than the expected association with reduced body size.

  11. Reproductive biology of the Del Norte salamander (Plethodon elongatus).

    Treesearch

    Clara A. Wheeler; Hartwell H. Welsh Jr.; Lisa M. Ollivier

    2013-01-01

    We examined seasonal reproductive patterns of the Del Norte Salamander, Plethodon elongatus, in mixed conifer and hardwood forests of northwestern California and southwestern Oregon. Seasonal size differences in reproductive structures suggested that maximum spermatogenic activity occurred during the late summer, with spermatozoa transfer to the...

  12. Life-history perspective of adaptive radiation in desmognathine salamanders

    Treesearch

    Richard C. Bruce

    1996-01-01

    This study investigates interspecific variation in age at first reproduction, fecundity, and body size in multispecies assemblages of desmognathine salamanders. The hypotheses tested are that interspecific differences in body size among desmognathines stem proximately from variation in age at first reproduction and that variation in the latter trait is positively...

  13. Overview of the status of the Cheat Mountain salamander

    Treesearch

    Thomas K. Pauley

    2010-01-01

    Plethodon nettingi, the Cheat Mountain salamander, is endemic to the high elevations of the Allegheny Mountains in eastern West Virginia. In 1938, N.B. Green named the species from specimens collected at Barton Knob, Randolph County, in honor of his friend and colleague Graham Netting.

  14. Reproductive allometry in three species of Dusky Salamanders

    Treesearch

    Richard C. Bruce

    2014-01-01

    Desmognathus comprises 21 currently recognized species of salamanders in eastern North America. Assemblages of 3–6 species occur in the Appalachian Mountains, wherein the larger species are more aquatic and the smaller more terrestrial. Adaptive divergence along the habitat gradient from stream to forest involves variation in such life-history traits as age and size at...

  15. Elevation, aspect, and cove size effects on southern Appalachian salamanders

    Treesearch

    W. Mark Ford; Michael A. Menzel; Richard H. Odom

    2002-01-01

    Using museum collection records and variables computed by digital terrain modeling in a geographic information system, we examined the relationship of elevation, aspect, and "cove" patch size to the presence or absence of 7 common woodland salamanders in mature cove hardwood and northern hardwood forests in the southern Appalachians of Georgia, North Carolina...

  16. Light-Driven Transport of a Liquid Marble with and against Surface Flows.

    PubMed

    Kavokine, Nikita; Anyfantakis, Manos; Morel, Mathieu; Rudiuk, Sergii; Bickel, Thomas; Baigl, Damien

    2016-09-05

    Liquid marbles, that is, liquid drops coated by a hydrophobic powder, do not wet any solid or liquid substrate, making their transport and manipulation both highly desirable and challenging. Herein, we describe the light-driven transport of floating liquid marbles and emphasize a surprising motion behavior. Liquid marbles are deposited on a water solution containing photosensitive surfactants. Irradiation of the solution generates photoreversible Marangoni flows that transport the liquid marbles toward UV light and away from blue light when the thickness of the liquid substrate is large enough (Marangoni regime). Below a critical thickness, the liquid marbles move in the opposite direction to that of the surface flow at a speed increasing with decreasing liquid thickness (anti-Marangoni). We demonstrate that the anti-Marangoni motion is driven by the free surface deformation, which propels the non-wetting marble against the surface flow. We call this behavior "slide effect".

  17. Analysis of climatic factors influencing migrations of the salamander Ambystoma talpoideum

    SciTech Connect

    Semlitsch, R.D.

    1985-01-01

    Migrations of breeding adult and metamorphosing juvenile mole salamanders, Ambystoma talpoideum, were studied in five populations in South Carolina from September 1978 through July 1982. Onset of breeding immigrations occurred as early as September but migrations ''en masse'' did not occur until November, December, or January. Time of peak migration varied annually depending upon meteorological conditions. Total number of breeding adults or breeding population size, was significantly correlated with cumulative rainfall during the time of immigration. Sex ratio of immigrating adults was significantly biased towards males at the beginning of the breeding season whereas by the end of the season it was biased towards females. During the very dry year of 1980 - 1981 water levels in two relatively permanent breeding sites were substantially metamorphosis and emigration of sexually mature gilled morphs. Statistical models which predict the magnitude of migrations indicated that rainfall, water level, and minimum air temperature were consistently important environmental variables.

  18. Seasonality and microhabitat selection in a forest-dwelling salamander.

    PubMed

    Basile, Marco; Romano, Antonio; Costa, Andrea; Posillico, Mario; Scinti Roger, Daniele; Crisci, Aldo; Raimondi, Ranieri; Altea, Tiziana; Garfì, Vittorio; Santopuoli, Giovanni; Marchetti, Marco; Salvidio, Sebastiano; De Cinti, Bruno; Matteucci, Giorgio

    2017-09-12

    Many small terrestrial vertebrates exhibit limited spatial movement and are considerably exposed to changes in local environmental variables. Among such vertebrates, amphibians at present experience a dramatic decline due to their limited resilience to environmental change. Since the local survival and abundance of amphibians is intrinsically related to the availability of shelters, conservation plans need to take microhabitat requirements into account. In order to gain insight into the terrestrial ecology of the spectacled salamander Salamandrina perspicillata and to identify appropriate forest management strategies, we investigated the salamander's seasonal variability in habitat use of trees as shelters in relation to tree features (size, buttresses, basal holes) and environmental variables in a beech forest in Italy. We used the occupancy approach to assess tree suitability on a non-conventional spatial scale. Our approach provides fine-grained parameters of microhabitat suitability and elucidates many aspects of the salamander's terrestrial ecology. Occupancy changed with the annual life cycle and was higher in autumn than in spring, when females were found closer to the stream in the study area. Salamanders showed a seasonal pattern regarding the trees they occupied and a clear preference for trees with a larger diameter and more burrows. With respect to forest management, we suggest maintaining a suitable number of trees with a trunk diameter exceeding 30 cm. A practice of selective logging along the banks of streams could help maintain an adequate quantity of the appropriate microhabitat. Furthermore, in areas with a presence of salamanders, a good forest management plan requires leaving an adequate buffer zone around streams, which should be wider in autumn than in spring.

  19. Slow DNA loss in the gigantic genomes of salamanders.

    PubMed

    Sun, Cheng; López Arriaza, José R; Mueller, Rachel Lockridge

    2012-01-01

    Evolutionary changes in genome size result from the combined effects of mutation, natural selection, and genetic drift. Insertion and deletion mutations (indels) directly impact genome size by adding or removing sequences. Most species lose more DNA through small indels (i.e., ~1-30 bp) than they gain, which can result in genome reduction over time. Because this rate of DNA loss varies across species, small indel dynamics have been suggested to contribute to genome size evolution. Species with extremely large genomes provide interesting test cases for exploring the link between small indels and genome size; however, most large genomes remain relatively unexplored. Here, we examine rates of DNA loss in the tetrapods with the largest genomes-the salamanders. We used low-coverage genomic shotgun sequence data from four salamander species to examine patterns of insertion, deletion, and substitution in neutrally evolving non-long terminal repeat (LTR) retrotransposon sequences. For comparison, we estimated genome-wide DNA loss rates in non-LTR retrotransposon sequences from five other vertebrate genomes: Anolis carolinensis, Danio rerio, Gallus gallus, Homo sapiens, and Xenopus tropicalis. Our results show that salamanders have significantly lower rates of DNA loss than do other vertebrates. More specifically, salamanders experience lower numbers of deletions relative to insertions, and both deletions and insertions are skewed toward smaller sizes. On the basis of these patterns, we conclude that slow DNA loss contributes to genomic gigantism in salamanders. We also identify candidate molecular mechanisms underlying these differences and suggest that natural variation in indel dynamics provides a unique opportunity to study the basis of genome stability.

  20. Seasonality and microhabitat selection in a forest-dwelling salamander

    NASA Astrophysics Data System (ADS)

    Basile, Marco; Romano, Antonio; Costa, Andrea; Posillico, Mario; Scinti Roger, Daniele; Crisci, Aldo; Raimondi, Ranieri; Altea, Tiziana; Garfì, Vittorio; Santopuoli, Giovanni; Marchetti, Marco; Salvidio, Sebastiano; De Cinti, Bruno; Matteucci, Giorgio

    2017-10-01

    Many small terrestrial vertebrates exhibit limited spatial movement and are considerably exposed to changes in local environmental variables. Among such vertebrates, amphibians at present experience a dramatic decline due to their limited resilience to environmental change. Since the local survival and abundance of amphibians is intrinsically related to the availability of shelters, conservation plans need to take microhabitat requirements into account. In order to gain insight into the terrestrial ecology of the spectacled salamander Salamandrina perspicillata and to identify appropriate forest management strategies, we investigated the salamander's seasonal variability in habitat use of trees as shelters in relation to tree features (size, buttresses, basal holes) and environmental variables in a beech forest in Italy. We used the occupancy approach to assess tree suitability on a non-conventional spatial scale. Our approach provides fine-grained parameters of microhabitat suitability and elucidates many aspects of the salamander's terrestrial ecology . Occupancy changed with the annual life cycle and was higher in autumn than in spring, when females were found closer to the stream in the study area. Salamanders showed a seasonal pattern regarding the trees they occupied and a clear preference for trees with a larger diameter and more burrows. With respect to forest management, we suggest maintaining a suitable number of trees with a trunk diameter exceeding 30 cm. A practice of selective logging along the banks of streams could help maintain an adequate quantity of the appropriate microhabitat. Furthermore, in areas with a presence of salamanders, a good forest management plan requires leaving an adequate buffer zone around streams, which should be wider in autumn than in spring.

  1. Marble-hosted ruby deposits of the Morogoro Region, Tanzania

    NASA Astrophysics Data System (ADS)

    Balmer, Walter A.; Hauzenberger, Christoph A.; Fritz, Harald; Sutthirat, Chakkaphan

    2017-10-01

    The ruby deposits of the Uluguru and Mahenge Mts, Morogoro Region, are related to marbles which represent the cover sequence of the Eastern Granulites in Tanzania. In both localities the cover sequences define a tectonic unit which is present as a nappe structure thrusted onto the gneissic basement in a north-western direction. Based on structural geological observations the ruby deposits are bound to mica-rich boudins in fold hinges where fluids interacted with the marble-host rock in zones of higher permeability. Petrographic observations revealed that the Uluguru Mts deposits occur within calcite-dominated marbles whereas deposits in the Mahenge Mts are found in dolomite-dominated marbles. The mineral assemblage describing the marble-hosted ruby deposit in the Uluguru Mts is characterised by corundum-dolomite-phlogopite ± spinel, calcite, pargasite, scapolite, plagioclase, margarite, chlorite, tourmaline whereas the assemblage corundum-calcite-plagioclase-phlogopite ± dolomite, pargasite, sapphirine, titanite, tourmaline is present in samples from the Mahenge Mts. Although slightly different in mineral assemblage it was possible to draw a similar ruby formation history for both localities. Two ruby forming events were distinguished by textural differences, which could also be modeled by thermodynamic T-XCO2 calculations using non-ideal mixing models of essential minerals. A first formation of ruby appears to have taken place during the prograde path (M1) either by the breakdown of diaspore which was present in the original sedimentary precursor rock or by the breakdown of margarite to corundum and plagioclase. The conditions for M1 metamorphism was estimated at ∼750 °C at 10 kbar, which represents granulite facies conditions. A change in fluid composition towards a CO2 dominated fluid triggered a second ruby generation to form. Subsequently, the examined units underwent a late greenschist facies overprint. In the framework of the East African Orogen we

  2. Magnetic Anisotropy in Carbonate Rocks: Revisiting the Carrara Marble

    NASA Astrophysics Data System (ADS)

    Schmidt, V.; Hirt, A. M.; Leiss, B.; Piguet, P.; Burlini, L.

    2003-12-01

    Magnetic anisotropy has been used in numerous investigations since the 1950's as an indicator of petrofabric. In deformed rocks the anisotropy of magnetic susceptibility (AMS) has been shown to qualitatively, and sometimes quantitatively reflect finite strain. In low-field AMS all minerals contribute to the measured anisotropy. Over the past years several methods have been used to isolate different components to the AMS. Various high-field methods are used to separate the paramagnetic, diamagnetic and high coercivity antiferromagnetic components from the ferrimagnetic component. In spite of these advances, our understanding of the factors controlling the total AMS signal in a rock remains limited, which has hampered the quantitative use of magnetic fabrics in deformation studies. This is partly due to the limited data available on the intrinsic anisotropy of single mineral crystals. Calcite is one mineral whose AMS is well-determined. Earlier studies have shown that the magnetic fabric in deformed pure marble can be related to the crystallographic orientation of the calcite crystals (Owens and Rutter, 1978, PEPI, 16 2115; deWall et al., 2000, J. Struct. Geol., 22, 1761). De Wall et al (2000) were able to model quantitatively the AMS from the mineral fabric and AMS of calcite for coarse-grained marbles, but were less successful for fine-grained ones. In this study we have used low-field AMS and high-field torque magnetometry to isolate the diamagnetic signal of Carrara marbles. The magnetic fabric has been compared with the calcite fabric in the rocks. Preliminary results will be presented of synthetic calcite aggregates prepared from Carrara marble powder, which was initially uniaxially cold pressed at different amount of load, in order to induce a c-axis maximum type of fabric of various strength, and compare it with the magnetic anisotropy. This was later Hot Isostatic Pressed at about 150 MPa and 700° C to reduce porosity and increase/homogenize the grain

  3. Reinforcement of natural rubber hybrid composites based on marble sludge/Silica and marble sludge/rice husk derived silica

    PubMed Central

    Ahmed, Khalil; Nizami, Shaikh Sirajuddin; Riza, Nudrat Zahid

    2013-01-01

    A research has been carried out to develop natural rubber (NR) hybrid composites reinforced with marble sludge (MS)/Silica and MS/rice husk derived silica (RHS). The primary aim of this development is to scrutinize the cure characteristics, mechanical and swelling properties of such hybrid composite. The use of both industrial and agricultural waste such as marble sludge and rice husk derived silica has the primary advantage of being eco-friendly, low cost and easily available as compared to other expensive fillers. The results from this study showed that the performance of NR hybrid composites with MS/Silica and MS/RHS as fillers is extremely better in mechanical and swelling properties as compared with the case where MS used as single filler. The study suggests that the use of recently developed silica and marble sludge as industrial and agricultural waste is accomplished to provide a probable cost effective, industrially prospective, and attractive replacement to the in general purpose used fillers like china clay, calcium carbonate, and talc. PMID:25685484

  4. Reinforcement of natural rubber hybrid composites based on marble sludge/Silica and marble sludge/rice husk derived silica.

    PubMed

    Ahmed, Khalil; Nizami, Shaikh Sirajuddin; Riza, Nudrat Zahid

    2014-03-01

    A research has been carried out to develop natural rubber (NR) hybrid composites reinforced with marble sludge (MS)/Silica and MS/rice husk derived silica (RHS). The primary aim of this development is to scrutinize the cure characteristics, mechanical and swelling properties of such hybrid composite. The use of both industrial and agricultural waste such as marble sludge and rice husk derived silica has the primary advantage of being eco-friendly, low cost and easily available as compared to other expensive fillers. The results from this study showed that the performance of NR hybrid composites with MS/Silica and MS/RHS as fillers is extremely better in mechanical and swelling properties as compared with the case where MS used as single filler. The study suggests that the use of recently developed silica and marble sludge as industrial and agricultural waste is accomplished to provide a probable cost effective, industrially prospective, and attractive replacement to the in general purpose used fillers like china clay, calcium carbonate, and talc.

  5. Measuring the Coefficient of Friction of a Small Floating Liquid Marble

    NASA Astrophysics Data System (ADS)

    Ooi, Chin Hong; Nguyen, Anh Van; Evans, Geoffrey M.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-12-01

    This paper investigates the friction coefficient of a moving liquid marble, a small liquid droplet coated with hydrophobic powder and floating on another liquid surface. A floating marble can easily move across water surface due to the low friction, allowing for the transport of aqueous solutions with minimal energy input. However, the motion of a floating marble has yet to be systematically characterised due to the lack of insight into key parameters such as the coefficient of friction between the floating marble and the carrier liquid. We measured the coefficient of friction of a small floating marble using a novel experimental setup that exploits the non-wetting properties of a liquid marble. A floating liquid marble pair containing a minute amount magnetite particles were immobilised and then released in a controlled manner using permanent magnets. The capillarity-driven motion was analysed to determine the coefficient of friction of the liquid marbles. The “capillary charge” model was used to fit the experimental results. We varied the marble content and carrier liquid to establish a relationship between the friction correction factor and the meniscus angle.

  6. Measuring the Coefficient of Friction of a Small Floating Liquid Marble

    PubMed Central

    Ooi, Chin Hong; Nguyen, Anh Van; Evans, Geoffrey M.; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-01-01

    This paper investigates the friction coefficient of a moving liquid marble, a small liquid droplet coated with hydrophobic powder and floating on another liquid surface. A floating marble can easily move across water surface due to the low friction, allowing for the transport of aqueous solutions with minimal energy input. However, the motion of a floating marble has yet to be systematically characterised due to the lack of insight into key parameters such as the coefficient of friction between the floating marble and the carrier liquid. We measured the coefficient of friction of a small floating marble using a novel experimental setup that exploits the non-wetting properties of a liquid marble. A floating liquid marble pair containing a minute amount magnetite particles were immobilised and then released in a controlled manner using permanent magnets. The capillarity-driven motion was analysed to determine the coefficient of friction of the liquid marbles. The “capillary charge” model was used to fit the experimental results. We varied the marble content and carrier liquid to establish a relationship between the friction correction factor and the meniscus angle. PMID:27910916

  7. Georgia marble at the Minnesota State Capitol The Effects of Mineralogy and Climate on Durability

    NASA Astrophysics Data System (ADS)

    Whitenack, Paul; Shotwell, L. Brad; Scheffler, Michael J.

    2016-11-01

    Based on visual observations and tests made of Georgia marble units that have been in service at the historic Minnesota State Capitol for 110 years, a fielddiscernible correlation exists between marble unit mineralogical composition and unit weathering performance. Field studies noted over the course of a five-year restoration project of the capitol exterior were used to categorize the original marble cladding into four perceptible types, which were evaluated by field testing that suggested a correlation between the textural and mineralogical differences within the marble and its long-term durability. To test this theory, field-issued repair assignments made during an exterior marble restoration project at the capitol were examined statistically. The nature and frequency of assigned repairs were compared to the type of marble from which they were originally fabricated to determine whether a correlation existed. The results of this comparison provided convincing statistical verification of the link between mineralogy and durability. This hypothesis was then verified through detailed petrographic analysis in a laboratory setting, which determined that marble consisting of a smaller, more interlocked grain configuration that was more dolomitic than calcitic in its basic chemistry consistently proved to be more durable in weathering performance over time. The paper describes the process followed by the authors to categorize and study the distinct varieties of Georgia marble present on the Minnesota State Capitol, and how this information was used to guide the restoration process with the intent of maximizing the anticipated service life of new marble replacements.

  8. Measuring the Coefficient of Friction of a Small Floating Liquid Marble.

    PubMed

    Ooi, Chin Hong; Nguyen, Anh Van; Evans, Geoffrey M; Dao, Dzung Viet; Nguyen, Nam-Trung

    2016-12-02

    This paper investigates the friction coefficient of a moving liquid marble, a small liquid droplet coated with hydrophobic powder and floating on another liquid surface. A floating marble can easily move across water surface due to the low friction, allowing for the transport of aqueous solutions with minimal energy input. However, the motion of a floating marble has yet to be systematically characterised due to the lack of insight into key parameters such as the coefficient of friction between the floating marble and the carrier liquid. We measured the coefficient of friction of a small floating marble using a novel experimental setup that exploits the non-wetting properties of a liquid marble. A floating liquid marble pair containing a minute amount magnetite particles were immobilised and then released in a controlled manner using permanent magnets. The capillarity-driven motion was analysed to determine the coefficient of friction of the liquid marbles. The "capillary charge" model was used to fit the experimental results. We varied the marble content and carrier liquid to establish a relationship between the friction correction factor and the meniscus angle.

  9. Can the eastern red-backed salamander (Plethodon cinereus) persist in an acidified landscape?

    USGS Publications Warehouse

    Bondi, Cheryl A; Beier, Colin M.; Ducey, Peter K; Lawrence, Gregory B.; Bailey, Scott W.

    2016-01-01

    Hardwood forests of eastern North America have experienced decades of acidic deposition, leading to soil acidification where base cation supply was insufficient to neutralize acid inputs. Negative impacts of soil acidity on amphibians include disrupted embryonic development, lower growth rates, and habitat loss. However, some amphibians exhibit intraspecific variation in acid tolerance, suggesting the potential for local adaptation in areas where soils are naturally acidic. The eastern red-backed salamander (Plethodon cinereus) is a highly abundant top predator of the northern hardwood forest floor. Early research found that P. cinereus was sensitive to acidic soils, avoiding substrates with pH < 3.8 and experiencing decreased growth rates in acidic habitats. However, recent studies have documented P. cinereus populations in lower pH conditions than previously observed, suggesting some populations may persist in acidic conditions. Here, we evaluated relationships between organic horizon soil pH and P. cinereus abundance, adult health (body size and condition), and microhabitat selection, based on surveys of 34 hardwood forests in northeastern United States that encompass a regional soil pH gradient. We found no associations between soil pH and P. cinereus abundance or health, and observed that this salamander used substrates with pH similar to that available, suggesting that pH does not mediate their fine-scale distributions. The strongest negative predictor of P. cinereus abundance was the presence of dusky salamanders (Desmognathus spp.), which were most abundant in the western Adirondacks. Our results indicate that P. cinereus occupies a wider range of soil pH than has been previously thought, which has implications for their functional role in forest food webs and nutrient cycles in acid-impaired ecosystems. Tolerance of P. cinereus for more acidic habitats, including anthropogenically acidified forests, may be due to local adaptation in

  10. Sound production in marbled rockfish (Sebastiscus marmoratus) and implications for fisheries.

    PubMed

    Zhang, Xuguang; Guo, Hongyi; Zhang, Shouyu; Song, Jiakun

    2015-01-01

    Recently, several rockfish species (genus Sebastes) have been reported to be soniferous. To determine whether an additional rockfish species produces sounds, passive acoustic recordings were analyzed from captive marbled rockfish (Sebastiscus marmoratus) during the non-spawning season. Three distinct sounds were identified based on frequency features. The common characteristics among all sounds were low frequency (below 300 Hz) and rapidly dampened pulses consisting of 3-5 acoustic energy cycles. During free-swimming conditions in the canvas tank, the fish produced voluntary sounds with lower frequencies than the disturbance sounds produced by individuals during prodding. Two types of sounds were identified in the disturbance context: one type consists of single or double pulses with two peak frequencies, and another type consists of a series of pulses with a single peak frequency. These results suggest that specific-species and behavior-associated sounds are potentially useful in passive acoustical surveys to monitor rockfish populations and distributions remotely.

  11. Geographic variation, genetic structure and conservation unit designation in the larch mountain salamander( Plethodon larselli)

    USGS Publications Warehouse

    Wagner, R.S.; Miller, Mark P.; Crisafulli, Charles; Haig, Susan M.

    2005-01-01

    The Larch Mountain salamander (Plethodon larselli Burns, 1954) is an endemic species in the Pacific northwestern United States facing threats related to habitat destruction. To facilitate development of conservation strategies, we used DNA sequences and RAPDs (random amplified polymorphic DNA) to examine differences among populations of this species. Phylogenetic analyses of cytochrome b revealed a clade of haplotypes from populations north of the Columbia River derived from a clade containing haplotypes from the river's southwestern region. Haplotypes from southeastern populations formed a separate clade. Nucleotide diversity was reduced in northern populations relative to southern populations. These results were corroborated by analyses of RAPD loci, which revealed similar patterns of clustering and diversity. Network analyses suggested that northern populations were colonized following a range expansion mediated by individuals from populations located southwest of the river. Changes in the Columbia River's location during the Pliocene and Pleistocene likely released distributional constraints on this species, permitting their northern range expansion. Based on the barrier presented by the Columbia River's present location and differences in haplotype diversity and population structure observed between northern and southern populations, we suggest that designation of separate management units encompassing each region may assist with mitigating different threats to this species.

  12. Fluctuations in a metapopulation of nesting four-toed salamanders, Hemidactylium scutatum, in the Great Smoky Mountains National Park, USA, 1999-2003

    USGS Publications Warehouse

    Corser, J.D.; Dodd, C.K.

    2004-01-01

    We tested two predictions associated with the hypothesis that certain populations of pond-breeding amphibians are structured into metapopulations using minimum relative abundance estimates of nesting four-toed salamanders (Hemidactylium scutatum Schlegel) from 11 different ponds in the Great Smoky Mountains National Park. Coefficients of variation (CV) for counts at individual ponds ranged from 0.25 to 1.26, and the overall mean CV at all 11 ponds was 0.34. Many pairs of ponds had negative correlations in abundance from 1999-2003, whereas others had various degrees of positive correlation (mean r = 0.29). Thus, nesting population size fluctuated semi-independently among the ponds from year to year, inferring the existence of inter-pond dispersal. The mean number of nesting females at a pond was negatively, but non-significantly, correlated (r = -0.27; P = 0.40; 10 d.f.) to the pond's isolation. Owing to physiological constraints on plethodontid salamander energetics, precipitation during the nesting season (February and March) appeared to play an important role (r = 0.78; P = 0.12; 4 d.f.) in the number of nesting females we observed. Unlike some other plethodontid salamander populations in more fragmented southern Appalachian forest ecosystems, this (meta)population within Great Smoky Mountains National Park does not appear to be declining.

  13. New species of kathlaniid (Nematoda: Cosmocercoidea) collected from hynobiid salamanders in Japan.

    PubMed

    Hasegawa, Hideo; Nishikawa, Kanto

    2009-02-01

    Falcaustra odaiensis n. sp. (Nematoda: Cosmocercoidea: Kathlaniidae) is described from the Japanese clawed salamander, Onychodactylus japonicus (Houttuyn, 1782), and Ishizuchi salamander, Hynobius hirosei Lantz, 1931 (Caudata: Hynobiidae), in Japan. This nematode is characterized by having multiple pseudosuckers in the male. It resembles Falcaustra araxiana, Falcaustra duyagi, Falcaustra lambdiensis, Falcaustra pillaii, Falcaustra siamensis, and Falcaustra washingtonensis, but is readily distinguished by the spicule length and/or egg size. This is the first Falcaustra species described from Japanese salamanders.

  14. Variation in phenology and density differentially affects predator-prey interactions between salamanders.

    PubMed

    Anderson, Thomas L; Rowland, Freya E; Semlitsch, Raymond D

    2017-09-11

    Variation in the timing of breeding (i.e., phenological variation) can affect species interactions and community structure, in part by shifting body size differences between species. Body size differences can be further altered by density-dependent competition, though synergistic effects of density and phenology on species interactions are rarely evaluated. We tested how field-realistic variation in phenology and density affected ringed salamander (Ambystoma annulatum) predation on spotted salamanders (Ambystoma maculatum), and whether these altered salamander dynamics resulted in trophic cascades. In outdoor mesocosms, we experimentally manipulated ringed salamander density (low/high) and breeding phenology (early/late) of both species. Ringed salamander body size at metamorphosis, development, and growth were reduced at higher densities, while delayed phenology increased hatchling size and larval development, but reduced relative growth rates. Survival of ringed salamanders was affected by the interactive effects of phenology and density. In contrast, spotted salamander growth, size at metamorphosis, and survival, as well as the biomass of lower trophic levels, were negatively affected primarily by ringed salamander density. In an additional mesocosm experiment, we isolated whether ringed salamanders could deplete shared resources prior to their interactions with spotted salamanders, but instead found direct interactions (e.g., predation) were the more likely mechanism by which ringed salamanders limited spotted salamanders. Overall, our results indicate the effects of phenological variability on fitness-related traits can be modified or superseded by differences in density dependence. Identifying such context dependencies will lead to greater insight into when phenological variation will likely alter species interactions.

  15. The effects of 24-h exposure to carbaryl or atrazine on the locomotor performance and overwinter growth and survival of juvenile spotted salamanders (Ambystoma maculatum).

    PubMed

    Mitchkash, Matthew G; McPeek, Tammy; Boone, Michelle D

    2014-03-01

    Understanding the effects of pesticide exposure on organisms throughout their life cycle is critical to predict population-level effects. For many taxa, including amphibians, juveniles are the main dispersal stage and are disproportionally important to population persistence when compared with other life stages. In the present study, we examined the effects of a single 24-h exposure to the insecticide carbaryl or the herbicide atrazine on locomotor performance (endurance, distance traveled, speed, and fatigue) in the laboratory and terrestrial growth and survival through overwintering in field enclosures using recent metamorphs of spotted salamanders (Ambystoma maculatum). We found that neither atrazine nor carbaryl impacted endurance, but fatigue increased with carbaryl exposure, which could leave salamanders less able to escape repeated attacks by predators. Terrestrial growth and overwinter survival were not affected by short-term exposure to carbaryl or atrazine, suggesting that when individuals can overcome acute effects, no long-term consequences result for the endpoints measured.

  16. High occupancy of stream salamanders despite high ranavirus prevalence in a southern appalachians watershed.

    PubMed

    Rothermel, Betsie B; Travis, Emilie R; Miller, Debra L; Hill, Robert L; McGuire, Jessica L; Yabsley, Michael J

    2013-06-01

    The interactive effects of environmental stressors and emerging infectious disease pose potential threats to stream salamander communities and their headwater stream ecosystems. To begin assessing these threats, we conducted occupancy surveys and pathogen screening of stream salamanders (Family Plethodontidae) in a protected southern Appalachians watershed in Georgia and North Carolina, USA. Of the 101 salamanders screened for both chytrid fungus (Batrachochytrium dendrobatidis) and Ranavirus, only two exhibited low-level chytrid infections. Prevalence of Ranavirus was much higher (30.4% among five species of Desmognathus). Despite the ubiquity of ranaviral infections, we found high probabilities of site occupancy (≥0.60) for all stream salamander species.

  17. Rapid fixation of non-native alleles revealed by genome-wide SNP analysis of hybrid tiger salamanders

    PubMed Central

    Fitzpatrick, Benjamin M; Johnson, Jarrett R; Kump, D Kevin; Shaffer, H Bradley; Smith, Jeramiah J; Voss, S Randal

    2009-01-01

    Background Hybrid zones represent valuable opportunities to observe evolution in systems that are unusually dynamic and where the potential for the origin of novelty and rapid adaptation co-occur with the potential for dysfunction. Recently initiated hybrid zones are particularly exciting evolutionary experiments because ongoing natural selection on novel genetic combinations can be studied in ecological time. Moreover, when hybrid zones involve native and introduced species, complex genetic patterns present important challenges for conservation policy. To assess variation of admixture dynamics, we scored a large panel of markers in five wild hybrid populations formed when Barred Tiger Salamanders were introduced into the range of California Tiger Salamanders. Results At three of 64 markers, introduced alleles have largely displaced native alleles within the hybrid populations. Another marker (GNAT1) showed consistent heterozygote deficits in the wild, and this marker was associated with embryonic mortality in laboratory F2's. Other deviations from equilibrium expectations were idiosyncratic among breeding ponds, consistent with highly stochastic demographic effects. Conclusion While most markers retain native and introduced alleles in expected proportions, strong selection appears to be eliminating native alleles at a smaller set of loci. Such rapid fixation of alleles is detectable only in recently formed hybrid zones, though it might be representative of dynamics that frequently occur in nature. These results underscore the variable and mosaic nature of hybrid genomes and illustrate the potency of recombination and selection in promoting variable, and often unpredictable genetic outcomes. Introgression of a few, strongly selected introduced alleles should not necessarily affect the conservation status of California Tiger Salamanders, but suggests that genetically pure populations of this endangered species will be difficult to maintain. PMID:19630983

  18. Rapid fixation of non-native alleles revealed by genome-wide SNP analysis of hybrid tiger salamanders.

    PubMed

    Fitzpatrick, Benjamin M; Johnson, Jarrett R; Kump, D Kevin; Shaffer, H Bradley; Smith, Jeramiah J; Voss, S Randal

    2009-07-24

    Hybrid zones represent valuable opportunities to observe evolution in systems that are unusually dynamic and where the potential for the origin of novelty and rapid adaptation co-occur with the potential for dysfunction. Recently initiated hybrid zones are particularly exciting evolutionary experiments because ongoing natural selection on novel genetic combinations can be studied in ecological time. Moreover, when hybrid zones involve native and introduced species, complex genetic patterns present important challenges for conservation policy. To assess variation of admixture dynamics, we scored a large panel of markers in five wild hybrid populations formed when Barred Tiger Salamanders were introduced into the range of California Tiger Salamanders. At three of 64 markers, introduced alleles have largely displaced native alleles within the hybrid populations. Another marker (GNAT1) showed consistent heterozygote deficits in the wild, and this marker was associated with embryonic mortality in laboratory F2's. Other deviations from equilibrium expectations were idiosyncratic among breeding ponds, consistent with highly stochastic demographic effects. While most markers retain native and introduced alleles in expected proportions, strong selection appears to be eliminating native alleles at a smaller set of loci. Such rapid fixation of alleles is detectable only in recently formed hybrid zones, though it might be representative of dynamics that frequently occur in nature. These results underscore the variable and mosaic nature of hybrid genomes and illustrate the potency of recombination and selection in promoting variable, and often unpredictable genetic outcomes. Introgression of a few, strongly selected introduced alleles should not necessarily affect the conservation status of California Tiger Salamanders, but suggests that genetically pure populations of this endangered species will be difficult to maintain.

  19. Dusky salamanders (Desmognathus, Plethodontidae) from the Coastal Plain: multiple independent lineages and their bearing on the molecular phylogeny of the genus.

    PubMed

    Beamer, David A; Lamb, Trip

    2008-04-01

    Recent phylogenetic reassessment of the lungless salamanders (Plethodontidae) confirmed a major life-history reversal-from direct development to an aquatic larval stage-in the dusky salamanders (Desmognathus) of eastern North America. This reversal initiated high rates of lineage accumulation, reputedly generating the species richness and ecological breath that now characterize Desmognathus. Certain important aspects of the radiation, e.g., ecomorphological evolution, have been identified through intense sampling effort of Appalachian Highland lineages. However, the research preoccupation on montane species has left overlooked a significant component of dusky salamander distribution-the Coastal Plain. We present the first molecular phylogeny for Desmognathus to incorporate extensive coverage from the Atlantic and Gulf coastal plains. We examined 38 Coastal Plain populations in conjunction with 45 additional populations, representing 16 of the 19 nominal species. Bayesian analysis of 88 mitochondrial cox1 haplotypes diagnosed eight independent population lineages within the Coastal Plain, a number at odds with the region's three currently recognized species. Desmognathus has apparently experienced a complex biogeographic history in this physiographic region, one involving multiple invasions and several ecological transitions from lotic to lentic habitats.

  20. Apparent predation by Gray Jays, Perisoreus canadensis, on Long-toed Salamanders, Ambystoma macrodactylum, in the Oregon Cascade Range

    USGS Publications Warehouse

    Murray, M.P.; Pearl, C.A.; Bury, R.B.

    2005-01-01

    We report observations of Gray Jays (Perisoreus canadensis) appearing to consume larval Long-toed Salamanders (Ambystoma macrodactylum) in a drying subalpine pond in Oregon, USA. Corvids are known to prey upon a variety of anuran amphibians, but to our knowledge, this is the first report of predation by any corvid on aquatic salamanders. Long-toed Salamanders appear palatable to Gray Jays, and may provide a food resource to Gray Jays when salamander larvae are concentrated in drying temporary ponds.

  1. Influence of surrounding environment on subcritical crack growth in marble

    NASA Astrophysics Data System (ADS)

    Nara, Yoshitaka; Kashiwaya, Koki; Nishida, Yuki; , Toshinori, Ii

    2017-06-01

    Understanding subcritical crack growth in rock is essential for determining appropriate measures to ensure the long-term integrity of rock masses surrounding structures and for construction from rock material. In this study, subcritical crack growth in marble was investigated experimentally, focusing on the influence of the surrounding environment on the relationship between the crack velocity and stress intensity factor. The crack velocity increased with increasing temperature and/or relative humidity. In all cases, the crack velocity increased with increasing stress intensity factor. However, for Carrara marble (CM) in air, we observed a region in which the crack velocity still increased with temperature, but the increase in the crack velocity with increasing stress intensity factor was not significant. This is similar to Region II of subcritical crack growth observed in glass in air. Region II in glass is controlled by mass transport to the crack tip. In the case of rock, the transport of water to the crack tip is important. In general, Region II is not observed for subcritical crack growth in rock materials, because rocks contain water. Because the porosity of CM is very low, the amount of water contained in the marble is also very small. Therefore, our results imply that we observed Region II in CM. Because the crack velocity increased in both water and air with increasing temperature and humidity, we concluded that dry conditions at low temperature are desirable for the long-term integrity of a carbonate rock mass. Additionally, mass transport to the crack tip is an important process for subcritical crack growth in rock with low porosity.

  2. Grain growth in synthetic marbles with added mica and water

    NASA Astrophysics Data System (ADS)

    Olgaard, D. L.; Evans, B.

    1988-10-01

    Evolution of grain size in synthetic marbles was traced from compaction of unconsolidated powder, through primary recrystallization and normal grain growth, to a size stabilized by second phases. To form the marbles, reagent grade CaCO3 was mixed with 0, 1 and 5 volume% mica and heat-treated under pressure with added water. Densification with negligible recrystallization occurred within one hour at 500° C and 500 MPa confining pressure. Primary recrystallization occurred at 500 550° C, causing increases of grain size of factors of 2 5. Resulting samples had uniform grain size, gently curved grain boundaries, and near-equilibrium triple junctions; they were used subsequently for normal grain growth studies. Normal grain growth occurred above 550° C; at 800° C, grain size ( D) increased from 7 μm ( D 0) to 65 μm in 24 hours. Growth rates fit the equation, D n - D {0/ n }= Kt, where K is a constant and n≃2.6. Minor amounts of pores or mica particles inhibit normal grain growth and lead to a stabilized grain size, D max, which depends on the size of the second phases and the inverse of their volume fraction raised to a power between 0.3 and 1. Once D max is reached, normal growth continues only if second phases are mobile or coarsen, or if new driving forces are introduced that cause unpinning of boundaries. Normal grain growth in Solnhofen limestone was significantly slower than in pure synthetic marble, suggesting that migration is also inhibited by second phases in the limestone.

  3. Transgranular Crack Nucleation in Carrara Marble of Brittle Failure

    NASA Astrophysics Data System (ADS)

    Cheng, Yi; Wong, Louis Ngai Yuen; Maruvanchery, Varun

    2016-08-01

    Understanding the microcrack nucleation is of a fundamental importance in the study of rock fracturing process. Due to variations in texture and mineralogy, different rocks may show different distinctive microcrack nucleation mechanisms. In order to understand the microcrack nucleation mechanisms in Carrara marble comprehensively, localized damage zones are artificially produced by loading specimens containing an array of en-echelon flaws in this study. Then, representative samples were cut from those loaded specimens and prepared for optical observation. Four types of microcrack nucleation mechanisms leading to the formation of transgranular cracks have been identified in Carrara marble. Type I and II mechanisms are favored by the distinctive polygonal shape of the crystal grains in Carrara marble. Local tensile stress concentration in these two mechanisms is attributed to grain sliding and divergent normal contact force, respectively. Type III mechanism is associated with the gliding along twin lamellae. The resultant tensile stress concentration could nucleate microcracks within the grain containing these lamellae or in the grain boundary. No microcracks in the adjoining grains were observed in this study. Our statistical analysis suggests that type III mechanism favors the nucleation of new cracks which are nearly perpendicular to the gently inclined twin lamellae and thus have a small angle with the maximum loading direction (about 15°). Type IV mechanism operates in grains failed mainly due to compressive stress rather than tensile stress concentration. Sets of parallel microcracks of this mechanism seem to be related to the crystallographic planes of calcite. The microcracking results also suggest that most of the grain boundaries in damaged zone have been cracked at the loading about 80 % of the specimen strength, while transgranular cracks begin to occur at that time and flourish after about 90 % loading of the strength.

  4. Detecting cryptic species in phylogeographic studies: speciation in the California Slender Salamander, Batrachoseps attenuatus.

    PubMed

    Highton, Richard

    2014-02-01

    A study of DNA sequence variation in the plethodontid salamander Batrachoseps attenuatus by Martínez-Solano et al. (2007) revealed more species than acknowledged by the authors. They sequenced 677 base pairs of the cytochrome-b mitochondrial gene in 178 individuals from 123 populations of the currently recognized species B. attenuatus from throughout most of its known range in southwestern Oregon and northern and central California. Their data show that the common ancestor of the species diverged into five clades during the late Miocene Epoch, an estimated 9.2-5.5 mya, with subsequent divergences producing at least 39 living lineages that replace each other geographically. These groups have been diverging independently from each other throughout the Pleistocene Epoch and many of them have probably reached the species level of divergence.

  5. Marble-type glass based on blast furnace slag

    SciTech Connect

    Sarkisov, P.D.; Smirnov, V.G.; Trifonova, T.E.; Sergeev, Yu.N.

    1987-01-01

    This paper discusses the recovery and use of blast furnace wastes as coloring agents in the manufacture of imitation marble glass. The slags consist of a series of metal oxides each of which is tested for the color it generates when reacted and annealed with the molten glass. Comparative tests were also run against non-waste coloring agents and it was found that the waste-derived colorants were equal or superior both in process behavior and in generating the appropriate optical properties in the finished glass.

  6. Genome Sequence of a Marbled Eel Polyoma-Like Virus in Taiwan.

    PubMed

    Wen, Chiu-Ming; Liu, Ping-Chung; Nan, Fan-Hua

    2017-02-09

    We report here the complete genome sequence of a virus isolated from a diseased marbled eel (Anguilla marmorata) in Taiwan. The virus has been characterized as being related to Japanese eel endothelial cell-infecting virus (JEECV), with a large T-antigen-like protein. The sequence of the marbled eel virus displays low homology to the JEECV.

  7. Genome Sequence of a Marbled Eel Polyoma-Like Virus in Taiwan

    PubMed Central

    Liu, Ping-Chung

    2017-01-01

    ABSTRACT We report here the complete genome sequence of a virus isolated from a diseased marbled eel (Anguilla marmorata) in Taiwan. The virus has been characterized as being related to Japanese eel endothelial cell-infecting virus (JEECV), with a large T-antigen-like protein. The sequence of the marbled eel virus displays low homology to the JEECV. PMID:28183770

  8. Don't Lose Your Marbles!: Game Project Teaches Introductory Manufacturing Skills

    ERIC Educational Resources Information Center

    Kapur, Arjun; Carter, Horlin; Dillon, Dave

    2006-01-01

    This article describes a lab activity conducted in an introductory manufacturing class. In this good, simple, mass-production project, the students designed and produced a small game composed of a piece of plywood and 14 glass marbles. In appearance, the game is something like Chinese checkers, but it involves jumping over marbles, then removing…

  9. Catalytic liquid marbles: Ag nanowire-based miniature reactors for highly efficient degradation of methylene blue.

    PubMed

    Miao, Yue-E; Lee, Hiang Kwee; Chew, Wee Shern; Phang, In Yee; Liu, Tianxi; Ling, Xing Yi

    2014-06-04

    Ag nanowire-based catalytic liquid marbles are fabricated as miniature reactors, which demonstrate highly efficient, support-free and rate-controllable heterogeneous degradation of methylene blue, with catalytic efficiency close to 100%. Our miniature catalytic liquid marbles are essential for reactions involving highly toxic/hazardous or costly reactants, where small volume preliminary reactions are preferred.

  10. Genetic evaluation of Angus cattle for carcass marbling using ultrasound and genomic indicators

    USDA-ARS?s Scientific Manuscript database

    Objectives were to estimate genetic parameters needed to elucidate the relationships of a molecular breeding value for marbling (MBV), intramuscular fat of yearling bulls measured with ultrasound (IMF) and marbling score of harvested steers (MRB), and to assess the utility of MBV and IMF in predicti...

  11. Chapter 1: Ecology and Conservation of the Marbled Murrelet in North America: An Overview

    Treesearch

    C. John Ralph; Jr. Hunt; Martin G. Raphael; John F. Piatt

    1995-01-01

    Over the past decade, the Marbled Murrelet has become a focus of much controversy. It was listed as threatened in Washington, Oregon, and California by the U.S. Fish and Wildlife Service in February 1993. In order to aid the various agencies with management, the Marbled Murrelet Conservation Assessment was formed to bring together scientists, managers, and others to...

  12. Don't Lose Your Marbles!: Game Project Teaches Introductory Manufacturing Skills

    ERIC Educational Resources Information Center

    Kapur, Arjun; Carter, Horlin; Dillon, Dave

    2006-01-01

    This article describes a lab activity conducted in an introductory manufacturing class. In this good, simple, mass-production project, the students designed and produced a small game composed of a piece of plywood and 14 glass marbles. In appearance, the game is something like Chinese checkers, but it involves jumping over marbles, then removing…

  13. "Right-Throughs, Rings, and Taws": Marbles Pitching Terminology in Trinidad and Tobago.

    ERIC Educational Resources Information Center

    Winer, Lise; Boos, Hans E. A.

    Marble games, or pitch, are among the most widely played of traditional boys' games in Trinidad and Tobago and have declined in the last two decades. Nearly 200 marbles terms found in Trinidad and Tobago English Creole are documented. Although most are British in origin, there are East Indian, French Creole, and possible African influences on this…

  14. Retention of low-fitness genotypes over six decades of admixture between native and introduced tiger salamanders

    PubMed Central

    2010-01-01

    Background Introductions of non-native tiger salamanders into the range of California tiger salamanders have provided a rare opportunity to study the early stages of secondary contact and hybridization. We produced first- and second-generation hybrid salamanders in the lab and measured viability among these early-generation hybrid crosses to determine the strength of the initial barrier to gene exchange. We also created contemporary-generation hybrids in the lab and evaluated the extent to which selection has affected fitness over approximately 20 generations of admixture. Additionally, we examined the inheritance of quantitative phenotypic variation to better understand how evolution has progressed since secondary contact. Results We found significant variation in the fitness of hybrids, with non-native backcrosses experiencing the highest survival and F2 hybrids the lowest. Contemporary-generation hybrids had similar survival to that of F2 families, contrary to our expectation that 20 generations of selection in the wild would eliminate unfit genotypes and increase survival. Hybrid survival clearly exhibited effects of epistasis, whereas size and growth showed mostly additive genetic variance, and time to metamorphosis showed substantial dominance. Conclusions Based on first- and second- generation cross types, our results suggest that the initial barrier to gene flow between these two species was relatively weak, and subsequent evolution has been generally slow. The persistence of low-viability recombinant hybrid genotypes in some contemporary populations illustrates that while hybridization can provide a potent source of genetic variation upon which natural selection can act, the sorting of fit from unfit gene combinations might be inefficient in highly admixed populations. Spatio-temporal fluctuation in selection or complex genetics has perhaps stalled adaptive evolution in this system despite selection for admixed genotypes within generations. PMID:20482794

  15. Retention of low-fitness genotypes over six decades of admixture between native and introduced tiger salamanders.

    PubMed

    Johnson, Jarrett R; Fitzpatrick, Benjamin M; Shaffer, H Bradley

    2010-05-18

    Introductions of non-native tiger salamanders into the range of California tiger salamanders have provided a rare opportunity to study the early stages of secondary contact and hybridization. We produced first- and second-generation hybrid salamanders in the lab and measured viability among these early-generation hybrid crosses to determine the strength of the initial barrier to gene exchange. We also created contemporary-generation hybrids in the lab and evaluated the extent to which selection has affected fitness over approximately 20 generations of admixture. Additionally, we examined the inheritance of quantitative phenotypic variation to better understand how evolution has progressed since secondary contact. We found significant variation in the fitness of hybrids, with non-native backcrosses experiencing the highest survival and F2 hybrids the lowest. Contemporary-generation hybrids had similar survival to that of F2 families, contrary to our expectation that 20 generations of selection in the wild would eliminate unfit genotypes and increase survival. Hybrid survival clearly exhibited effects of epistasis, whereas size and growth showed mostly additive genetic variance, and time to metamorphosis showed substantial dominance. Based on first- and second- generation cross types, our results suggest that the initial barrier to gene flow between these two species was relatively weak, and subsequent evolution has been generally slow. The persistence of low-viability recombinant hybrid genotypes in some contemporary populations illustrates that while hybridization can provide a potent source of genetic variation upon which natural selection can act, the sorting of fit from unfit gene combinations might be inefficient in highly admixed populations. Spatio-temporal fluctuation in selection or complex genetics has perhaps stalled adaptive evolution in this system despite selection for admixed genotypes within generations.

  16. Ecological radiation with limited morphological diversification in salamanders.

    PubMed

    Blankers, Thomas; Adams, D C; Wiens, J J

    2012-04-01

    A major goal of evolutionary biology is to explain morphological diversity among species. Many studies suggest that much morphological variation is explained by adaptation to different microhabitats. Here, we test whether morphology and microhabitat use are related in plethodontid salamanders, which contain the majority of salamander species, and have radiated into a striking diversity of microhabitats. We obtained microhabitat data for 189 species that also had both morphometric and phylogenetic data. We then tested for associations between morphology and microhabitat categories using phylogenetic comparative methods. Associations between morphology and ecology in plethodontids are largely confined to a single clade within one subfamily (Bolitoglossinae), whereas variation in morphology across other plethodontids is unrelated to microhabitat categories. These results demonstrate that ecological radiation and morphological evolution can be largely decoupled in a major clade. The results also offer a striking contrast to lizards, which typically show close relationships between morphology and microhabitat.

  17. Salamander Blue-sensitive Cones Lost During Metamorphosis†

    PubMed Central

    Chen, Ying; Znoiko, Sergey; DeGrip, Willem J.; Crouch, Rosalie K.; Ma, Jian-xing

    2009-01-01

    The tiger salamander lives in shallow water with bright light in the aquatic phase, and in dim tunnels or caves in the terrestrial phase. In the aquatic phase, there are five types of photoreceptors—two types of rods and three types of cones. Our previous studies showed that the green rods and blue-sensitive cones contain the same visual pigment and have the same absorbance spectra; however, the green rods have a larger photon-catch area and thus have higher light sensitivity than the blue-sensitive cones. Here we show that after metamorphosis, the terrestrial salamander looses the blue-sensitive cones, while the density of the green rods increases. Moreover, the size of the green rod outer segments is increased in the terrestrial phase, compared to that in the aquatic phase. This switch from the blue-sensitive cones to the green rods may represent an adaptation to the dim light environment of the terrestrial phase. PMID:18331398

  18. Evaluation of Slip Potentials on Bilecik Beige Marble with Pendulum Method

    NASA Astrophysics Data System (ADS)

    Erdem Çerçevik, Ali; Yerel Kandemir, Suheyla; Ozgur Yayli, M.

    2016-10-01

    This study deals with the determining of slip resistance and classification of slip potential for 5 different type of Bilecik Beige Marble were applied tumbling. TS EN 14231 Standard “Determination of Slip Resistance with Pendulum Friction Test Equipment” was basically utilized in determining the slip resistances of Bilecik Beige Marble with wet and dry surfaces. After tumbling process, by depending on the Bilecik Beige Marble type reduce slip potential, especially wet conditions. Slip resistance values on marble sample plates were specified to be considerably change by depending on both the applied surface processing techniques and dry/wet of surface characteristics. Finally, marbles used in this research have been classified according to safety applications by taking into account their slip resistance values.

  19. Effect of grain size and heavy metals on As immobilization by marble particles.

    PubMed

    Simón, M; García, I; González, V; Romero, A; Martín, F

    2015-05-01

    The effect of grain size and the interaction of heavy metals on As sorption by marble waste with different particle sizes was investigated. Acidic solutions containing only arsenic and a mixture of arsenic, lead, zinc, and cadmium were put in contact with the marble waste. The amount of metal(loid)s that were immobilized was calculated using the difference between the concentration in the acidic solution and in the liquid phase of the suspensions. Approximately 420 μg As m(-2) was sorbed onto the marble grains, both nonspecifically and specifically, where ≥ 80 % of the total arsenic in the acidic solution remained soluble, which suggests that this amendment is not effective to immobilize arsenic. However, in mixed contamination, relatively stable Pb-Ca arsenates were formed on the surface of the marble particles, and the soluble arsenic was reduced by 95 %, which indicates that marble particles can effectively immobilize arsenic and lead when both appear together.

  20. 76 FR 26280 - Vermont Marble Power Division of Omya Inc.; Notice of Application Accepted for Filing, Soliciting...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-05-06

    ... Energy Regulatory Commission Vermont Marble Power Division of Omya Inc.; Notice of Application Accepted.... Date filed: March 31, 2010. d. Applicant: Vermont Marble Power Division of Omya Inc. e. Name of Project... Marble Power Division of Omya Inc., 9987 Carver Road, Suite 300, Cincinnati, OH 45242; Telephone (513...